HBVdb

Dataset for protein HBe of genotype A

[Download (right click)] [Edit] [Sequences] [Repertoires]

1086 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KU605535_HBe_P-A      -QLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KU605536_HBe_P-A      -QIFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MF536836_HBe_P-A      MQLFHLCLFISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPT
KP857091_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPH
KP857066_HBe_P-A      MQLFHLCLVISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP857072_HBe_P-A      MQLFHLCLFTSCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP857068_HBe_P-A      MQLFHLCLFISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP857067_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ477462_HBe_P-A      LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPH
AB937797_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPT
AB076679_HBe_P-A      MQLFHLCLIISCTCPTIQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
MF925362_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPH
KX276769_HBe_P-A      LQLFHLCLIXSCTCPTFQASKLCLGWLWGMDIDPYKEFGASAELLSFLPS
KP857073_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPA
KP857070_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPS
KP857071_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPS
GQ477500_HBe_P-A      IQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPT
KM606696_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATTELVSFLPS
KF922414_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF922415_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF922416_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF922420_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF922418_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF922419_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF922421_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692588_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ349296_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATGELLSFLPS
AY034878_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF419536_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPH
FJ692593_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDLYKEFGATVELLSFLPS
KP857069_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
GU563547_HBe_P-A      LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATTDLLSFLPS
GQ477504_HBe_P-A      LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ477497_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLRWLWGMDIDPYKEFGATVELLSFLPS
GQ477488_HBe_P-A      TQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPA
GQ477475_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLRWLWGMDIDPYKEFGASVELLSFLPS
FJ692604_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPA
FJ692602_HBe_P-A      TQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPA
FJ692597_HBe_P-A      LQLFHLCLIIXCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLSFLPT
FJ692586_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPA
AB246317_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB194952_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP857092_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB194950_HBe_P-A      LQLFHLCLIISCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692564_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692565_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB194951_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692570_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP995108_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGATVELLSFLPS
KP857075_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPS
KP857074_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPN
JQ707577_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707595_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707596_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707600_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707605_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FN545828_HBe_P-A      MQLFHLCLIISCSCPTLQASKLCLGXLWGMDIDPYKEFGATVELLSFLPS
KP857078_HBe_P-A      LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPA
KP857077_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPI
KP857059_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ477501_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPH
GQ477487_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPH
GQ477472_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPT
FN545838_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FM199974_HBe_P-A      LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ904434_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPR
FJ692573_HBe_P-A      LQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPA
MH464825_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP857076_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP857064_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPA
KM606653_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
GQ477502_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPA
GQ477473_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPL
FN545826_HBe_P-A      MQLFHLCLIISCTCPTXQASKLCLGWLWGMDIDPYKEFGATVELISFLPS
FJ692576_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWDMDIDPYKEFGATVELLSFLPT
EU414050_HBe_P-A      TQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY233290_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AJ627228_HBe_P-A      MQLFHLCLVISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPH
AJ344115_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPS
AB453982_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB116083_HBe_P-A      MQLFHLCLIISCSCPTFQASKLCLGWLWDMDIDPYKEFGATVELLSFLPS
EU414052_HBe_P-A      LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU414133_HBe_P-A      LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606649_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
GQ477484_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ477474_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELISFLPS
FJ692592_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692587_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPN
AB116087_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512455_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MF925368_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KX357640_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KT749832_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELISFLPA
KM606695_HBe_P-A      MQLFHLCLIISCTCPTVQAYKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606647_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDHYKEFGATVELLSFLPL
KJ854685_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMAIDPYKEFGATVELLSFLPS
KF214658_HBe_P-A      MQLFHLCLIISCTCPTFQASQLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ477490_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ477478_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPT
GQ477469_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPL
FJ692567_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU414049_HBe_P-A      MXLFHLCLIISCTCPTVQASXLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU185786_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPN
AY152726_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPS
KF214666_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512467_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512460_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749833_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGATVELLSFLPS
KP857060_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPP
KJ843172_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707602_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707388_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707368_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPSKEFGATVELLSFLPS
JQ707346_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ477491_HBe_P-A      TQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVDLLSFLPS
GQ477463_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692561_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPX
FJ692555_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWDMDIDPYKEFGASVELLSFLPH
AF419535_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350087_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350083_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350081_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU185765_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPT
MH464817_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATXELLSFLPP
KM606650_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDLYKEFGATVELLSFLPS
KJ586809_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JX154579_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDLYKEFGATVELLSFLPS
JQ707576_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMNIDPYKEFGATAELLSFLPS
GQ477493_HBe_P-A      LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPT
GQ477464_HBe_P-A      LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPL
FN545830_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FN545829_HBe_P-A      LQLFHLCLIISCTCPTXQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FM199977_HBe_P-A      LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692611_HBe_P-A      MQLFHLCLIISCSCPTFQASKLCLGWLWGMDIDTYKEFGASVELLSFLPA
FJ692598_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692595_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPN
EU414048_HBe_P-A      LQLFHLCLITSCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AM180624_HBe_P-A      LQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB222707_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JN182323_HBe_P-A      --LFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JF440016_HBe_P-A      --LFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ867986_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWDMDIDRYKEFGATVELLSFLPS
FJ867960_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWDMDIDPYKEFGATVELLSFLPS
AY903452_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512472_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
MK512466_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512461_HBe_P-A      LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512457_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MF925400_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MF772348_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPS
MF772344_HBe_P-A      MQLFHLCLIISCTCPTIQASKLCLGWLWGMDIDPYKEYGATVELLSFLPS
KP857080_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KM606658_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLPS
KF922430_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM535200_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GU827640_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
GQ477495_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ477486_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPH
GQ477482_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGATVELLSFLPS
GQ477480_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASTELLSFLPS
GQ477479_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPA
GQ477468_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ477466_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ331047_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FN545825_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692613_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692577_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692566_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859952_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859944_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY738141_HBe_P-A      XQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY738140_HBe_P-A      XQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY603446_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY603438_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY603432_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPS
AY233287_HBe_P-A      MQLFHLCLIITCTCPTLQASKLCLGWLWDMDIDPYKEFGATVELLSFLPS
AJ309371_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF536524_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF419534_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854698_HBe_P-A      --LFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854693_HBe_P-A      --LFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ868008_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPA
FJ867995_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ867994_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ867985_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ867961_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ867958_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDRYKEFGATVELLSFLPS
FJ867949_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDRYKEFGATVELLSFLPS
FJ867948_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDRYKEFGATVELLSFLPS
FJ867947_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ867946_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDRYKEFGATVELLSFLPS
EU185775_HBe_P-A      LQLFHLXLIISCTCPTVGASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512471_HBe_P-A      LQLFHLCLIISCSCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512463_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512458_HBe_P-A      MQLFHLCLIISCSSPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MF925361_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
MF772353_HBe_P-A      MQLFHLCLIIFCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KX827296_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KX827295_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KX827294_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KX827293_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KU736920_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKXFGATVELLSFLPS
KT749839_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749824_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP857061_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPH
KP718101_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP168427_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP168426_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP168425_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606742_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPF
KM606688_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
KM606656_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF922409_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF922408_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KC875252_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JX154582_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDLYKEFGATVELLSFLPS
JX154581_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDLYKEFGATVELLSFLPS
JX154580_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDLYKEFGATVELLSFLPS
JX096953_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELPSFLPS
JQ707582_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707565_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707555_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707414_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707387_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707345_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELVSFLPS
JQ707336_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707329_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707315_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707312_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707300_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ687533_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JN182332_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JN182318_HBe_P-A      XXLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ477465_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ222208_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FN545835_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FN545831_HBe_P-A      MQLFHLCLIISCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FM199975_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692608_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692606_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692601_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692599_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692591_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692590_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692585_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692584_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692583_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692582_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692581_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692580_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692579_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692578_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692575_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692574_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692571_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692563_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692562_HBe_P-A      MQLFHLCLIISCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLSFLPA
FJ692559_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692557_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692554_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU410082_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU054331_HBe_C-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
DQ788725_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
DQ315784_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
DQ020003_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY934774_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY934771_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY934770_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY934769_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY934768_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY934767_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY934765_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY934764_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY934763_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY373432_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY373429_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY373428_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY233286_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY233278_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY233276_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AM494718_HBe_P-A      MQLFHLCLIISCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AM184126_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AM184125_HBe_P-A      MQLFHLCLIISCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350098_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350097_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350096_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350095_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350094_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350093_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350092_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350091_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350090_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350089_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350088_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350086_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350085_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350084_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350082_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF350080_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF297625_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF090842_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF043560_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB937796_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB937795_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB937791_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512464_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512462_HBe_P-A      KQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPS
MH580643_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MH580642_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MH580639_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MH580627_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP857079_HBe_P-A      MPLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP718100_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP168435_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606737_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
KJ843182_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KC875257_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JQ707623_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707356_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GU563550_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWVWGMDIDPYKEFGATGELLSFLPS
AF537371_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697497_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697496_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697495_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697493_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697492_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697491_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697489_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697488_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU185750_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
LT992448_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
LT992441_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854709_HBe_P-A      --LFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JN182329_HBe_P-A      --LFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JN182322_HBe_P-A      --LFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512470_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPS
MH464814_HBe_P-A      LQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KX648547_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATXELLSFLPS
KU605533_HBe_P-A      MQIFHLCIIISYSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP718089_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF922431_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KF922429_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KC875256_HBe_P-A      TQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KC836858_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JQ707335_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
HM535205_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
HE576989_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
HE576988_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GU563562_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GU563558_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GU563557_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GU563555_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GU563554_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GU563553_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GU563548_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GU563546_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GU563545_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ477503_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ477496_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ477467_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ477461_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ414522_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ184324_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATLELLSFLPS
GQ184323_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FM199980_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FM199979_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FM199978_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FM199976_HBe_P-A      MQLFHLCLIISCTCXTVQASKLCLGWLXGMDIDPYKEFGATVELLSFLPS
FJ349224_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ349222_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859956_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859955_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859954_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859953_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859951_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859950_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859949_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859948_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859947_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859946_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859945_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859943_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859942_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859941_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859940_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859939_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859937_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859936_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859935_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859934_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859933_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859932_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859931_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859930_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859929_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859928_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859927_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859926_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859925_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859924_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859923_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859922_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859921_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859920_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859919_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVEFLSFLPS
EU859918_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859917_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859916_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859915_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859914_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859913_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859912_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859911_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859910_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859909_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859908_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859907_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859906_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859905_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859904_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859903_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859902_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859901_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859900_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859899_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU859898_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU594395_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU594394_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU594393_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU594392_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU594391_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU594390_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU594389_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU594388_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU594387_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU594386_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU594385_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU594384_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPA
EU594383_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU185789_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU185774_HBe_P-A      MQLFHLCLIISRACPTVZASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU185746_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU086721_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EF208113_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
DQ315786_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
DQ020002_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY934773_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY934772_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY934766_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY902775_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY862868_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY862867_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCPGWLWGMDIDPYKEFGATVELLSFLPS
AY738143_HBe_P-A      XQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY738142_HBe_P-A      XQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY738139_HBe_P-A      XQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY707087_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY603441_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY603436_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY603435_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY603431_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY603430_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY603429_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY233289_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY233288_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY233285_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY233284_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY233283_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY233282_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY233281_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY233280_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY233279_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY233275_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY233274_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY161139_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY161138_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY128092_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AM410963_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AM295797_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AM295796_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AM295795_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AM282986_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AJ309370_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AJ309369_HBe_P-A      MQLFHLCQIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AJ012207_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF537372_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF297624_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF297623_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF297622_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF090841_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF090840_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLPS
AF090839_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AF043580_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB937798_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB937794_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB937793_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB937792_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB775201_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB775200_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB775199_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB775198_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697512_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697511_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697509_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697508_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697507_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697506_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697505_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697504_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697503_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697501_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697499_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
Z72478_HBe_P-A        MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
Z35717_HBe_P-A        MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
X70185_HBe_P-A        MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
X51970_HBe_P-A        MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
X07911_HBe_P-A        MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
X02763_HBe_C-A        MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
V00866_HBe_P-A        MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512476_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512475_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
MK512474_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512473_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512469_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512468_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512465_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512459_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MH932713_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MH464830_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MH464828_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MH464818_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MH464815_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MH464813_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MH464810_HBe_P-A      XQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MH464808_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKKFGAXVELLSFLPS
MF772350_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MF772346_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATTELLSFLPS
LT992440_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
LC458431_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
LC458430_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
LC311243_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
LC311242_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
LC311241_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
LC074724_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
L13994_HBe_P-A        MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KY886219_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KY382410_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KY003230_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KX827298_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KX648549_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KX648548_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KX357646_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KU605539_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KU605538_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KU605537_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KU605534_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KU605532_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KU605522_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KU605521_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KU605520_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KU605519_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KU605518_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KU605517_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KU605516_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749850_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749849_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749847_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749846_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749844_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749843_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749842_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749840_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749838_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749837_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749836_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749835_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749834_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749831_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749830_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749829_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749826_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT749825_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT347088_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT347087_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT151614_HBe_P-A      MQLFHLCLIISCTCPTXQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP857063_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP857058_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP718099_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP718098_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP718097_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP718096_HBe_P-A      MQLFHLCIIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP718095_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP718094_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP718093_HBe_P-A      MQLLHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP718091_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP718088_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP718087_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP274928_HBe_P-A      MQLFHLCLMMSCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP274927_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP274925_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP168434_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP168424_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP168423_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606749_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606746_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606700_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606694_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606691_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606687_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606685_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606684_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606683_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606680_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606678_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606677_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606676_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606674_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606672_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606669_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606666_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606665_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606663_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606661_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606660_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606652_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606648_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM519454_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM519453_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854710_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854708_HBe_P-A      MQLFHLCLIXSCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ843218_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ843217_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ843216_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ843215_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ843214_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ843192_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ843188_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ843186_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ843184_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ843173_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ843166_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ010778_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ010777_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ010776_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF922407_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF922406_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KC875259_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYQEFGATVELLSFLPS
