HBVdb

Dataset for protein HBc of genotype A

[Download (right click)] [Edit] [Sequences] [Repertoires]

1523 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


MF536836_HBc_P-A      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLHTASALYREALESPEHCSS
DQ298162_HBc_P-A      MDIDTYKEFGATVELLSFLPPDFFPSVRDLLDTASALFREALESPEHCSP
AY236166_HBc_P-A      MDVDTYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSP
DQ298164_HBc_P-A      MDVDTYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSP
AY230111_HBc_P-A      MDIDTYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSP
AY236167_HBc_P-A      MDIDTYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSP
AY236169_HBc_P-A      MDIDTYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSP
DQ298161_HBc_P-A      MDIDTYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSP
DQ298165_HBc_P-A      MDIDTYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSP
AY236165_HBc_P-A      MDIDTYKEFGATVELLSFLPPDFFPSVRDLLDTASALFREALESPEHCSP
AY236168_HBc_P-A      MDIDTYKEFGATVELLSFLPPDFFPSVRDLLDTASALFREALESPEHCSP
DQ298163_HBc_P-A      MDIDTYKEFGATVELLSFLPPDFFPSVRDLLDTASALFREALESPEHCSP
KP857070_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
KP857071_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREXLESPEHCSP
KP857091_HBc_P-A      MDIDPYKEFGATVELLSFLPHDFFPSIRDLLDTASALYREALESPEHCSH
GQ477474_HBc_P-A      MDIDPYKEFGASVELISFLPSDFFPSVRDLLDTASALYREALESSEHCSP
JF439821_HBc_P-A      RDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYQEALKSPEHCSP
KP857088_HBc_P-A      MDIDPYKEFGASVELLSFLPLDFFPSVRDLLDTASALFREALESPEHCSP
KM606662_HBc_P-A      MDIDPYKEFGASVELLSFLPHDFFPSAPDLLDTAAALYREALESPEHCTP
GQ477493_HBc_P-A      MDIDPYKEFGASVELLSFLPTDFFPSARDLLDTASALYREALESPEHCSP
KP857068_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ477477_HBc_P-A      MDIDPYKEFGASASLLSFLPHDFFPSVRDLLDTATALFQEALESPEHCSS
AB116076_HBc_P-A      MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYQEALESPEHCSP
AF324122_HBc_P-A      MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYQEALESPEHCSP
AB076679_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857066_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVKDLYDTALALHREALESPEHCTH
KM606647_HBc_P-A      MDIDHYKEFGATVELLSFLPLDFFPSARDLLETASALYRESLESPEHCSP
JF439767_HBc_P-A      MDIDPYKEFGATVELLSVLPCDFFPSVPDLLHAASTWYQEVLKSPGHCSP
GQ477499_HBc_P-A      MDIDPYKEFGASVELLSFLPLDFYPSVRDLLDTASALYREALESPEHCTP
GQ477480_HBc_P-A      MDIDPYKEFGASTELLSFLPSDFFPNVRDLLDTASALYREALESPEHCTP
GQ477473_HBc_P-A      MDIDPYKEFGASVELLSFLPLDFFPSARDLLDTASALYREGLESPEHCSP
AB116088_HBc_P-A      MDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSS
KY353919_HBc_P-A      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTSSALFREALESPEHCSH
GU563547_HBc_P-A      MDIDPYKEFGATTDLLSFLPSDFFPSVRDLRDTTSALYREALESPEHCSS
FJ692595_HBc_P-A      MDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTATALYREALESPEHCSP
AB453989_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSA
AB246317_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB116087_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSR
AB116082_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857086_HBc_P-A      MDIDPYKEFGASAQLLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
KP857075_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESSEHCSP
KP857060_HBc_P-A      MDIDPYKEFGATVELLSFLPPDFFPSARDLLDTAAALFREALESPEHCSP
KM606649_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
FN545830_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTP
FJ692599_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
FJ349296_HBc_P-A      MDIDPYKEFGATGELLSFLPSDFFPSVRDLLNTASALYREALKSPGHCSP
EU304331_HBc_P-A      MDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSS
AJ627227_HBc_P-A      MDIDLYKEFGASVELLSFLPXDFYPSVRDLLDTAXALYREALESPEHCSP
AB116092_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVAALFRDALESPEHCSA
JF439921_HBc_P-A      MDIDPYKEFGATVELLSFLPSDSFPSVRDLLDTASALFRDALESPEHCSP
JF439929_HBc_P-A      MDIDPYKEFGATVELLSFLPSDSFPSVRDLLDTASALFRDALESPEHCSP
MF925362_HBc_P-A      MDIDPYKEFGATVELLSFLPHDFFPNVRDLLDTASALFREALESPEHCSP
KP857081_HBc_P-A      MDIDPYKEFGASVELLSFLPADFFPSVKDLLDTASALYREALESXEHCTP
KP857073_HBc_P-A      MDIDPYKEFGASVELLSFLPADFYPSVRDLLDTATALYREALESPEHCSA
KF922429_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSP
KF922431_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSP
JF439932_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
GQ477469_HBc_P-A      MDIDPYKEFGATAELLSFLPLDFFPSVRDLLDTASALYREALESPEHCSA
AY034878_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
AJ627228_HBc_P-A      MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSP
AB453986_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692593_HBc_P-A      MDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
KY353918_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALFRDALESPEHCTP
KX357649_HBc_P-A      MDIDPYKEFGATVELLSFLPRDFYPSVRDLIDTASALFREALESPEHCSP
KR905427_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALEAPEHCSP
KP857085_HBc_P-A      MDIDPYKEFGATVELLSFLPIDFFPSVRDLLDTASALYREALESPEHCTP
KP857078_HBc_P-A      MDIDPYKEFGASVELLSFLPADFFPSTKDLLDTASALYREALESPEHCSP
KP857064_HBc_P-A      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALEAPEHCSP
KF922437_HBc_P-A      MDIDPYKEFGSTVELLSFLPSDFFPSVRDLLDTASALYREGLESPEHCSP
KF922430_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSP
JF439926_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
FJ692588_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692586_HBc_P-A      MDIDPYKEFGATVELLSFLPADFFPSARDLLDTASALYREALESPEHCSP
EU366129_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALFREALESPEHCSP
AJ627226_HBc_P-A      MDIDPYKEFGATAELLSFLPPDFFPSARDLLDTASALFRDALESPEHCSA
AF537372_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB116086_HBc_P-A      MDIDPYKEFGATADLLSFLPSDFFPSVQDLLDTASALYREALESPVHCSP
KT151612_HBc_P-A      MDIDPYKEFGATSELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT151617_HBc_P-A      MDIDPYKEFGATSELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FN545832_HBc_P-A      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRXALESPEHCTP
FN545839_HBc_P-A      MDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYRDALESPEHCTP
MF772345_HBc_P-A      MDIDPYKEFGATVDLLSFLPSDFFPSIRDLLDTASALYREALESPEHCSH
KX357644_HBc_P-A      MDIDPYKEFGATTELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ477501_HBc_P-A      MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRQALESPEHCSP
GQ477500_HBc_P-A      MDIDPYKEFGATVELLSFLPTDFFPSVKDLLDTASALYREALESSEHCSP
GQ477466_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSH
FN545829_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREGLESPEHCTP
FJ692587_HBc_P-A      MDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTAAALYREALESPEHCSP
FJ692567_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDGLESPEHCXP
AF419536_HBc_P-A      MDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTVSALYREALESPEHCSP
AF324072_HBc_P-A      MDIDPYKEFGATVELLWFLPSDFFPSVRDLLDTASALYREALESPEHCTP
AB453983_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB453982_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSS
AB362931_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
AB194951_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB116091_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
AB116089_HBc_P-A      MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB116084_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB116081_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB116078_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYQEALESPEHCSP
AB116085_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB205118_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB480036_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB480040_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB076678_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB116077_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB116079_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB116080_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB116090_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB116094_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB126580_HBc_P-A      MDIDPHKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB241114_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB241115_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB246335_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB246337_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB246338_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB300366_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB300367_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB453979_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB453980_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB453981_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB453984_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB480038_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB480039_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB480041_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB549213_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512464_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF772348_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
KY353915_HBc_P-A      MDIDLYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
KP857072_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALFREALESPEHGSS
KP857059_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSS
JF439941_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439933_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
GQ477502_HBc_P-A      MDIDPYKEFGATVELLSFLPADFFPNVRDLLDTASALYREALESPEHCSP
GQ477478_HBc_P-A      MDIDPYKEFGATVELLSFLPTDYYPSVRDLLDTASALYREALESPEHCSP
FN545828_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTP
FJ692576_HBc_P-A      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
FJ692555_HBc_P-A      MDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTASXLYREALESPEHCSP
AB937797_HBc_P-A      MDIDPYKEFGASVELLSFLPTDFFPSVKDLLDTASALYRDALESPEHCSA
AB222707_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB064314_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY353917_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
KP857092_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
KF214666_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512475_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464825_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPPVRDLLGTAAALYREALESSDHCSP
KY353916_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSA
KY353909_HBc_P-A      MDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857089_HBc_P-A      MDIDPYKEFGATTELLSFLPSDFFPNIRDLLDTASALFREALESPEHCSA
KP857083_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTP
KP857065_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSA
KP857061_HBc_P-A      MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSA
KM606688_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSP
KM606671_HBc_P-A      MDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTASALFREALESPEHCSP
JQ707598_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707582_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSS
GQ477498_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
GQ477476_HBc_P-A      MDIDPYKEFGATAELLSFLPTDFFPSVRDLLDTASALFREALESPEHCSP
GQ477475_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
FJ692611_HBc_P-A      MDIDTYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
FJ692597_HBc_P-A      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALFXEALESPEHCSP
FJ692561_HBc_P-A      MDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSP
FJ692559_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB194952_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTSAALYREALESPEHCSP
HM363612_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTSAALYREALESPEHCSP
HM363613_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTSAALYREALESPEHCSP
AB194950_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB014370_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU185765_HBc_P-A      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
KY353926_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSA
KP857080_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857077_HBc_P-A      MDIDPYKEFGASVELLSFLPIDFYPSVRDLIETASALYREALESPEHCSP
KP857074_HBc_P-A      MDIDPYKEFGATAELLSFLPNDFYPSVKDLLDTASALYREALESPEHCSA
KP857067_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESAEHCSP
KF922436_HBc_P-A      MDIDPYKEFGSTVELLSFLPSDFFPSVRDLLDTASALYREALESLEHCSP
KF922435_HBc_P-A      MDIDPYKEFGSTVELLSFLPSDFFPSVRDLLDTASALYREALESQEHCSP
JF439928_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439908_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439830_HBc_P-A      MDVDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ477491_HBc_P-A      MDIDPYKEFGASVDLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FN545840_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
FJ692607_HBc_P-A      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
FJ692566_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRESLESPEHCSP
AY373429_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB453988_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB246336_HBc_P-A      MDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB116093_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439911_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439912_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439913_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439914_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439915_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439916_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439917_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439918_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439919_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439920_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439922_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439923_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439924_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439925_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439927_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
FJ867986_HBc_P-A      MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY903452_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512458_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPDDCSP
MF925373_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF772347_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALKSPEHCSP
MF772346_HBc_P-A      MDIDPYKEFGATTELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX276769_HBc_P-A      MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSS
KT749822_HBc_P-A      MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSP
KR905429_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
KP857087_HBc_P-A      MDIDLYKEFGATVELLSFLPHDFYPSVRDLLDTASALFREALESPEHCSP
KP168428_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
KM606693_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTP
KM606658_HBc_P-A      MDIDHYKEFGASVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSP
KF922421_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922418_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798271_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
JF439942_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439940_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439939_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439938_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439937_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439936_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439935_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439934_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439931_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF439930_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALSRDALESPEHCSP
JF439909_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439896_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439748_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439742_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439738_HBc_P-A      MDIDPYREFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439737_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439733_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439732_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439731_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439728_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439725_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439722_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439721_HBc_P-A      MDIDPYKEFGATVELPSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439720_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
GU563551_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
GQ477494_HBc_P-A      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
GQ477488_HBc_P-A      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSH
GQ477487_HBc_P-A      MDIDPYKEFGATVELLSFLPHDFYPSVRDLLDTASALYREALESPEHCSP
GQ477472_HBc_P-A      MDIDPYKEFGATVELLSFLPTDFFPGVRDLLDTASALYREALESPEHCSP
GQ477464_HBc_P-A      MDIDPYKEFGATVELLSFLPLDFFPSVRDLLDTASALYREALESPEHCSP
GQ477463_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCTP
FM199977_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALQREALESHEHCSP
FJ692613_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ692608_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
FJ692606_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
FJ692604_HBc_P-A      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
FJ692602_HBc_P-A      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALHREALESPEHCSP
FJ692592_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYREGLESPEHCSP
FJ692577_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692573_HBc_P-A      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
FJ692562_HBc_P-A      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
EF103278_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSH
AY161144_HBc_P-A      MDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY161143_HBc_P-A      MDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY161142_HBc_P-A      MDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324071_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HM042263_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESAEHCSP
MK512476_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512474_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512461_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSH
KX357650_HBc_P-A      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSH
KM606657_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALFRQALESPEHCSP
KC875259_HBc_P-A      MDIDPYQEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875255_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875251_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALGSPEHCSP
JQ707607_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707594_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN182325_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
JF439953_HBc_P-A      MDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYREALESPEHCSP
JF439829_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439743_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
GQ477497_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ477486_HBc_P-A      MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTAAALFREALESPEHCSP
GQ477465_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ477462_HBc_P-A      MDIDPYKEFGASVELLSFLPHDFYPSVRDLLDTASALYREALESPEHCSP
FJ904434_HBc_P-A      MDIDPYKEFGATVELLSFLPRDFFPSVRDLLDTASALYREALESPEHCSP
FJ692603_HBc_P-A      MDIDHYKEFGAXVELLSFLPSDFYPSVRDLLDTATALYRXXLESPEHCSP
EU414133_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSP
EU414052_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSP
AY233285_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASAQYREALESPEHCSP
AJ344115_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB453987_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB116083_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU185775_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512465_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREGLESPEHCSP
MK512463_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512455_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALNREALESPEHCSP
MH464817_HBc_P-A      MDIDPYKEFGATXELLSFLPPDFFPSVRDLLDTASALYREALESPEHCSP
MF925368_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX648547_HBc_P-A      MDIDPYKEFGATXELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749833_HBc_P-A      MDIDTYKEFGATVELLSFLPSDFFPSVRDLVDTASALHREALESPEHCSP
KP995108_HBc_P-A      MDIDTYKEFGATVELLSFLPSDFYPSVRDLVDTASALYREALESPEHGSP
KP857084_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSARDLLATASALYREALESPEHCSP
KF922414_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779215_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779213_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875260_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707593_HBc_P-A      MDIDPYKEFGATAELLAFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707578_HBc_P-A      MDIDPYKEFGATAELLLFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707576_HBc_P-A      MNIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439973_HBc_P-A      MDIDPYKEFGATVELLSFLPSDSFPSVRDLLDTASALYREALESPEHCSP
JF439958_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439954_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439751_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439744_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439740_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLGSPEHCSP
JF439729_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439724_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRGALESPEHCSP
HM011485_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCXP
GQ477495_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
GQ477484_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
GQ477482_HBc_P-A      MDIDHYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ477479_HBc_P-A      MDIDPYKEFGATVELLSFLPADYYPSVRDLLDTASALYREALESPEHCSP
GQ331046_HBc_P-A      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSP
FN545838_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
FN545826_HBc_P-A      MDIDPYKEFGATVELISFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FM199974_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FJ692600_HBc_P-A      MDIDPYKEFGATVELLSFLPTDYYPSVRDLLDTASALYRXALESPEHCSP
EU185789_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU185787_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU185786_HBc_P-A      MDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTASALYREALESPEHCSP
AY233290_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AJ309369_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ868008_HBc_P-A      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
FJ868002_HBc_P-A      MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHGSP
FJ867985_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867958_HBc_P-A      MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867949_HBc_P-A      MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867948_HBc_P-A      MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867946_HBc_P-A      MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512462_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512460_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF925400_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY271391_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX648549_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX357640_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749832_HBc_P-A      MDIDPYKEFGATVELISFLPADFFPSVRDLLDTASALFREALESPEHCSA
KT151615_HBc_P-A      MDIDHYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSP
KP857082_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTP
KP857063_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857062_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
KP168426_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSP
KM606737_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606695_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESHEHCSP
KM606659_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606650_HBc_P-A      MDIDLYKEFGATVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSP
KJ854685_HBc_P-A      MAIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922420_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922419_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922416_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922415_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779334_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779284_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779249_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF214661_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF214660_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLQDTASALYREALESPEHCSH
KF214657_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX154582_HBc_P-A      MDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX154581_HBc_P-A      MDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX154580_HBc_P-A      MDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX154579_HBc_P-A      MDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707600_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707369_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707368_HBc_P-A      MDIDPSKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707346_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707299_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439910_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439907_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439906_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439905_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439904_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439903_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439902_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439901_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439900_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439899_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439898_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439897_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439883_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439882_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439881_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439880_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439879_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439878_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439877_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439876_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439875_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439874_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439873_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439872_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439871_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439870_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439869_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439859_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLPDTASALYREALESPEHCSP
JF439774_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439750_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439747_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439746_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439741_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439736_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439735_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439730_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439727_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439726_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
JF439723_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
GQ477504_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
GQ477496_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ477470_HBc_P-A      MDIDPYKEFGASVELLSFLPFDFFPSVRDLLDTASALYREALESPEHCSP
GQ184324_HBc_P-A      MDIDPYKEFGATLELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FN545834_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSARDLLETASALYREALESPEHCSP
FN545825_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FM199975_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESXEHCXP
FJ692596_HBc_P-A      MDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSP
FJ692570_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692558_HBc_P-A      MDIDPYKEFGATVELLSFLPYDFFPSVRDLLDTASALYREALESPEHCSP
EU859938_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AJ309371_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AJ309370_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF419535_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVSALYREALESPEHCSP
AF419534_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVSALYREALESPEHCSP
AF324123_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF090838_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPNVRDLLDTASALFREALESPEHCSP
LT992448_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LT992441_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HM042278_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512471_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAGALYREALESPEHCSP
MH464809_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
MF925385_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF925372_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF772344_HBc_P-A      MDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LK995385_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LC311242_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY353913_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749843_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASAMYREALESPEHCSP
KT749834_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366466_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
KR905425_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
KP857079_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHXSP
KP857076_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSP
KP718095_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP168425_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606742_HBc_P-A      MDIDPYKEFGATVELLSFLPFDFFPSVRDFLDTASALYREALESPEHCSP
KM606672_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606661_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606653_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSP
KJ854701_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPTARDLLDTASALYREALESPEHCSP
KJ854687_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESHEHCSP
KJ843184_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922434_HBc_P-A      MDIDPYKEFGSTVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922433_HBc_P-A      MDIDPYKEFGSTVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798266_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798265_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
KF779297_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779268_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779265_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779239_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875258_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875256_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCAP
KC875253_HBc_P-A      MDVDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707608_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707606_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707604_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707603_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707602_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707599_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707597_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707592_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707591_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707590_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707589_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707588_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707587_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707586_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707585_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707584_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707583_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707581_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707580_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707579_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707575_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707574_HBc_P-A      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707534_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707382_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707339_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALGSPEHCSP
JQ707331_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ687533_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ023661_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREDLESPEHCSP
JQ023660_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREDLESPEHCSP
JN182332_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439990_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439986_HBc_P-A      MDIDPYIEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439983_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439976_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439975_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439972_HBc_P-A      MDIDPYKEFGATVELLPFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439962_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSS
JF439944_HBc_P-A      MDMDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439855_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439853_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439832_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPGHCSP
JF439828_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439827_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439826_HBc_P-A      MDIDPYKEFGAAVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439825_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439824_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439822_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439820_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439734_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HM535205_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU563550_HBc_P-A      MDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ477490_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSP
GQ222208_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FN545835_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
FJ692575_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692564_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSP
FJ692554_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ349222_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859936_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859935_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859919_HBc_P-A      MDIDPYKEFGATVEFLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859912_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859898_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594384_HBc_P-A      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
EU185777_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSXRDLLXTASALYREALESPEHCSP
EU185776_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLXTASALYREALESPEHCSP
DQ315784_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY603438_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY603431_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233279_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AM295796_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350081_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVPDLLDTASALYREALESPEHCSP
AF324127_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324120_HBc_P-A      MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYQEALESPEHCSP
AF324118_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
AF324107_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALHREALESPEHCSP
AF297625_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF297621_HBc_P-A      MDIDPYKEFGSTVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ868007_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X70185_HBc_P-A        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512469_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF772350_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY886219_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX357646_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857069_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSS
KP857058_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP168422_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606666_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606665_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779365_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779361_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779332_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779329_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779322_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779317_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779316_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779315_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779298_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779272_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLVDTASALHREALESPEHCSP
KF779254_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPFVRDLLDTASALYREALESPEHCSP
JQ707656_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707655_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRELLDTASALYREALESPEHCSP
JQ707654_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707653_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707652_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707651_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707650_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707649_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707648_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707647_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707646_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707645_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707644_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707643_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707642_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707641_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707640_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707639_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707638_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707636_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707635_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707633_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707615_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707605_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707596_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707595_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707577_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707388_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN182329_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439969_HBc_P-A      MDIGPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439964_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439848_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU827640_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU563545_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLCDTASALYREALESPEHCSP
FM199976_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ904411_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSP
FJ692609_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692565_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSP
EU859939_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859934_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU414050_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
EU414048_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EF208113_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY934772_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY603441_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY603432_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVLDLLDTASALYREALESPEHCSP
AY233283_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233281_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AM180624_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHGSX
AF536524_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASTLYREALESPEHCSP
AF324126_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324121_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867995_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867994_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867962_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867961_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867960_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867959_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867947_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692605_HBc_P-A      MDIDXYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692612_HBc_P-A      MDIDXYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
V00866_HBc_P-A        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512466_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512459_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512457_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512456_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSARDLLETASALFREALESPEHCSP
MF925407_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF925361_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY382410_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY271390_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTTSALCREALESPEHCSP
KT366467_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KR905426_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP718101_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP168429_HBc_P-A      MDIDPYKEFGATVELLSFLXSDFFPSVRDLLDTXSALYREALESPEHCSP
KM606748_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606673_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854703_HBc_P-A      MDFDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854700_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854691_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854686_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ843172_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798291_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798267_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779381_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779351_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779295_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779294_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779293_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779252_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF214662_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707681_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707676_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707675_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707674_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707672_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707670_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707669_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707667_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707665_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707664_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707663_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707662_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707661_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707659_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707658_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707370_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707367_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707366_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707365_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707364_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707363_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707362_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707361_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707360_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707359_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707358_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707357_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707356_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707355_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707354_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707353_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707352_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707351_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707350_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707349_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707348_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707347_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707345_HBc_P-A      MDIDPYKEFGATVELVSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707337_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707334_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707325_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707322_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707321_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707319_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707318_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707314_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707312_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707300_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN182334_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439992_HBc_P-A      MDIDPYKEFGATVELLSFLPSDLFPSVRDLLDTASALYREALESPEHCSP
JF439984_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439980_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439974_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439949_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439852_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439837_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439835_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HE576989_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ184323_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FN545837_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FN545833_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
FM199981_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692610_HBc_P-A      MDIDXYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHXSP
EU859944_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594387_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU414049_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
EU185774_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLBTASALYREALESPEHCSP
EU185746_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ788725_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY862868_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY738143_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY738142_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY738141_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY738140_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY738139_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233275_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY152726_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF537371_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350086_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324135_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF297623_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF297622_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697511_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697491_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU185750_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
Z72478_HBc_P-A        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
Z35717_HBc_P-A        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X51970_HBc_P-A        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X07911_HBc_P-A        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X02763_HBc_C-A        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512473_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512472_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512470_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512468_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK512467_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH932713_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH580643_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH580642_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH580639_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH580627_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464830_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464828_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464818_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464815_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464813_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464810_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF772353_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF772351_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
M74501_HBc_P-A        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
M57663_HBc_P-A        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LT992440_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LC458431_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LC458430_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LC311243_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LC311241_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LC074724_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LC051141_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
L13994_HBc_P-A        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY353912_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY271389_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY003230_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX827298_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX827296_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVGDLLDTASALYREALESPEHCSP
KX827295_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX827294_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX827293_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX686607_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX648548_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX357647_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX357645_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX357643_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX357642_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU736920_HBc_P-A      MDIDPYKXFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU736919_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU736918_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU605539_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU605538_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU605537_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU605536_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU605535_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU605534_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU605533_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU605532_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU605522_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU605521_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU605520_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU605519_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU605518_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU605517_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU605516_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749850_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749849_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749847_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749846_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749844_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749842_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749840_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749839_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749838_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749837_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749836_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749835_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749831_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749830_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749829_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749826_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749825_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749824_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366471_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366470_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366469_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366468_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT347088_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT347087_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT151618_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT151616_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT151614_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT151613_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT151611_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KR905431_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KR905430_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP718100_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDXLDTASALYREALESPEHCSP
KP718099_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP718098_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP718097_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP718096_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP718094_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP718093_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP718092_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP718091_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP718090_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP718089_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALEXPEHCSP
KP718088_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP718087_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP718086_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP718085_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP274928_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP274927_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP274925_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP168435_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP168434_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP168433_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP168432_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP168430_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP168427_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP168424_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP168423_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606749_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606746_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606700_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606694_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606691_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606687_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606685_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606684_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606683_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606680_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606678_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606677_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606676_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606674_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606669_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606663_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606660_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606656_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606652_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606648_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM519454_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM519453_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM519452_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM243029_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854710_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854709_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854708_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854707_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854706_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854705_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854704_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854702_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854699_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854698_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854697_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854696_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854694_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854693_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854692_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854690_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTSSALYREALESPEHCSP
KJ854689_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ854688_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ843218_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ843217_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ843216_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ843215_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ843214_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ843192_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ843188_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ843186_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ843183_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ843182_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ843173_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ843166_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ586809_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVKDLLNTASALYREALESPEHCSP
KJ010778_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ010777_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ010776_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922428_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922427_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922426_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922425_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922424_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922409_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922408_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922407_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922406_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798314_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798311_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798310_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798309_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798308_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798302_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798292_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798290_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798289_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798286_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798285_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798279_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798278_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779386_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779385_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779384_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779383_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779379_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779378_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779375_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779374_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779373_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779372_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779371_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779370_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779369_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779368_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779367_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779366_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779364_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779363_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779362_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779360_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779359_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779358_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779356_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779355_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779354_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779352_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779350_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779349_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779348_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779347_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779346_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779345_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779344_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779342_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779339_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779338_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779337_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779336_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779335_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779333_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779331_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779330_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779328_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779326_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779325_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779324_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779323_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779321_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779320_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779319_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779314_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779313_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779312_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779311_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779310_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779309_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779308_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779307_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779306_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779305_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779304_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779299_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779291_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779290_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779286_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779283_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779282_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779281_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779279_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779277_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779276_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779275_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779274_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779273_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779271_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779270_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779269_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779266_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779264_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779263_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779262_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779261_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779260_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779259_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779258_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779257_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779256_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779255_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779253_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779251_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779248_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779247_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779246_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779245_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779244_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779243_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779240_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779238_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779234_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779232_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779231_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779227_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF214665_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF214663_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF214659_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF214658_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875257_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875254_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875252_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC836858_HBc_P-A      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC836854_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC836849_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC836846_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC836834_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC836832_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC836831_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX310725_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX310724_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX310723_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX310722_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX310721_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX096953_HBc_P-A      MDIDPYKEFGATVELPSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX096952_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707637_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707634_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707632_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707631_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707630_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707629_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707628_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707627_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707626_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707625_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707624_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707623_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALEFPEHCSP
JQ707622_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707621_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707620_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707619_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707618_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707617_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707616_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707614_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707613_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707612_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707611_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707610_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707609_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707601_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707573_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707572_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707571_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707570_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707569_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707568_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707567_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707566_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707565_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHSSP
JQ707564_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707563_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707562_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707561_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707560_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707559_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707558_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707557_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707556_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707555_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707554_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707553_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707552_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707551_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707550_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707549_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707548_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707547_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707546_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707545_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707544_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707543_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707542_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707541_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707540_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707539_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707538_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707537_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707536_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707535_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707533_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707532_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707531_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707420_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707419_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707418_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707417_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707416_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707415_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707414_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASTLYREALESPEHCSP
JQ707413_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707412_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707411_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707410_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707409_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707408_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707407_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707406_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707405_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707404_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707403_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707402_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707401_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707400_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707399_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707398_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707397_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707396_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707395_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707394_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707393_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707392_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707391_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707390_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707389_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707387_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707386_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707385_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707384_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707383_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707381_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707380_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707379_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707378_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707377_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707376_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707375_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707374_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707373_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707372_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707371_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707344_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707343_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707342_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707341_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707340_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707338_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707336_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALHREALESPEHCSP
JQ707335_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707333_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707332_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707330_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707329_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707327_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707326_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707324_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707323_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707320_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707317_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707316_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707315_HBc_P-A      MDIDPYKEFGATVELLSFLPSGFFPSVRDLLDTASALYREALESPEHCSP
JQ707313_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707311_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707310_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707309_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707308_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707307_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707306_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707305_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707304_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707303_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707302_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707301_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ687529_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN182333_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN182331_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN182330_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN182328_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN182327_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN182326_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN182324_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN182323_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN182322_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN182321_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN182320_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN182319_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN182318_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF440016_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439993_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439991_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439989_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439988_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439987_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439985_HBc_P-A      MDIDPYKEFGATVELPSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439982_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439981_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLGTASALYREALESPEHCSP
JF439979_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439977_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439971_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439970_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439968_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439966_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439965_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439961_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439960_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439959_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439957_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439956_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439955_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439952_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439951_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439950_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439948_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439947_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439946_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439945_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439943_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439868_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439867_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439866_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439865_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439864_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439861_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439860_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439858_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439857_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439856_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439854_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439851_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439850_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439849_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439847_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439846_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439845_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439844_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439843_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439842_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439841_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439840_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439839_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439838_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439836_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439834_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439833_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439831_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439823_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439819_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439778_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439777_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439775_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439773_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439772_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439771_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439770_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439769_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439768_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439766_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439765_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439764_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439763_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439762_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439761_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439760_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439759_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439758_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439757_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439756_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439755_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439754_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439753_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439752_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HM535200_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HE576988_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU563562_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU563558_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU563557_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU563555_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU563554_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU563553_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU563548_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU563546_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ477503_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ477468_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ477467_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ477461_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ414522_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ331047_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ161813_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FN545836_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FN545831_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FM199980_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FM199979_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FM199978_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692601_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692591_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692590_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692585_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692584_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692583_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692582_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692581_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692580_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692579_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692578_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692574_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692571_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692563_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692557_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ349224_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859956_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859955_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859954_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859953_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859952_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859951_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859950_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859949_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859948_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859947_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859946_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859945_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859943_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859942_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859941_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859940_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859937_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859933_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859932_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859931_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859930_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859929_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859928_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859927_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859926_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859925_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859924_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859923_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859922_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859921_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859920_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859918_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859917_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859916_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859915_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859914_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859913_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859911_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859910_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859909_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859908_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859907_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859906_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859905_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859904_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859903_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859902_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859901_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859900_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU859899_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594395_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594394_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594393_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594392_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594391_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594390_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594389_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594388_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594386_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594385_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594383_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU410082_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU086721_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU054331_HBc_C-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ315786_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ020003_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ020002_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY934774_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY934773_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY934771_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY934770_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY934769_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY934768_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY934767_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY934766_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY934765_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY934764_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY934763_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY902775_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY862867_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY707087_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY603446_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY603436_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY603435_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY603430_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY603429_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY373432_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY373428_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233289_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233288_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233286_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233284_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233282_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233280_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233278_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233276_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233274_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY161139_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY161138_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY128092_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AM494718_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AM410963_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AM295797_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AM295795_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AM282986_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AM184126_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AM184125_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AJ012207_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350098_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350097_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350096_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350095_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350094_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350093_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350092_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350091_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350090_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350089_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350088_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350087_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALNREALESPEHCSP
AF350085_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350084_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350083_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350082_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350080_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324148_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324147_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324136_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324133_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324128_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324125_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF297624_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF090842_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF090841_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF090840_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF090839_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF043580_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF043560_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB937798_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB937796_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB937795_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB937794_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB937793_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB937792_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB937791_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB775201_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB775200_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB775199_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB775198_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697512_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697509_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697508_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697507_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697506_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697505_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697504_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697503_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697501_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697499_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697497_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697496_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697495_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697493_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697492_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697489_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697488_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692598_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233287_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464814_HBc_P-A      MDIDPYKEFGATVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSP
MH464808_HBc_P-A      MDIDPYKKFGAXVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB697487_HBc_P-A      MDIDPYKEFGAXVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSP
AB697498_HBc_P-A      MDIDPYKEFGAXVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
                        ..    :*:  .:  .*  . :*   :   :        *        

MF536836_HBc_P-A      HHTALRQAILCWGELLYSLPTWVGNNLQDPASRDLHVNYVNTNMGLKIRQ
DQ298162_HBc_P-A      HHTALRLAIVCWGELM-NLATWVGNNWQDPASRDVVVNYVNTNMGIKIRQ
AY236166_HBc_P-A      HHTALRQAIVCWGELM-NLATWVGNNLQDPASRDLVVNYVNTNMGIKIRQ
DQ298164_HBc_P-A      HHTALRQAIVCWGELM-NLATWVGNNLQDPASRDLVVNYVNTNMGIKIRQ
AY230111_HBc_P-A      HHTALRQAIVCWGELM-NLATWVGNNLQDPASRDLVVNYVNTNMGIKIRQ
AY236167_HBc_P-A      HHTALRQAIVCWGELM-NLATWVGNNLQDPASRDLVVNYVNTNMGIKIRQ
AY236169_HBc_P-A      HHTALRQAIACWGELM-NLATWVGNNLQDPASRDLVVNYVNTNMGIKIRQ
DQ298161_HBc_P-A      HHTALRQAIVCWGELM-NLATWVGNNLQDPASRDLVVNYVNTNMGIKIRQ
DQ298165_HBc_P-A      HHTALRQAIVCWGELM-NLATWVGNNLQDPASRDLVVNYVNTNMGIKIRQ
AY236165_HBc_P-A      HHTALRQAIVCWGELM-NLATWVGNNLQDPASRDLVVNYVNTNMGIKIRQ
AY236168_HBc_P-A      HHTALRQAIVCWGELM-NLATWVGNNLQDPASRDLVVNYVNTNMGIKIRQ
DQ298163_HBc_P-A      HHTALRQAIVCWGELM-NLATWVGNNLQDPASRDLVVNYVNTNMGIKIRQ
KP857070_HBc_P-A      HHTALRQAILCWGDLT-TLGSWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KP857071_HBc_P-A      HHTALRQAILCWGDLT-TLGSWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KP857091_HBc_P-A      HHTAIRQAILCWGELT-TLATWVGTNLDDPGSRDLVVNYVNTNMGLKIRQ
GQ477474_HBc_P-A      HHTAIRHVLLCWVELM-TLANWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439821_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVFNYVNTNMGLKIRQ
KP857088_HBc_P-A      HHTAIRQAILCWGELM-TLANWVGNNLDDPASRDLVVNYVNNNMGLKIRQ
KM606662_HBc_P-A      HHTALRQAILCWGELT-TLGSWVGNNLQDQASRDQVVNYVNTNMGLKIRQ
GQ477493_HBc_P-A      HHTAIRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
KP857068_HBc_P-A      HHTAIRQIVLCWGDVM-NLATWVGSNLQDPASRDQVVNYVNTNMGLKIRQ
GQ477477_HBc_P-A      HHTAIRQAILCWGELM-SLASWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
AB116076_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AF324122_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB076679_HBc_P-A      HHTALRQAILCWVELT-TLATWVGNNLEDHASRDLVVNYVNDNMGLKLRQ
KP857066_HBc_P-A      HHTALRQAILCWGDLM-NLANWVGTNLDDPASRDLVVNYVNTNMGLKIRQ
KM606647_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439767_HBc_P-A      HHTALLHAILCWRELM-TLATWVGDNLEDPASRDLVVNYVNTNMGLKIRQ
GQ477499_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
GQ477480_HBc_P-A      HHTALRQAVLCWGELM-NLATWVGSNLQDPASRDLVVNYVNTNMGLKFRQ
GQ477473_HBc_P-A      HHTALRQAILCWGELT-ALATWVGGNLDDPASRDQVVNYVNTNMGLKIRQ
AB116088_HBc_P-A      HHTALRQAIVCWGELM-TLGTWVGNNLEDPESRDLVVNYVNTNMGLKIRQ
KY353919_HBc_P-A      HHTARRQAIICWVELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
GU563547_HBc_P-A      HHTAIRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
FJ692595_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNDNMGIKIRQ
AB453989_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB246317_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKVRQ
AB116087_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB116082_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KP857086_HBc_P-A      HHTALRQAILCWLELM-TLATWVGNNLDDPASRDQVVNYVNTNMGLKIRQ
KP857075_HBc_P-A      HHTALRQAALCWWELT-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KP857060_HBc_P-A      HHTALRQASLCWVELM-TLATWVGNNLQDTASRDLVVNYVNTNMGLKIRQ
KM606649_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKLRQ
FN545830_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692599_HBc_P-A      HHTAIRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ349296_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLENPASRDLVVNYVNTNMGLKIRQ
EU304331_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
AJ627227_HBc_P-A      HHTAIRQAIVCWGELT-NLGTWVGNNLQDPASRDLVVNHVNTNMGLKIRQ
AB116092_HBc_P-A      HHTALRQVILCWGELM-TLATWVGTNLQDPASRDLVVSYVNDNMGLKIRQ
JF439921_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439929_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
MF925362_HBc_P-A      HHTALRQAILCWGDVM-NLATWVGTNLDDPASRDLVVNYVNTNMGLKIRQ
KP857081_HBc_P-A      HHTALRQAILCWGDVM-NLATWVGANLEDPASRDLVVNYVNTNMGLKIRQ
KP857073_HBc_P-A      HHTAIRQAILCWGELM-TLASWVGANLDDPASRDQVVNYVNTNMGLKIRQ
KF922429_HBc_P-A      HHTAIRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF922431_HBc_P-A      HHTAIRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439932_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
GQ477469_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLEDQASRDLVVNYVNTNMGLKIRQ
AY034878_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASKDLVVNYVNTKHGLKIRQ
AJ627228_HBc_P-A      HHTAIRQCVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AB453986_HBc_P-A      HHTALRQAILCWGELT-TLGTWVGNNLQDQTSRDQVVNYVNTNMGLKIRQ
FJ692593_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPVSRDLVVNYVNTNMGLRIRQ
KY353918_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
KX357649_HBc_P-A      HHTALRQAVLCWGELM-TLAXWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KR905427_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KP857085_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
KP857078_HBc_P-A      HHTALRQAILCWGDVM-TLGTWVGNNLEDQASRDLVVNYVNTNMGLKIRQ
KP857064_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTHMGLKIRQ
KF922437_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KF922430_HBc_P-A      HHTAIRQAILCWGELM-IFATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439926_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
FJ692588_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692586_HBc_P-A      HHTALRQAILCWGDLT-TLGSWVGNNLEDQASRALVVNYVDTNMGLKIRQ
EU366129_HBc_P-A      HHTAIRQAILCWGELM-TLATWVGNNLXDPASRDLVVNYVNTHMGLKIRQ
AJ627226_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AF537372_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AB116086_HBc_P-A      HHTALRQAILCWGELR-TLGTWVGNNLDDQASRDLVVNYVNTNMGLKIRQ
KT151612_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KT151617_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FN545832_HBc_P-A      HHTALRQAILCWGEXM-TLATWVGNNLDDPASRDLVVNYVNTXMGLKIRQ
FN545839_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTHMGLKIRQ
MF772345_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKLRQ
KX357644_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
GQ477501_HBc_P-A      HHTALRQAILCWGELT-TLGTWVGNNLNDPASRDLVVNYVNTNMGLKIRQ
GQ477500_HBc_P-A      HHTAIRQVILCWGDVM-TLGTWVGNNLEDPASKDLVVNYVNTNMGLKIRQ
GQ477466_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FN545829_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
FJ692587_HBc_P-A      HHTALRQAILCWGDVM-TLGTWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692567_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AF419536_HBc_P-A      HHTAIRQAILCWGQLM-TLATWVGNNLQDPASRDLVVNYVNDNMGLMIRQ
AF324072_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB453983_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AB453982_HBc_P-A      HHTALRQAILCWGELT-TLGTWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
AB362931_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
AB194951_HBc_P-A      HHTALRQAILCWGDVT-NLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
AB116091_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AB116089_HBc_P-A      HHTALRQASLCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB116084_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
AB116081_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB116078_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
AB116085_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB205118_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB480036_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB480040_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB076678_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB116077_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB116079_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB116080_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB116090_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB116094_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB126580_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB241114_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB241115_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB246335_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB246337_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB246338_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB300366_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB300367_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB453979_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB453980_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB453981_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB453984_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB480038_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB480039_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB480041_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB549213_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
MK512464_HBc_P-A      HHTALRQATLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
MF772348_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KY353915_HBc_P-A      HHTALRQAIVCWGELM-TLGSWVGNNLEDQASRDLVVNYVNTNMGLKIRQ
KP857072_HBc_P-A      HHTALRQAILCWQEVT-TLASWVGTNLDDPSSRDQVVHYVNTNMGLKIRQ
KP857059_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439941_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439933_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
GQ477502_HBc_P-A      HHTALRQAILCWGDLM-NLATWVGGNLQDPASRDLVVNYVNTNMGLKIRQ
GQ477478_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
FN545828_HBc_P-A      HHTALRQAILCWGELM-TLASWVGNNLQDPASRDQVVDYVNTNMGLKIRQ
FJ692576_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692555_HBc_P-A      XHTAIRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTXMGLKIRQ
AB937797_HBc_P-A      HHTALRQVSLCWVELM-TLATWVGNNLQDPASRDQVVNYVNNNMGLKIRQ
AB222707_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
AB064314_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KY353917_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KP857092_HBc_P-A      HHTALRQAILCWVELX-TLATWVGNNLEDPASRDQVVNYVNTNMGLKLRQ
KF214666_HBc_P-A      HHTALRQAVLCWGELT-TLAGWVGHNLEDPASRDLVVNYVNTNMGLKIRQ
MK512475_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
MH464825_HBc_P-A      HHTALRQALLCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KY353916_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
KY353909_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KP857089_HBc_P-A      HHTALRQAIICWGELM-SLATWVGGNLQDQASRDLVVNYVNINMGLKIRQ
KP857083_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KP857065_HBc_P-A      HHTAIRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KP857061_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KM606688_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KM606671_HBc_P-A      HHTALRQAILCWGEVT-ALGEWVGNNLQDQASRDLVVNYVDTNMGLKIRQ
JQ707598_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707582_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
GQ477498_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
GQ477476_HBc_P-A      HHTALRQAILCWGELS-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
GQ477475_HBc_P-A      HHTAIRQVVLCWGELM-TLATWVGNNLQDQASRDLVVNYVNTNMGLKIRQ
FJ692611_HBc_P-A      HHTALRQAILCWGELM-TLASWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692597_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDQVVNYVNXNMGLKIRQ
FJ692561_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692559_HBc_P-A      HHTAIRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AB194952_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
HM363612_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
HM363613_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
AB194950_HBc_P-A      HHTALRQAILCWGDVT-NLATWVGTNLDDPASRDLVVNYVNTNMGLKIRQ
AB014370_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
EU185765_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KY353926_HBc_P-A      HHTAIRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KP857080_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
KP857077_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KP857074_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDQASRNLVVDYVNNNVGLRLRQ
KP857067_HBc_P-A      HHTALRQAILCWGDVM-TLGTWVGNNLDDPASRDQVVNYVNTNMGLKIRQ
KF922436_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF922435_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439928_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRNLVVNYVSTNMGLKIRQ
JF439908_HBc_P-A      HHTALRQAILCWWDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439830_HBc_P-A      HHTALRQAILCWGELM-ALATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
GQ477491_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FN545840_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692607_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692566_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AY373429_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AB453988_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB246336_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AB116093_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439911_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439912_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439913_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439914_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439915_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439916_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439917_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439918_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439919_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439920_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439922_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439923_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439924_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439925_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439927_HBc_P-A      HHTALRQAVLCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
FJ867986_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AY903452_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
MK512458_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
MF925373_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
MF772347_HBc_P-A      HHTALRQAILCWGDVT-TLATWVGQNLEDPASRDLVVNYVNTNMGLKIRQ
MF772346_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KX276769_HBc_P-A      HHTALRQAILCWGELM-TLASWVGNNLQDPASRDQVVSYVNTNMGLKIRQ
KT749822_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KR905429_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KP857087_HBc_P-A      HHTALRQAIVCWGELN-TLGTWVGNNLEDQASRDLVVNYVNNNMGIKIRQ
KP168428_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLDDXASRDLVVNYVNTHMGLKIRQ
KM606693_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KM606658_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KF922421_HBc_P-A      HHTALRQAILCWGDVM-NLATWVGTNLEDPASRDQVVNYVNINMGIKIRQ
KF922418_HBc_P-A      HHTALRQAILCWGDVM-NLATWVGTNLEDPASRDQVVNYVNINMGIKIRQ
KF798271_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439942_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439940_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439939_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439938_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439937_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439936_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439935_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439934_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439931_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439930_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439909_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439896_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439748_HBc_P-A      HHTAPRQAILCWGNVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439742_HBc_P-A      HHTALRQAILCWGNVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439738_HBc_P-A      HHTALRQAILCWGNVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439737_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMSLKIRQ
JF439733_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439732_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439731_HBc_P-A      HHTALRQAILCWGKVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439728_HBc_P-A      HHTALRQAILCWGKVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439725_HBc_P-A      HHTALRQAILCWGNVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439722_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439721_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439720_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
GU563551_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
GQ477494_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
GQ477488_HBc_P-A      HHTAIRQAILCWGELM-TLASWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
GQ477487_HBc_P-A      HHTALRQAILCWGELS-TLATWVGNNLQDSASRDLVVNYVNTNMGLKIRQ
GQ477472_HBc_P-A      HHTALRQAILCWGELT-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
GQ477464_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
GQ477463_HBc_P-A      HHTALRQAILCWVELM-TLASWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FM199977_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
FJ692613_HBc_P-A      HHTAIRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692608_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
FJ692606_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
FJ692604_HBc_P-A      HHTALRQAILCWGDLM-TLATWVGNNLEDPASRDLVVNYVNTTTGLRIRQ
FJ692602_HBc_P-A      HHTALRQAILCWGDLS-TLATWVGNNLADPASRDLVVNYVNTNMGLKIRQ
FJ692592_HBc_P-A      HHTALRQAILXWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692577_HBc_P-A      HHTALRQAXLCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692573_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692562_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
EF103278_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AY161144_HBc_P-A      HHTALRQAILCCGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AY161143_HBc_P-A      HHTALRQAILCCGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AY161142_HBc_P-A      HHTALRQAILCCGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AF324071_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
HM042263_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
MK512476_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
MK512474_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKLRQ
MK512461_HBc_P-A      HHTAIRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KX357650_HBc_P-A      HHTALRQAILCWGDVI-NLSTWVGQNLEDPASRDLVVNYVNTNIGLKTRQ
KM606657_HBc_P-A      HHTALRQAILCWGELT-TLGAWVGNNLEDQASRDLVVNYVNTNMGLKIRQ
KC875259_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KC875255_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KC875251_HBc_P-A      HHPALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707607_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707594_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JN182325_HBc_P-A      HHTALRQAILRWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439953_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439829_HBc_P-A      HHAALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439743_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
GQ477497_HBc_P-A      HHTALRQAILCWGELT-TLGTWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
GQ477486_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
GQ477465_HBc_P-A      HHTALRQAILCWGELM-TLASWVGNNLQDPASRDLVVDYVNTNMGLKIRQ
GQ477462_HBc_P-A      HHTALRQAILCWGELT-SLGTWVGNNLDDQASRDLVVNYVNTNMGLKLRQ
FJ904434_HBc_P-A      HHTAIRQIILCWGDVM-TLATWVGTNLZDPASRDLVVNYVNTNMGLKIRQ
FJ692603_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
EU414133_HBc_P-A      HHTALRQAILCWADVT-NLATWVGNNLEDQASRDLVVNYVNTNMGLKIRQ
EU414052_HBc_P-A      HHTALRQAILCWADVT-NLATWVGNNLEDQASRDLVVNYVNTNMGLKIRQ
AY233285_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AJ344115_HBc_P-A      HHTALRQAILCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AB453987_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AB116083_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
EU185775_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
MK512465_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
MK512463_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
MK512455_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRE
MH464817_HBc_P-A      HHTALRQAILCWGDLM-TLATWVGNNLDDPASRDLVVNYVNTNVGLKIRQ
MF925368_HBc_P-A      HHTALRQAILCWGELT-TLGTWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
KX648547_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KT749833_HBc_P-A      HHTALRQAIVCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KP995108_HBc_P-A      HHTALRQAIVCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KP857084_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVDYVNTNMGLKIRQ
KF922414_HBc_P-A      HHTALRQAILCWGDVM-NLATWVGTNLEDPASRDQVVNYVNINMGIKIRQ
KF779215_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779213_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KC875260_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707593_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707578_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707576_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTHMGLKIRQ
JF439973_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439958_HBc_P-A      HHTALRQAILCWEELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439954_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439751_HBc_P-A      HHTALRQDILCWGELM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRR
JF439744_HBc_P-A      HHTALRQDILCWGGLM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRR
JF439740_HBc_P-A      HHTALRQAILCWGNVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439729_HBc_P-A      HHTALRQDILCWGELM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRR
JF439724_HBc_P-A      HHTALRQDILCWGELM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRR
HM011485_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
GQ477495_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
GQ477484_HBc_P-A      HHTALRQAILCWGDVM-SLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
GQ477482_HBc_P-A      HHTALRQAIICWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKLRQ
GQ477479_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
GQ331046_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
FN545838_HBc_P-A      HHTALRQAILCWGDVM-SLATWVGTNLEDPASREQVVSYVNTNMGLKIRQ
FN545826_HBc_P-A      HHTALRQAILCWGDLM-TLATWVGNNLEDPASRDLVVNYVNNTTGLKIRQ
FM199974_HBc_P-A      HHTALRQAILCWGELM-ALASWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
FJ692600_HBc_P-A      HHTALRQAXLCWGELM-TLATWVGNNLEDPASRDXVVNYVNXNMGLKIRQ
EU185789_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
EU185787_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
EU185786_HBc_P-A      HHTALRQAILCWGELT-TLGTWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
AY233290_HBc_P-A      HHTALRQAILCWGDVM-NLASWVGNNLDDPASRDQVVNYVNTNMGLKIRQ
AJ309369_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
FJ868008_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ868002_HBc_P-A      HHTALRQAILCWGELM-TLATWVGINLEDPASRDLVVNYVNTNMGLKIRQ
FJ867985_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ867958_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ867949_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ867948_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ867946_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
MK512462_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
MK512460_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
MF925400_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KY271391_HBc_P-A      HHTALRQAILCWGDVT-TLATWVGQNLEDPASRDLVVNYVNTNMGLKIRQ
KX648549_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KX357640_HBc_P-A      HHTALRQAILCWGDVT-NLATWVGTNLDDPASRDLVVNYVNTNMGLKIRQ
KT749832_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KT151615_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KP857082_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGTKIRQ
KP857063_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KP857062_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KP168426_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTHMGLKIRQ
KM606737_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KM606695_HBc_P-A      HHTALRQAILCWGELM-TLATWAGNNLEDPASRDLVVNYVNTNMGLKIRQ
KM606659_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KM606650_HBc_P-A      HHTALRQAIVCWGELM-TLGTWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KJ854685_HBc_P-A      HHTALRQAILCWGELS-TLGTWVGNNLQDQASRDLVVNYVNTNMGLKIRQ
KF922420_HBc_P-A      HHTALRQAILCWGDVM-NLATWVGTNLEDPASRDQVVNYVNINMGIKIRQ
KF922419_HBc_P-A      HHTALRQAILCWGDVM-NLATWVGTNLEDPASRDQVVNYVNINMGIKIRQ
KF922416_HBc_P-A      HHTALRQAILCWGDVM-NLATWVGTNLEDPASRDQVVNYVNINMGIKIRQ
KF922415_HBc_P-A      HHTALRQAILCWGDVM-NLATWVGTNLEDPASRDQVVNYVNINMGIKIRQ
KF779334_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779284_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779249_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
KF214661_HBc_P-A      HHTALRRAVLCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF214660_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KF214657_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JX154582_HBc_P-A      HHTALRQAIVCWGELM-TLGTWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JX154581_HBc_P-A      HHTALRQAIVCWGELM-TLGTWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JX154580_HBc_P-A      HHTALRQAIVCWGELM-TLGTWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JX154579_HBc_P-A      HHTALRQAIVCWGELM-TLGTWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707600_HBc_P-A      HHTALRQDILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLTIRR
JQ707369_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707368_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707346_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQEPASRDLVVNYVNTNMGLKIRQ
JQ707299_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
JF439910_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439907_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439906_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439905_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439904_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439903_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439902_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439901_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439900_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439899_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439898_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439897_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439883_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439882_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439881_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439880_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439879_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439878_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439877_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439876_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439875_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439874_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439873_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439872_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439871_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439870_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439869_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JF439859_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKVRQ
JF439774_HBc_P-A      HHTALREAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKVRQ
JF439750_HBc_P-A      HHTALRQAILCWGNVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439747_HBc_P-A      HHTALRQAILCWGNVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439746_HBc_P-A      HHTALRQAILCWGNVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439741_HBc_P-A      HHTALRQAILCWGKVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439736_HBc_P-A      HHTALRQAILCWGNVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439735_HBc_P-A      HHTALRQAILCWGNVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439730_HBc_P-A      HHTALRQAILCWGKVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439727_HBc_P-A      HHTALRQAILCWGNVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439726_HBc_P-A      HHTALRQAILCWGNVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
JF439723_HBc_P-A      HHTALRQAILCWGNVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
GQ477504_HBc_P-A      HHTALRQAILCWGELS-TLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
GQ477496_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
GQ477470_HBc_P-A      HHTALRQAILCWGELT-NLGTWVGNNLEDQASRDLVVNYVNTNMGLKIRQ
GQ184324_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
FN545834_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
FN545825_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
FM199975_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692596_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692570_HBc_P-A      HHTALRQAILCWGDVT-NLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692558_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDAASRDLVVNYVNTNMGLKIRQ
EU859938_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AJ309371_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AJ309370_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AF419535_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AF419534_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AF324123_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AF090838_HBc_P-A      HHTALRQAILCWGDVM-NLATWVGANLEDQASRDLVVNYVNTNMGLKIRQ
LT992448_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
LT992441_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
HM042278_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
MK512471_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
MH464809_HBc_P-A      HHTALRQAILCWXELM-XLATWVGXNLZDPASRDLVVNYVNTNMGLKXRQ
MF925385_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
MF925372_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
MF772344_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
LK995385_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
LC311242_HBc_P-A      NHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KY353913_HBc_P-A      HHTALRQAILCWGDVM-NLATWVGTNLDDPASRDLVVNYVNTNMGLKIRQ
KT749843_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KT749834_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KT366466_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KR905425_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KP857079_HBc_P-A      HHTALRQAILCWGXVM-TLGTWVGBNLEDPASRDLVVNYVNTNMGLKIRQ
KP857076_HBc_P-A      HHTALRQAILCWGEVT-XLATWVGTNLDDPASRDLVVNYVNTNMGLKIRQ
KP718095_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KP168425_HBc_P-A      HHTALRQAIFWWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KM606742_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KM606672_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KM606661_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KM606653_HBc_P-A      HHTALRQEILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KJ854701_HBc_P-A      HHTALRQAILCWGDIL-TLGTWVGNNLEDQTSRDLVVNYVNTNMGLKIRQ