KC875253_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDVDPYKEFGATVELLSFLPS
KC875251_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KC836854_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KC836849_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KC836834_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KC836832_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KC836831_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JX096952_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707681_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707676_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707675_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707674_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707672_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707670_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707669_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707667_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707665_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707664_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707663_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707662_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707661_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707659_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707658_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707656_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707655_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707654_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707653_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707652_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707651_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707650_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707649_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707648_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707647_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707646_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707645_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707644_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707643_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707642_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707641_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707640_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707639_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707638_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707637_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707636_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707635_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707634_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707633_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707632_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707631_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707630_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707629_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707628_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707627_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707626_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707625_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707624_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707622_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707621_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707620_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707619_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707618_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707617_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707616_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707615_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707614_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707613_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707612_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707611_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707610_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707609_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707608_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707607_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707606_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707604_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707603_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707601_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707599_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707598_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707597_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707594_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707593_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLAFLPS
JQ707592_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707591_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707590_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707589_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707588_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707587_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707586_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707585_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707584_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707583_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707581_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707580_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707579_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707578_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLLFLPS
JQ707575_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707574_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPS
JQ707573_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707572_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707571_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707570_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707569_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707568_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707567_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707566_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707564_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707563_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707562_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707561_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707560_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707559_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707558_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707557_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707556_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707554_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707553_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707552_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707551_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707550_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707549_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707548_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707547_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707546_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707545_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707544_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707543_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707542_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707541_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707540_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707539_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707538_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707537_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707536_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707535_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707534_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707533_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707532_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707531_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707420_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707419_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707418_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707417_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707416_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707415_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707413_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707412_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707411_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707410_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707409_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707408_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707407_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707406_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707405_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707404_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707403_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707402_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707401_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707400_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707399_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707398_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707397_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707396_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707395_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707394_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707393_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707392_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707391_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707390_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707389_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707386_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707385_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707384_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707383_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707382_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707381_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707380_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707379_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707378_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707377_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707376_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707375_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707374_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707373_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707372_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707371_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707370_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707369_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707367_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707366_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707365_HBe_P-A      MQLFHLCLIISCSSPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707364_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707363_HBe_P-A      MQLFHLCLIISCSCPTVPASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707362_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707361_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707360_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707359_HBe_P-A      MQLFHLCLIISCSCPTVQAFKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707358_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707357_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707355_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707354_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707353_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707352_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707351_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707350_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707349_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707348_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707347_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707344_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707343_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707342_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707341_HBe_P-A      MQLFHLCLIISCSCPTVQAFKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707340_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707339_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707338_HBe_P-A      MQLFHLCLIISCSFPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707337_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707334_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707333_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707332_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707331_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707330_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707327_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707326_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707325_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707324_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707323_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707322_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707321_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707320_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707319_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707318_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707317_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707316_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707314_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707313_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707311_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707310_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707309_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707308_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707307_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707306_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707305_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707304_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707303_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707302_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707301_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ707299_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ687529_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JN182333_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JN182331_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JN182330_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JN182328_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCPGWLWGMDIDPYKEFGATVELLSFLPS
JN182325_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JN182324_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JN182321_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP718092_HBe_P-A      MQLFHLCLIIXCTCPTVQAXKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU185787_HBe_P-A      MQLFHLCLIISXXCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB697487_HBe_P-A      MQLFHLCLIISCXCPTVQASKLCLGWLWGMDIDPYKEFGAXVELLSFLPS
AB697498_HBe_P-A      MQLFHLCLIISCXCPTVQASKLCLGWLWXMDIDPYKEFGAXVELLSFLPS
KP718090_HBe_P-A      MQLFHLCLIIXCTCPXVXAXKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JN182319_HBe_P-A      MQLFXXXXXXXXXCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JN182327_HBe_P-A      MQLXXXXXXXXXXCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JN182334_HBe_P-A      MQLXXXXXXXXCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB116092_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AY161143_HBe_P-A      MQLFHLCLIISCTCSTFQASKLCLGWLWGMDIDPYKEYGATVELLSFLPS
AY161144_HBe_P-A      MQLFHLCLIISCTCSTFQASKLCLGWLWGMDIDPYKEYGATVELLSFLPS
AY161142_HBe_P-A      MQLFHLCLIISCTCSTFQASKLCLGWLWGMDIDPYKEYGATVELLSFLPS
AJ627226_HBe_P-A      MQLFHLCLVISCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPP
AB116088_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDLYKEFGATVELLSFLPS
AB116086_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATADLLSFLPS
KJ854701_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
EU304331_HBe_P-A      IQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPX
EU366129_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
FN545834_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB453986_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MK512456_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ477476_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLSFLPT
FJ692607_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPA
AB453989_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU185776_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EU185777_HBe_P-A      MQLFHLCLIIXCTCPTVQASKLCXGWLWGMDIDPYKEFGATVELLSFLPS
AB116076_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVQLLSFLPS
FJ868002_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDRYKEFGATVELLSFLPS
FJ692558_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPY
FJ692596_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPX
KF798266_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KX357649_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPR
KP857065_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ023661_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
JQ023660_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
EF103278_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB126580_HBe_P-A      MQLFHLCLIISRTCPTVQASKLCLGWLWGMDIDPHKEFGATVELLSFLPS
AB116089_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVQLLSFLPS
AB014370_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB064314_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB076678_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB116077_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB116078_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB116079_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB116080_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB116081_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB205118_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB246337_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB246338_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB300366_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB300367_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB362931_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB453979_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB453980_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB453981_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB453984_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB480036_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB480038_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB480039_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB480040_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB480041_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB549213_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FN545833_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB116082_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB116085_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB116090_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB116091_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB116093_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB116094_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB241114_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB241115_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB246335_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB246336_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATGELLSFLPS
AB453987_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB453988_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
AB116084_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF798267_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KR905426_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT366467_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692600_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPT
FJ692603_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDHYKEFGAXVELLSFLPS
KP857062_HBe_P-A      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
M57663_HBe_P-A        MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP168428_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KF214660_HBe_P-A      MQLFHLCLISSCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ477498_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ161813_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FN545839_HBe_P-A      MQLFHLCLIISCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLPX
MF925372_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT366466_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KR905427_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KR905425_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854690_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF798265_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
GQ331046_HBe_P-A      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPA
KX357644_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATTELLSFLPS
KT366471_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP168429_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLXS
KJ854703_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDFDPYKEFGATVELLSFLPS
KF798308_HBe_P-A      LQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MF925407_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MF925385_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MF925373_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
MF772351_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
M74501_HBe_P-A        MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
LK995385_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
LC051141_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KX686607_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KX357647_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KX357645_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KX357643_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KX357642_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KU736919_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KU736918_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT366470_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT366469_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT366468_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT151618_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT151617_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATSELLSFLPS
KT151616_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT151615_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDHYKEFGATVELLSFLPX
KT151613_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KT151612_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATSELLSFLPS
KT151611_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KR905431_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KR905430_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KR905429_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP718086_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP718085_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP168433_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP168432_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KP168430_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM606673_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM519452_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KM243029_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854707_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854706_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854705_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854704_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854702_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854700_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854699_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854697_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854696_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854694_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854692_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854691_HBe_P-A      MQLFHLCLIXSCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854689_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854688_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854687_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ854686_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KJ843183_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF922428_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF922427_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF922426_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF922425_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF922424_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF798314_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF798311_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF798310_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF798309_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF798302_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF798292_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF798291_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF798290_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF798289_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF798286_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF798285_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF798279_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF798278_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF798271_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF214665_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF214663_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF214662_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF214661_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF214659_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KF214657_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KC875260_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KC875258_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KC875255_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
KC836846_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FN545840_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FN545836_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPS
FJ692612_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDXYKEFGATVELLSFLPS
FJ692605_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDXYKEFGATVELLSFLPS
FN545832_HBe_P-A      MQLFHLCLIISCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLPA
                        :               *  **   :  * .*  : :**  ::  **  

KU605535_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KU605536_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MF536836_HBe_P-A      DFFPSVRDLLHTASALYREALESPEHCSSHHTALRQAILCWGELLYSLPT
KP857091_HBe_P-A      DFFPSIRDLLDTASALYREALESPEHCSHHHTAIRQAILCWGELT-TLAT
KP857066_HBe_P-A      DFFPSVKDLYDTALALHREALESPEHCTHHHTALRQAILCWGDLM-NLAN
KP857072_HBe_P-A      DFFPSARDLLDTASALFREALESPEHGSSHHTALRQAILCWQEVT-TLAS
KP857068_HBe_P-A      DFFPSVRDLLDTASALYRDALESPEHCSPHHTAIRQIVLCWGDVM-NLAT
KP857067_HBe_P-A      DFFPSVKDLLDTASALYRDALESAEHCSPHHTALRQAILCWGDVM-TLGT
GQ477462_HBe_P-A      DFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELT-SLGT
AB937797_HBe_P-A      DFFPSVKDLLDTASALYRDALESPEHCSAHHTALRQVSLCWVELM-TLAT
AB076679_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELT-TLAT
MF925362_HBe_P-A      DFFPNVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVM-NLAT
KX276769_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSSHHTALRQAILCWGELM-TLAS
KP857073_HBe_P-A      DFYPSVRDLLDTATALYREALESPEHCSAHHTAIRQAILCWGELM-TLAS
KP857070_HBe_P-A      DFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDLT-TLGS
KP857071_HBe_P-A      DFFPSVRDLLDTASALYREXLESPEHCSPHHTALRQAILCWGDLT-TLGS
GQ477500_HBe_P-A      DFFPSVKDLLDTASALYREALESSEHCSPHHTAIRQVILCWGDVM-TLGT
KM606696_HBe_P-A      DFFPNTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF922414_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVM-NLAT
KF922415_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVM-NLAT
KF922416_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVM-NLAT
KF922420_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVM-NLAT
KF922418_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVM-NLAT
KF922419_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVM-NLAT
KF922421_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVM-NLAT
FJ692588_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ349296_HBe_P-A      DFFPSVRDLLNTASALYREALKSPGHCSPHHTALRQAILCWGELM-TLAT
AY034878_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELM-TLAT
AF419536_HBe_P-A      DFFPSVRDLLDTVSALYREALESPEHCSPHHTAIRQAILCWGQLM-TLAT
FJ692593_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP857069_HBe_P-A      DFFPSARDLLDTASALYREALESPEHCSSHHTALRQAILCWGELT-TLAT
GU563547_HBe_P-A      DFFPSVRDLRDTTSALYREALESPEHCSSHHTAIRQAILCWGELM-TLAT
GQ477504_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELS-TLAT
GQ477497_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELT-TLGT
GQ477488_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSHHHTAIRQAILCWGELM-TLAS
GQ477475_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTAIRQVVLCWGELM-TLAT
FJ692604_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-TLAT
FJ692602_HBe_P-A      DFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAILCWGDLS-TLAT
FJ692597_HBe_P-A      DFFPSVRDLLDTASALFXEALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692586_HBe_P-A      DFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLT-TLGS
AB246317_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-TLAT
AB194952_HBe_P-A      DFFPSVRDLLDTSAALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP857092_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWVELX-TLAT
AB194950_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVT-NLAT
FJ692564_HBe_P-A      DFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVT-TLAT
FJ692565_HBe_P-A      DFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVT-TLAT
AB194951_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVT-NLAT
FJ692570_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVT-NLAT
KP995108_HBe_P-A      DFYPSVRDLVDTASALYREALESPEHGSPHHTALRQAIVCWGELM-TLAT
KP857075_HBe_P-A      DFFPSVRDLLDTASALYREALESSEHCSPHHTALRQAALCWWELT-TLAT
KP857074_HBe_P-A      DFYPSVKDLLDTASALYREALESPEHCSAHHTALRQAILCWGELM-TLAT
JQ707577_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELM-TLAT
JQ707595_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELM-TLAT
JQ707596_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELM-TLAT
JQ707600_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELM-TLAT
JQ707605_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELM-TLAT
FN545828_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELM-TLAS
KP857078_HBe_P-A      DFFPSTKDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVM-TLGT
KP857077_HBe_P-A      DFYPSVRDLIETASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP857059_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELM-TLAT
GQ477501_HBe_P-A      DFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGELT-TLGT
GQ477487_HBe_P-A      DFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELS-TLAT
GQ477472_HBe_P-A      DFFPGVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELT-TLAT
FN545838_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVM-SLAT
FM199974_HBe_P-A      DFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELM-ALAS
FJ904434_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQIILCWGDVM-TLAT
FJ692573_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVM-TLAT
MH464825_HBe_P-A      DFFPPVRDLLGTAAALYREALESSDHCSPHHTALRQALLCWGELM-TLAT
KP857076_HBe_P-A      DFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGEVT-XLAT
KP857064_HBe_P-A      DFFPSVRDLLDTASALYREALEAPEHCSPHHTALRQAILCWGELM-TLAT
KM606653_HBe_P-A      DFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQEILCWGELM-TLAT
GQ477502_HBe_P-A      DFFPNVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-NLAT
GQ477473_HBe_P-A      DFFPSARDLLDTASALYREGLESPEHCSPHHTALRQAILCWGELT-ALAT
FN545826_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-TLAT
FJ692576_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
EU414050_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVT-NLAT
AY233290_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVM-NLAS
AJ627228_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQCVLCWGELM-TLAT
AJ344115_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAS
AB453982_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELT-TLGT
AB116083_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU414052_HBe_P-A      DFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWADVT-NLAT
EU414133_HBe_P-A      DFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWADVT-NLAT
KM606649_HBe_P-A      DFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGELM-TLAT
GQ477484_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVM-SLAT
GQ477474_HBe_P-A      DFFPSVRDLLDTASALYREALESSEHCSPHHTAIRHVLLCWVELM-TLAN
FJ692592_HBe_P-A      DFYPSVRDLLDTASALYREGLESPEHCSPHHTALRQAILXWGELM-TLAT
FJ692587_HBe_P-A      DFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGDVM-TLGT
AB116087_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSRHHTALRQAILCWGELM-TLAT
MK512455_HBe_P-A      DFFPSVRDLLDTASALNREALESPEHCSPHHTALRQAILCWGELM-TLAT
MF925368_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELT-TLGT
KX357640_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVT-NLAT
KT749832_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSAHHTALRQAILCWGELM-TLAT
KM606695_HBe_P-A      DFFPSVRDLLDTASALYREALESHEHCSPHHTALRQAILCWGELM-TLAT
KM606647_HBe_P-A      DFFPSARDLLETASALYRESLESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854685_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELS-TLGT
KF214658_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLM-TLAT
GQ477490_HBe_P-A      DFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVM-TLAT
GQ477478_HBe_P-A      DYYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GQ477469_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAVLCWGELM-TLAT
FJ692567_HBe_P-A      DFFPSVRDLLDTASALYRDGLESPEHCXPHHTALRQAILCWGELM-TLAT
EU414049_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWXXXX-TLAT
EU185786_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELT-TLGT
AY152726_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF214666_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELT-TLAG
MK512467_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELR-TLAT
MK512460_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749833_HBe_P-A      DFFPSVRDLVDTASALHREALESPEHCSPHHTALRQAIVCWGELM-TLAT
KP857060_HBe_P-A      DFFPSARDLLDTAAALFREALESPEHCSPHHTALRQASLCWVELM-TLAT
KJ843172_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAS
JQ707602_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGKLM-TLAT
JQ707388_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707368_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707346_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GQ477491_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GQ477463_HBe_P-A      DFFPSVRDLLDTASALYREALESPDHCTPHHTALRQAILCWVELM-TLAS
FJ692561_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVM-TLAT
FJ692555_HBe_P-A      DFFPSVRDLLDTASXLYREALESPEHCSPXHTAIRQAILCWGELM-TLAT
AF419535_HBe_P-A      DFFPSVRDLLDTVSALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350087_HBe_P-A      DFFPSVRDLLDTASALNREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350083_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIICWGELM-TLAT
AF350081_HBe_P-A      DFFPSVPDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU185765_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MH464817_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-TLAT
KM606650_HBe_P-A      DFFPAVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELM-TLGT
KJ586809_HBe_P-A      DFFPSVKDLLNTASALYREALESPEHCSPHHTALRQAILCWGELM-TLST
JX154579_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELM-TLGT
JQ707576_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GQ477493_HBe_P-A      DFFPSARDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELM-TLAT
GQ477464_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
FN545830_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELM-TLAT
FN545829_HBe_P-A      DFFPSARDLLDTASALYREGLESPEHCTPHHTALRQAILCWGELM-TLAT
FM199977_HBe_P-A      DFFPSVRDLLDTASALQREALESHEHCSPHHTALRQAILCWGELM-TLAT
FJ692611_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAS
FJ692598_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGEVM-BLGN
FJ692595_HBe_P-A      DFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU414048_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
AM180624_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHGSXHHTAXRQAILCWGXVM-TLAT
AB222707_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JN182323_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JF440016_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ867986_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ867960_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY903452_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MK512472_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELT-TLAT
MK512466_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MK512461_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSHHHTAIRQAILCWVELM-TLAT
MK512457_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVM-TLAT
MF925400_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MF772348_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELM-TLAT
MF772344_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP857080_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-TLAT
KM606658_HBe_P-A      DFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF922430_HBe_P-A      DFFPSVRDLLDTALALYREALESPEHCSPHHTAIRQAILCWGELM-IFAT
HM535200_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GU827640_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELT-SLGT
GQ477495_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWVELM-TLAT
GQ477486_HBe_P-A      DFFPSVRDLLDTAAALFREALESPEHCSPHHTALRQAILCWGELM-TLAT
GQ477482_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIICWGELM-TLAT
GQ477480_HBe_P-A      DFFPNVRDLLDTASALYREALESPEHCTPHHTALRQAVLCWGELM-NLAT
GQ477479_HBe_P-A      DYYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GQ477468_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVM-TLAT
GQ477466_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAVLCWGELM-TLAT
GQ331047_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FN545825_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-TLAT
FJ692613_HBe_P-A      DFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELM-TLAT
FJ692577_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELM-TLAT
FJ692566_HBe_P-A      DFFPSVRDLLDTAAALYRESLESPEHCSPHHTALRQAILCWGELM-TLAT
EU859952_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859944_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY738141_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY738140_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY603446_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY603438_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY603432_HBe_P-A      DFFPSVLDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
AY233287_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-ALAT
AJ309371_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF536524_HBe_P-A      DFFPSVRDLLDTASTLYREALESPEHCSPHHTALRQAILCWVELM-TLAT
AF419534_HBe_P-A      DFFPSVRDLLDTVSALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854698_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854693_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ868008_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ867995_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ867994_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ867985_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ867961_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ867958_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ867949_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ867948_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ867947_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ867946_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU185775_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MK512471_HBe_P-A      DFFPSVRDLLDTAGALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MK512463_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
MK512458_HBe_P-A      DFFPSVRDLLDTASALYREALESPDDCSPHHTALRQAILCWGELM-TLAT
MF925361_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MF772353_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KX827296_HBe_P-A      DFFPSVGDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KX827295_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIPCWGELM-TLAT
KX827294_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLM-TLAT
KX827293_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KU736920_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749839_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749824_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP857061_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELM-TLAT
KP718101_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP168427_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP168426_HBe_P-A      DFFPSVRDLLDTALALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP168425_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIFWWVELM-TLAT
KM606742_HBe_P-A      DFFPSVRDFLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606688_HBe_P-A      DFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAVLCWGELM-TLAT
KM606656_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF922409_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF922408_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KC875252_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIHCWGELM-TLAT
JX154582_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELM-TLGT
JX154581_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELM-TLGT
JX154580_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELM-TLGT
JX096953_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707582_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELM-TLAT
JQ707565_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHSSPHHTALRQAILCWGELM-TLAT
JQ707555_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLM-TLAT
JQ707414_HBe_P-A      DFFPSVRDLLDTASTLYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707387_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707345_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707336_HBe_P-A      DFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707329_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707315_HBe_P-A      GFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707312_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707300_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ687533_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JN182332_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JN182318_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GQ477465_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAS
GQ222208_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWRELM-TLAT
FN545835_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELM-TLAT
FN545831_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FM199975_HBe_P-A      DFFPSVRDLLDTASALYREALESXEHCXPHHTALRQAILCWGELM-TLAT
FJ692608_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELM-TLAT
FJ692606_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELM-TLAT
FJ692601_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692599_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELM-TLAT
FJ692591_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692590_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692585_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692584_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692583_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692582_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692581_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692580_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692579_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692578_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692575_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692574_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692571_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692563_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692562_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692559_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELM-TLAT
FJ692557_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692554_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU410082_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU054331_HBe_C-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
DQ788725_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
DQ315784_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-TLAT
DQ020003_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY934774_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY934771_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY934770_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY934769_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY934768_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY934767_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY934765_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY934764_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY934763_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY373432_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY373429_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY373428_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY233286_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY233278_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY233276_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AM494718_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AM184126_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AM184125_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350098_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350097_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350096_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350095_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350094_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350093_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350092_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350091_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350090_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350089_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350088_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350086_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350085_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350084_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350082_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF350080_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF297625_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRETILCWGELM-TLAT
AF090842_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF043560_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB937796_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB937795_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB937791_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MK512464_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELM-TLAT
MK512462_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-TLAT
MH580643_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MH580642_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MH580639_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MH580627_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP857079_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHXSPHHTALRQAILCWGXVM-TLGT
KP718100_HBe_P-A      DFFPSVRDXLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP168435_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606737_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ843182_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KC875257_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-NLAT
JQ707623_HBe_P-A      DFFPSVRDLLDTASALYREALEFPEHCSPHHTALRQAILCWGELM-TLAT
JQ707356_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GU563550_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF537371_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697497_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697496_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697495_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697493_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697492_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697491_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697489_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697488_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU185750_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
LT992448_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
LT992441_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854709_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JN182329_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JN182322_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MK512470_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MH464814_HBe_P-A      DFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KX648547_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KU605533_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP718089_HBe_P-A      DFFPSVRDLLDTASALYREALEXPEHCSPHHTALRQAIXCWGELM-TLAT
KF922431_HBe_P-A      DFFPSVRDLLDTALALYREALESPEHCSPHHTAIRQAILCWGELM-TLAT
KF922429_HBe_P-A      DFFPSVRDLLDTALALYREALESPEHCSPHHTAIRQAILCWGELM-TLAT
KC875256_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCAPHHTALRQAILCWGELM-TLAT
KC836858_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707335_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
HM535205_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
HE576989_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
HE576988_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GU563562_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GU563558_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GU563557_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GU563555_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GU563554_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GU563553_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GU563548_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GU563546_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GU563545_HBe_P-A      DFFPSVRDLCDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GQ477503_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GQ477496_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GQ477467_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GQ477461_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GQ414522_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GQ184324_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
GQ184323_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FM199980_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FM199979_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FM199978_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FM199976_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELM-TLAT
FJ349224_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ349222_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859956_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859955_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859954_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859953_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859951_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859950_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859949_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859948_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859947_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859946_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859945_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859943_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859942_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859941_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859940_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859939_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
EU859937_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859936_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859935_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859934_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859933_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859932_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859931_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859930_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859929_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859928_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859927_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859926_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859925_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859924_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859923_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859922_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859921_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859920_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859919_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859918_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859917_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859916_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859915_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859914_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859913_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859912_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859911_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859910_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859909_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859908_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859907_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859906_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859905_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859904_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859903_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859902_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859901_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859900_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859899_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU859898_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU594395_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU594394_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU594393_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU594392_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU594391_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU594390_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU594389_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU594388_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU594387_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU594386_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU594385_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU594384_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU594383_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU185789_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU185774_HBe_P-A      DFFPSVRDLLBTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU185746_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU086721_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EF208113_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
DQ315786_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
DQ020002_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY934773_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY934772_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