KJ854687_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KJ843184_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF922434_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF922433_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF798266_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KF798265_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779297_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779268_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779265_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779239_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KC875258_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KC875256_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KC875253_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707608_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707606_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707604_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707603_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707602_HBc_P-A      HHTALRQDILCWGKLM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707599_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707597_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707592_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707591_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707590_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707589_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707588_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707587_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707586_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707585_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707584_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707583_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707581_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707580_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707579_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707575_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707574_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707534_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707382_HBc_P-A      HHTALRQAILCWGELM-TLATWVDNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707339_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707331_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ687533_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ023661_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ023660_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JN182332_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439990_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439986_HBc_P-A      HHTALRQAILCWGELL-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439983_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439976_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439975_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439972_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439962_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439944_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439855_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439853_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439832_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439828_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439827_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439826_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439825_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439824_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439822_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439820_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439734_HBc_P-A      HHTALRQDILCWGELM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
HM535205_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
GU563550_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
GQ477490_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGSNLEDPASRDQVVNYVNTNMGLKIRQ
GQ222208_HBc_P-A      HHTALRQAILCWRELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
FN545835_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692575_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
FJ692564_HBc_P-A      HHTALRQAILCWGDVT-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692554_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ349222_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
EU859936_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
EU859935_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
EU859919_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
EU859912_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
EU859898_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
EU594384_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
EU185777_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPPSRDLVVNYVNTNMGLKIRQ
EU185776_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPPSRDLVVNYVNTNMGLKIRQ
DQ315784_HBc_P-A      HHTALRQAVLCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AY603438_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AY603431_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AY233279_HBc_P-A      HHTAHRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AM295796_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AF350081_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AF324127_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AF324120_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AF324118_HBc_P-A      HHTALRQEILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AF324107_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
AF297625_HBc_P-A      HHTALRETILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AF297621_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ868007_HBc_P-A      HHTALRQAILCWGELM-NLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
X70185_HBc_P-A        HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
MK512469_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
MF772350_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KY886219_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KX357646_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KP857069_HBc_P-A      HHTALRQAILCWGELT-TLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
KP857058_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KP168422_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KM606666_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KM606665_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779365_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
KF779361_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNFEDPASRDLVVNYVNTNMGLKIRQ
KF779332_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779329_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779322_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779317_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779316_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779315_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779298_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKFRQ
KF779272_HBc_P-A      HHTALRQAIVCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779254_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707656_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707655_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707654_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707653_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707652_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707651_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707650_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707649_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707648_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707647_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707646_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707645_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707644_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707643_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707642_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707641_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707640_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707639_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707638_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707636_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707635_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707633_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707615_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707605_HBc_P-A      HHTALRQDILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLTIRR
JQ707596_HBc_P-A      HHTALRQDILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLTIRR
JQ707595_HBc_P-A      HHTALRQDILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLTIRR
JQ707577_HBc_P-A      HHTALRQDILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLTIRR
JQ707388_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLLVNYVNGDMGLKIRQ
JN182329_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRR
JF439969_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439964_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439848_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
GU827640_HBc_P-A      HHTALRQAILCWGELT-SLGTWVGNNLEDQASRDLVVNYVNTNMGLKIRQ
GU563545_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FM199976_HBc_P-A      HHTALRQAXLCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
FJ904411_HBc_P-A      HHTALRQAILCWGELT-DLGSWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
FJ692609_HBc_P-A      HHTALRQAILCWGELT-TLGTWVGNNLQDPASRDQVVXYVNTHMGLKIRQ
FJ692565_HBc_P-A      HHTALRQAILCWGDVT-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
EU859939_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
EU859934_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
EU414050_HBc_P-A      HHTALRQAILCWGDVT-NLATWVGTNLNDPASRDQVVNYVNTNMGLKIRQ
EU414048_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDQVVNYVNTNMGLKIRQ
EF208113_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AY934772_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AY603441_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AY603432_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AY233283_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AY233281_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AM180624_HBc_P-A      HHTAXRQAILCWGXVM-TLATWVGXNLEDPASRDLVVNYVNTNMGLKIRQ
AF536524_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AF324126_HBc_P-A      HHTALRQAILCWGDVM-NLATWVGANLQDPASRDLVVNYVNTNMGLKIRQ
AF324121_HBc_P-A      HHTALRQAILCWVELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ867995_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRELVVNYVNTNMGLKIRQ
FJ867994_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ867962_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ867961_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ867960_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ867959_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ867947_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
FJ692605_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLXDPASRDLVVNYVNTXMGLKIRQ
FJ692612_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTXMGLKIRQ
V00866_HBc_P-A        HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
MK512466_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKISQ
MK512459_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
MK512457_HBc_P-A      HHTALRQAILCWGDVM-TLATWVGTNLEDPASRDLVVNYVNTNMGLKIRQ
MK512456_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
MF925407_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
MF925361_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KY382410_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KY271390_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDQVVNYVNTNMGLKIRQ
KT366467_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
KR905426_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
KP718101_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPHPRDLVVNYVNTNMGLKIRQ
KP168429_HBc_P-A      HHTALRQAILWWXELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KM606748_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KM606673_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KJ854703_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLXXNYVNTNMGLKIRQ
KJ854700_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KJ854691_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KJ854686_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KJ843172_HBc_P-A      HHTALRQAILCWGELM-TLASWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KF798291_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KF798267_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDQVVNYVNTNMGLKIRQ
KF779381_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KF779351_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
KF779295_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKFRQ
KF779294_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779293_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
KF779252_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
KF214662_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707681_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707676_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707675_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707674_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707672_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707670_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707669_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707667_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707665_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707664_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707663_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707662_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707661_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707659_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707658_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707370_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707367_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707366_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707365_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707364_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707363_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707362_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707361_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707360_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707359_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707358_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707357_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707356_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707355_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707354_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707353_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707352_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707351_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707350_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707349_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707348_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707347_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707345_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707337_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707334_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JQ707325_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707322_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707321_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707319_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
JQ707318_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707314_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707312_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JQ707300_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
JN182334_HBc_P-A      HHTALRQAILCWGEPM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439992_HBc_P-A      HHTALGQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439984_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKTRQ
JF439980_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKVRQ
JF439974_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439949_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKVRQ
JF439852_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439837_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
JF439835_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
HE576989_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
GQ184323_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
FN545837_HBc_P-A      HHTALRQAILCWGELM-XLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
FN545833_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
FM199981_HBc_P-A      HHTALRQAILCWGELM-XLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
FJ692610_HBc_P-A      HHTALRQAILCWGELT-TLXTWVGNNLQDPASRDQVVBYVNTHMGLKIRQ
EU859944_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
EU594387_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
EU414049_HBc_P-A      HHTALRQAILCWXXXX-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
EU185774_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
EU185746_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
DQ788725_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AY862868_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQ
AY738143_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AY738142_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AY738141_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AY738140_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AY738139_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AY233275_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AY152726_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AF537371_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AF350086_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLEDPASRDLVVSYVNTNMGLKFRQ
AF324135_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AF297623_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLDDPASRDLVVNYVNTNMGLKIRQ
AF297622_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AB697511_HBc_P-A      HHTALRQAILCWGELM-TLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQ
AB697491_HBc_P-A  &n