AY934766_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY902775_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY862868_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY862867_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY738143_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY738142_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY738139_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY707087_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY603441_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
AY603436_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY603435_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY603431_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY603430_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY603429_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY233289_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY233288_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY233285_HBe_P-A      DFFPSVRDLLDTASAQYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY233284_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY233283_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY233282_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY233281_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY233280_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY233279_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTAHRQAILCWGELM-TLAT
AY233275_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY233274_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY161139_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY161138_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AY128092_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AM410963_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AM295797_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AM295796_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AM295795_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AM282986_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AJ309370_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AJ309369_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AJ012207_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF537372_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-TLAT
AF297624_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF297623_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF297622_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF090841_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF090840_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF090839_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AF043580_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB937798_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB937794_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB937793_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB937792_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB775201_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB775200_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB775199_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB775198_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697512_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697511_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697509_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697508_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697507_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697506_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697505_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697504_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697503_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697501_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697499_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
Z72478_HBe_P-A        DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
Z35717_HBe_P-A        DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
X70185_HBe_P-A        DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
X51970_HBe_P-A        DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
X07911_HBe_P-A        DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
X02763_HBe_C-A        DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
V00866_HBe_P-A        DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MK512476_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
MK512475_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MK512474_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
MK512473_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MK512469_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MK512468_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MK512465_HBe_P-A      DFFPSVRDLLDTASALYREGLESPEHCSPHHTALRQAILCWVELM-TLAT
MK512459_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MH932713_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MH464830_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MH464828_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MH464818_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MH464815_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MH464813_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MH464810_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MH464808_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTAXRQAILCWGEXM-XLAX
MF772350_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
MF772346_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
LT992440_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
LC458431_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
LC458430_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
LC311243_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
LC311242_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPNHTALRQAILCWGELM-TLAT
LC311241_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
LC074724_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
L13994_HBe_P-A        DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KY886219_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
KY382410_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KY003230_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KX827298_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KX648549_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KX648548_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KX357646_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
KU605539_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KU605538_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KU605537_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KU605534_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KU605532_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KU605522_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KU605521_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KU605520_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KU605519_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KU605518_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KU605517_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KU605516_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749850_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749849_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749847_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749846_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749844_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749843_HBe_P-A      DFFPSVRDLLDTASAMYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749842_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749840_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749838_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749837_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749836_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749835_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749834_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749831_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749830_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749829_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749826_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT749825_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT347088_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT347087_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT151614_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP857063_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP857058_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
KP718099_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP718098_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP718097_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP718096_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP718095_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP718094_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP718093_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP718091_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP718088_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP718087_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP274928_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP274927_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP274925_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP168434_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP168424_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP168423_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606749_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606746_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606700_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606694_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606691_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606687_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606685_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606684_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606683_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606680_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606678_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606677_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606676_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606674_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606672_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606669_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606666_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
KM606665_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
KM606663_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606661_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606660_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606652_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606648_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM519454_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM519453_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854710_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854708_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ843218_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ843217_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ843216_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ843215_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ843214_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ843192_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ843188_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ843186_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ843184_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
KJ843173_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ843166_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ010778_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ010777_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ010776_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF922407_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF922406_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KC875259_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KC875253_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KC875251_HBe_P-A      DFFPSVRDLLDTASALYREALGSPEHCSPHHPALRQAILCWGELM-TLAT
KC836854_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KC836849_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KC836834_HBe_P-A      DFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KC836832_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KC836831_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JX096952_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707681_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707676_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707675_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707674_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707672_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707670_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707669_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707667_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707665_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707664_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707663_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707662_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707661_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707659_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707658_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707656_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707655_HBe_P-A      DFFPSVRELLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707654_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707653_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707652_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707651_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707650_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707649_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707648_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707647_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707646_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707645_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707644_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707643_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707642_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707641_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707640_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707639_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707638_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707637_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707636_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707635_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707634_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707633_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707632_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707631_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707630_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707629_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707628_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707627_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707626_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707625_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707624_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707622_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707621_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707620_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707619_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707618_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707617_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707616_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707615_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
JQ707614_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707613_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707612_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707611_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707610_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707609_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707608_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707607_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707606_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707604_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707603_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707601_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707599_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707598_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707597_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707594_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707593_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707592_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707591_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707590_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707589_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707588_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707587_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707586_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707585_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707584_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707583_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707581_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707580_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707579_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707578_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707575_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707574_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707573_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707572_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707571_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707570_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707569_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707568_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707567_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707566_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707564_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707563_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707562_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707561_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707560_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707559_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707558_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707557_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707556_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707554_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707553_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707552_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707551_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707550_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707549_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707548_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707547_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707546_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707545_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707544_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707543_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707542_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707541_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707540_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707539_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707538_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707537_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707536_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707535_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707534_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707533_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707532_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707531_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707420_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707419_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707418_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707417_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707416_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707415_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707413_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707412_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707411_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707410_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707409_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707408_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707407_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707406_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707405_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707404_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707403_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707402_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707401_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707400_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707399_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707398_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707397_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707396_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707395_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707394_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707393_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707392_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707391_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707390_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707389_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707386_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707385_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707384_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707383_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707382_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707381_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707380_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707379_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707378_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707377_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707376_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707375_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707374_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707373_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707372_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707371_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707370_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707369_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707367_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707366_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707365_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707364_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707363_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707362_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707361_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707360_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707359_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707358_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707357_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707355_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707354_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707353_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707352_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707351_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707350_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707349_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707348_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707347_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707344_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707343_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707342_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707341_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707340_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707339_HBe_P-A      DFFPSVRDLLDTASALYREALGSPEHCSPHHTALRQAILCWGELM-TLAT
JQ707338_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707337_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707334_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707333_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707332_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707331_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707330_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707327_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707326_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707325_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707324_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707323_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707322_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707321_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707320_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707319_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707318_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707317_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707316_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707314_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707313_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707311_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707310_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707309_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707308_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707307_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707306_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707305_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707304_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707303_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707302_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707301_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ707299_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JQ687529_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JN182333_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JN182331_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JN182330_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JN182328_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JN182325_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILRWGELM-TLAT
JN182324_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JN182321_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP718092_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELM-TLAT
EU185787_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB697487_HBe_P-A      DFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-XLAT
AB697498_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-XLAT
KP718090_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JN182319_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JN182327_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
JN182334_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGEPM-TLAT
AB116092_HBe_P-A      DFFPSVRDLLDTVAALFRDALESPEHCSAHHTALRQVILCWGELM-TLAT
AY161143_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCCGELM-TLAT
AY161144_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCCGELM-TLAT
AY161142_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCCGELM-TLAT
AJ627226_HBe_P-A      DFFPSARDLLDTASALFRDALESPEHCSAHHTALRQAILCWGELM-TLAT
AB116088_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSSHHTALRQAIVCWGELM-TLGT
AB116086_HBe_P-A      DFFPSVQDLLDTASALYREALESPVHCSPHHTALRQAILCWGELR-TLGT
KJ854701_HBe_P-A      DFFPTARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDIL-TLGT
EU304331_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELM-TLAT
EU366129_HBe_P-A      DFFPSVRDLLDTAAALFREALESPEHCSPHHTAIRQAILCWGELM-TLAT
FN545834_HBe_P-A      DFFPSARDLLETASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
AB453986_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELT-TLGT
MK512456_HBe_P-A      DFFPSARDLLETASALFREALESPEHCSPHHTALRQAILCWGELM-TLAT
GQ477476_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELS-TLAT
FJ692607_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB453989_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELM-TLAT
EU185776_HBe_P-A      DFFPSVRDLLXTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
EU185777_HBe_P-A      DFFPSXRDLLXTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB116076_HBe_P-A      DFFPSVRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ868002_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHGSPHHTALRQAILCWGELM-TLAT
FJ692558_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692596_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798266_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KX357649_HBe_P-A      DFYPSVRDLIDTASALFREALESPEHCSPHHTALRQAVLCWGELM-TLAX
KP857065_HBe_P-A      DFYPSVRDLLDTASALYREALESPEHCSAHHTAIRQAILCWGELM-TLAT
JQ023661_HBe_P-A      DFFPSVRDLLDTASALYREDLESPEHCSPHHTALRQAILCWGELM-TLAT
JQ023660_HBe_P-A      DFFPSVRDLLDTASALYREDLESPEHCSPHHTALRQAILCWGELM-TLAT
EF103278_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELM-TLAT
AB126580_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB116089_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQASLCWVELM-TLAT
AB014370_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
AB064314_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB076678_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB116077_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB116078_HBe_P-A      DFFPSVRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELM-TLAT
AB116079_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB116080_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB116081_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB205118_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
AB246337_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB246338_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB300366_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB300367_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB362931_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWVELM-TLAT
AB453979_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB453980_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB453981_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB453984_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB480036_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
AB480038_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB480039_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB480040_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
AB480041_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB549213_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FN545833_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB116082_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-TLAT
AB116085_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
AB116090_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB116091_HBe_P-A      DFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB116093_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB116094_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB241114_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB241115_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB246335_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB246336_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB453987_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
AB453988_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-TLAT
AB116084_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798267_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KR905426_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT366467_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692600_HBe_P-A      DYYPSVRDLLDTASALYRXALESPEHCSPHHTALRQAXLCWGELM-TLAT
FJ692603_HBe_P-A      DFYPSVRDLLDTATALYRXXLESPEHCSPHHTALRQAILCWGELM-TLAT
KP857062_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELM-TLAT
M57663_HBe_P-A        DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLM-TLAT
KP168428_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAVLCWGELM-TLAT
KF214660_HBe_P-A      DFFPSVRDLQDTASALYREALESPEHCSHHHTALRQAILCWGELM-TLAT
GQ477498_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAVLCWGELM-TLAT
GQ161813_HBe_P-A      DFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELM-TLAT
FN545839_HBe_P-A      DFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELM-TLAT
MF925372_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT366466_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELM-TLAT
KR905427_HBe_P-A      DFFPSVRDLLDTASALYREALEAPEHCSPHHTALRQAILCWVELM-TLAT
KR905425_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854690_HBe_P-A      DFFPSVRDLLDTSSALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798265_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELM-TLAT
GQ331046_HBe_P-A      DFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELM-TLAT
KX357644_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-TLAT
KT366471_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP168429_HBe_P-A      DFFPSVRDLLDTXSALYREALESPEHCSPHHTALRQAILWWXELM-TLAT
KJ854703_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798308_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MF925407_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MF925385_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MF925373_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
MF772351_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
M74501_HBe_P-A        DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
LK995385_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-TLAT
LC051141_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KX686607_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KX357647_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KX357645_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KX357643_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KX357642_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KU736919_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KU736918_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT366470_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT366469_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT366468_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT151618_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT151617_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-TLAT
KT151616_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT151615_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT151613_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KT151612_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-TLAT
KT151611_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KR905431_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KR905430_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KR905429_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELM-TLAT
KP718086_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP718085_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP168433_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP168432_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KP168430_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM606673_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM519452_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KM243029_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854707_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854706_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854705_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854704_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854702_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854700_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854699_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854697_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854696_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854694_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854692_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854691_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854689_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854688_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ854687_HBe_P-A      DFFPSVRDLLDTASALYREALESHEHCSPHHTALRQAILCWGELM-TLAT
KJ854686_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KJ843183_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF922428_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF922427_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF922426_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF922425_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF922424_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798314_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798311_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798310_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798309_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798302_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798292_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798291_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798290_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798289_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798286_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798285_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798279_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798278_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF798271_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELM-TLAT
KF214665_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF214663_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF214662_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF214661_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRRAVLCWGELM-TLAT
KF214659_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KF214657_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KC875260_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-TLAT
KC875258_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KC875255_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
KC836846_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FN545840_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWVELM-TLAT
FN545836_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692612_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FJ692605_HBe_P-A      DFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-TLAT
FN545832_HBe_P-A      DFFPSVRDLLDTASALFRXALESPEHCTPHHTALRQAILCWGEXM-TLAT
                      .::*   :   *        *         *.* *            :  

KU605535_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU605536_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
MF536836_HBe_P-A      WVGNNLQDPASRDLHVNYVNTNMGLKIRQLLWFHISCLTFGRLVVLEYLV
KP857091_HBe_P-A      WVGTNLDDPGSRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEFLV
KP857066_HBe_P-A      WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KP857072_HBe_P-A      WVGTNLDDPSSRDQVVHYVNTNMGLKIRQLLWFHISCLTFGRDIVLEYLV
KP857068_HBe_P-A      WVGSNLQDPASRDQVVNYVNTNMGLKIRQLLWFHTSCLTFGRDTVVEYLV
KP857067_HBe_P-A      WVGNNLDDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVVEYLI
GQ477462_HBe_P-A      WVGNNLDDQASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVIEYLV
AB937797_HBe_P-A      WVGNNLQDPASRDQVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB076679_HBe_P-A      WVGNNLEDHASRDLVVNYVNDNMGLKLRQLLWFHISCLTFGKQTVLEYLV
MF925362_HBe_P-A      WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEFLV
KX276769_HBe_P-A      WVGNNLQDPASRDQVVSYVNTNMGLKIRQLLWFHISCLTFGRDAVLEYLV
KP857073_HBe_P-A      WVGANLDDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRHTVLEYLV
KP857070_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLV
KP857071_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLV
GQ477500_HBe_P-A      WVGNNLEDPASKDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KM606696_HBe_P-A      WVGSNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLV
KF922414_HBe_P-A      WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLV
KF922415_HBe_P-A      WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLV
KF922416_HBe_P-A      WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLV
KF922420_HBe_P-A      WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLV
KF922418_HBe_P-A      WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCITFGRETVLEYLV
KF922419_HBe_P-A      WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCITFGRETVLEYLV
KF922421_HBe_P-A      WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCITFGRETVLEYLV
FJ692588_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ349296_HBe_P-A      WVGNNLENPASRDLVVNYVNTNMGLKIRQLWGFHISCLTFGRETVLEYLV
AY034878_HBe_P-A      WVGNNLDDPASKDLVVNYVNTKHGLKIRQLLWVHTSCLTFGRETVLEYLV
AF419536_HBe_P-A      WVGNNLQDPASRDLVVNYVNDNMGLMIRQLLWFHSSCITFGRETVLEYLV
FJ692593_HBe_P-A      WVGNNLDDPVSRDLVVNYVNTNMGLRIRQLLWFHISCLTFGRETVLEYLV
KP857069_HBe_P-A      WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLV
GU563547_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHLSCITFGRDTVLEYLV
GQ477504_HBe_P-A      WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGREVVHEYLV
GQ477497_HBe_P-A      WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ477488_HBe_P-A      WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEFLV
GQ477475_HBe_P-A      WVGNNLQDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLV
FJ692604_HBe_P-A      WVGNNLEDPASRDLVVNYVNTTTGLRIRQLLWFHISCLTFGRDTVLEYLV
FJ692602_HBe_P-A      WVGNNLADPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQIVLEYLV
FJ692597_HBe_P-A      WVGNNLQDPASRDQVVNYVNXNMGLKIRQLLWFHISCLTFGRDIVLEYLV
FJ692586_HBe_P-A      WVGNNLEDQASRALVVNYVDTNMGLKIRQLLWFHISCLTFGRETVLQYLV
AB246317_HBe_P-A      WVGNNLDDPASRDLVVNYVNTNMGLKVRQLLWFHISCITFGRQTVGEFLV
AB194952_HBe_P-A      WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLV
KP857092_HBe_P-A      WVGNNLEDPASRDQVVNYVNTNMGLKLRQLLWFHISCLTFGRETVIEYLV
AB194950_HBe_P-A      WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692564_HBe_P-A      WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCXTFGREVVLEYLV
FJ692565_HBe_P-A      WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLV
AB194951_HBe_P-A      WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692570_HBe_P-A      WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLV
KP995108_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KP857075_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVVEYLI
KP857074_HBe_P-A      WVGNNLEDQASRNLVVDYVNNNVGLRLRQLLWFHVSCLTFGRETVLEYLV
JQ707577_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLV
JQ707595_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLV
JQ707596_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLV
JQ707600_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLV
JQ707605_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLV
FN545828_HBe_P-A      WVGNNLQDPASRDQVVDYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLV
KP857078_HBe_P-A      WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KP857077_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVVEYLV
KP857059_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDLVLEYLV
GQ477501_HBe_P-A      WVGNNLNDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLV
GQ477487_HBe_P-A      WVGNNLQDSASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLV
GQ477472_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FN545838_HBe_P-A      WVGTNLEDPASREQVVSYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLV
FM199974_HBe_P-A      WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHTSCITFGRETVLEYLV
FJ904434_HBe_P-A      WVGTNLZDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLV
FJ692573_HBe_P-A      WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLV
MH464825_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KP857076_HBe_P-A      WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHTSCITFGRETVLEYLV
KP857064_HBe_P-A      WVGNNLEDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLV
KM606653_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ477502_HBe_P-A      WVGGNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLQYLV
GQ477473_HBe_P-A      WVGGNLDDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLDYLV
FN545826_HBe_P-A      WVGNNLEDPASRDLVVNYVNNTTGLKIRQLLWFHISCLTFGRDTVLEYLV
FJ692576_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEFLV
EU414050_HBe_P-A      WVGTNLNDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY233290_HBe_P-A      WVGNNLDDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLV
AJ627228_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLDYLV
AJ344115_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKDTVLEYLV
AB453982_HBe_P-A      WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB116083_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU414052_HBe_P-A      WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLV
EU414133_HBe_P-A      WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLV
KM606649_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRQTVLEYLV
GQ477484_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ477474_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLV
FJ692592_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692587_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEFLV
AB116087_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLV
MK512455_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRELLWFHISCLTFGRETVLEYLV
MF925368_HBe_P-A      WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLV
KX357640_HBe_P-A      WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KT749832_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KM606695_HBe_P-A      WAGNNLEDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLV
KM606647_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRDTVLQYLV
KJ854685_HBe_P-A      WVGNNLQDQASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLV
KF214658_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ477490_HBe_P-A      WVGSNLEDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ477478_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ477469_HBe_P-A      WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692567_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU414049_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKETVLEYLV
EU185786_HBe_P-A      WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY152726_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLV
KF214666_HBe_P-A      WVGHNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
MK512467_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
MK512460_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KT749833_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KP857060_HBe_P-A      WVGNNLQDTASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ843172_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ707602_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ707388_HBe_P-A      WVGNNLEDPASRDLLVNYVNGDMGLKIRQLGRFHISCLTFGRETVLEYLV
JQ707368_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ707346_HBe_P-A      WVGNNLQEPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ477491_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHSSCITFGRDTVLEYLV
GQ477463_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692561_HBe_P-A      WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692555_HBe_P-A      WVGNNLQDPASRDLVVNYVNTXMGLKIRQLLWFHISCLTFGRETVLEYLV
AF419535_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTXCITFGRETVLEYLV
AF350087_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AF350083_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AF350081_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU185765_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
MH464817_HBe_P-A      WVGNNLDDPASRDLVVNYVNTNVGLKIRQLLWFHISCLTFGRETVLEYLV
KM606650_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ586809_HBe_P-A      WVGNNLEDPASRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JX154579_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ707576_HBe_P-A      WVGNNLEDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ477493_HBe_P-A      WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGRDTVLEYLV
GQ477464_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLV
FN545830_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDIVLEYLV
FN545829_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLV
FM199977_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLV
FJ692611_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRPTVLEYLV
FJ692598_HBe_P-A      WVGNNLEDXASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRXTVLEYLV
FJ692595_HBe_P-A      WVGNNLEDPASRDLVVNYVNDNMGIKIRQLLWFHISCLTFGREIVLEYLV
EU414048_HBe_P-A      WVGNNLEDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AM180624_HBe_P-A      WVGXNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB222707_HBe_P-A      WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JN182323_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JF440016_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ867986_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ867960_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY903452_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
MK512472_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
MK512466_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKISQILWFHISCLTFGRETVLEYLV
MK512461_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
MK512457_HBe_P-A      WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
MF925400_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLV
MF772348_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRDTVLEYLV
MF772344_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KP857080_HBe_P-A      WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KM606658_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF922430_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
HM535200_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLRFHISCLTFGRETVLEYLV
GU827640_HBe_P-A      WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ477495_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ477486_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLV
GQ477482_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVLEYLV
GQ477480_HBe_P-A      WVGSNLQDPASRDLVVNYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLV
GQ477479_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ477468_HBe_P-A      WVGNNLEDLASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ477466_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHLSCLMFGRETVLEYLV
GQ331047_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FN545825_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692613_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692577_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGXXTVLEYLV
FJ692566_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU859952_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU859944_HBe_P-A      WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY738141_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLV
AY738140_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLV
AY603446_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY603438_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY603432_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY233287_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AJ309371_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AF536524_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AF419534_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHSSCLTFGRETVLEYLV
KJ854698_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ854693_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ868008_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ867995_HBe_P-A      WVGNNLEDPASRELVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ867994_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ867985_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ867961_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ867958_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ867949_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ867948_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ867947_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ867946_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU185775_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLV
MK512471_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
MK512463_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
MK512458_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
MF925361_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
MF772353_HBe_P-A      WXGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KX827296_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KX827295_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KX827294_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KX827293_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIGQLLWFHISCLTFGRETVLEYLV
KU736920_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KT749839_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KT749824_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLGFHISCLTFGRETVLEYLV
KP857061_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KP718101_HBe_P-A      WVGNNLEDPHPRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KP168427_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEYLV
KP168426_HBe_P-A      WVGNNLEDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLV
KP168425_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KM606742_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KM606688_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLV
KM606656_HBe_P-A      WVGNNLEDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF922409_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF922408_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCPTFGRETVLEYLV
KC875252_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JX154582_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JX154581_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JX154580_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JX096953_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ707582_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ707565_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ707555_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ707414_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ707387_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ707345_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ707336_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ707329_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ707315_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ707312_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFNISCLTFGRETVLEYLV
JQ707300_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ687533_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JN182332_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQRLWFHISCLTFGRETALEYLV
JN182318_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ477465_HBe_P-A      WVGNNLQDPASRDLVVDYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ222208_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FN545835_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FN545831_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FM199975_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692608_HBe_P-A      WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLV
FJ692606_HBe_P-A      WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLV
FJ692601_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692599_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLV
FJ692591_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692590_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692585_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692584_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692583_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692582_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692581_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692580_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692579_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692578_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692575_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLV
FJ692574_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692571_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692563_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692562_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRPTVLEYLV
FJ692559_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLV
FJ692557_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ692554_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU410082_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU054331_HBe_C-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
DQ788725_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
DQ315784_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
DQ020003_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY934774_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY934771_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY934770_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY934769_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY934768_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY934767_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY934765_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY934764_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY934763_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY373432_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY373429_HBe_P-A      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWSHISCLTFGRETALEYLV
AY373428_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY233286_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY233278_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY233276_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AM494718_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AM184126_HBe_P-A      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV