HBVdb

Dataset for protein MHBs of genotype A

[Download (right click)] [Edit] [Sequences] [Repertoires]

1463 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


AY161138_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB194951_MHBs_P-A      MQWNSTNFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISSRIG
FN545832_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSNSGTVNPVPNTASHISSISSRTG
AB194952_MHBs_P-A      MQWNSTKFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRIG
FN545825_MHBs_P-A      IQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVTPVPNIASHISSISSRTG
HM363613_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVTPVPNIASHISSISSRTG
FN545828_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSNSGTVNPVPNTASHISSISSRTG
FN545830_MHBs_P-A      XQWXSTTFHQALQDPRVRGLYLPAGGSNSGTVNPVPNTASHISSISSRTG
FN545829_MHBs_P-A      IQWNSTTFHQALQDPKVRGLYFPAGGSNSGTVNPVPNTASHISSISARTG
FN545833_MHBs_P-A      IQWNSTTFHQALQDPRVRGLYLPAGGSNSGTVNPVPNTASHISSISSRTG
MH580627_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSNSGTVNPVPTTASHISSISSRTG
MH580639_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSNSGTVNPVPTTASHISSISSRTG
MH580642_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSNSGTVNPVPTTASHISSISSRTG
MH580643_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSNSGTVNPVPTTASHISSISSRTG
FN545834_MHBs_P-A      IQWNSTTFHQALQDPRVRGLYLPAGGSNSGTVNPVPNTASHISSISSRTG
FN545835_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSNSGTVNPVPNTASHISSISSRTG
FJ692554_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
JF439732_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439733_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
FJ692613_MHBs_P-A      MQWNSTAFHQXLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
JF439751_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439722_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439731_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439734_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439739_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439742_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439744_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439720_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439743_MHBs_P-A      MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
FJ692606_MHBs_P-A      MQWNSPVFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
AY934764_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGIVNPVPNIASHISSISSRTG
AM180624_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVSPVPNIASHISSISSRTG
FJ349296_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVSPVPNIASHISSISSRTG
FN545838_MHBs_P-A      MQWNSTXFHQALXDPRVRGLYFPAGGSSSGTVSPVPNIASHISSISSRTG
JF439896_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439909_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439902_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439904_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439897_MHBs_P-A      VQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439907_MHBs_P-A      VQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439738_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439724_MHBs_P-A      MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439721_MHBs_P-A      MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439730_MHBs_P-A      MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439735_MHBs_P-A      MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439736_MHBs_P-A      MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439737_MHBs_P-A      MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439747_MHBs_P-A      MQWTSTAFHQTLQDPRVRGLYLPAGGSGSGTVNPVPNTASHISSISSTTG
JF439903_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439905_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439723_MHBs_P-A      MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
AB194950_MHBs_P-A      IKWNSPAFHQALQDPRVKGLYFPAGGSSSGTVSPVPNIASHISSISSRTG
FJ692609_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
FJ692610_MHBs_P-A      MQWNSTAFHQXLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
JF439906_MHBs_P-A      TQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
AM184125_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSRTVSPVQNIASHISSISSRTG
AM184126_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVSPVPNIASHISSISSRTG
EU054331_MHBs_C-A      MQWNSTAFHQALQDPRVRGLYFPAGCSSSGTVSPVPNIASHISSISSRTG
KM606737_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVSPVPNTASHISSISSRTG
JF439908_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439748_MHBs_P-A      MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
GQ161813_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSISSRTG
FN545831_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
FJ692599_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
JF439745_MHBs_P-A      MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439746_MHBs_P-A      MQWTSTAFHRTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439726_MHBs_P-A      MQWTSTAFHQTLQDPRVRGLYLPAGSSSSGTVNPVPNTASHISSISSTTG
JF439729_MHBs_P-A      MQWTSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439898_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439899_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439900_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439901_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
JF439910_MHBs_P-A      VQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTASHISSISSTTG
FN545836_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
FJ692598_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
JN604217_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
HM363612_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAQNIASHISSISSRTG
FJ692608_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHTSSISSRTG
FJ692603_MHBs_P-A      MQWNSTAFHQXLQDPRVRXLCLPAGGSSSGTVNPAPNIASHISSISSRTG
FJ692595_MHBs_P-A      XQWNSTAFHXALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
FJ692596_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
FJ692597_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
FJ692600_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
FJ692601_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
FJ692602_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
FJ692604_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
FJ692612_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
FJ692605_MHBs_P-A      MQWNSTAFHQXLQDPRVRGLYFPAGGSSSGTVNPAPNIASHILSISSRTG
FJ692611_MHBs_P-A      XQWNSTAFHQALQDPTVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
FJ692607_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRTG
KR905429_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
FJ692558_MHBs_P-A      LXWNSTALHXTQQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISARTG
KF922420_MHBs_P-A      IQWNSTACHQALKDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSTTG
KF922421_MHBs_P-A      IQWNSTACHQALKDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSTTG
KF922417_MHBs_P-A      IQWNSTACHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSTTG
KF922418_MHBs_P-A      IQWNSTACHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSTTG
KF922419_MHBs_P-A      IQWNSTACHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSTTG
KF922414_MHBs_P-A      IQWNSTACHQALKDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSTTG
KF922415_MHBs_P-A      IQWNSTACHQALKDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSTTG
KF922416_MHBs_P-A      IQWNSTACHQALKDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSTTG
KR905426_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
KT366467_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
KJ854689_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
JN604251_MHBs_P-A      MQWNSTAFHQALQDPRIRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB076687_MHBs_P-A      MQWNSTVFHQALQDPRVRGLYFPAGGSSSETLNPVPNIASHISSTSSRTG
AB076679_MHBs_P-A      VQWNFTAFQQALQDPRVRGIYLPAGGSSSGTLNPVPNIASHISSISSRTG
AY233287_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRIG
AB786661_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSRTG
AY233285_MHBs_P-A      MQWNPTAFHQALQDPRVRGLYFPAGGSSSGPLNPVPNTASHISSISSRTG
AB076682_MHBs_P-A      MQWNSTNLQQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSRTG
KF922433_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYRPAGGSSSGTHNPVPNIASHISSISSKTG
FN545826_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSISSRTG
GQ331046_MHBs_P-A      VQWESTTFHQALQDPRVRGLYFPAGGSSSGTVNPVQNIASHISSISSRTG
AB076681_MHBs_P-A      IQWNSTAFHQALQDPRVRDLCLPAGGSSSGTLNPVPNIASHISSISSRTG
KF476018_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTLNPAPNTASHISSISSKTG
KU605533_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSKTG
KU605534_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSKTG
KP168431_MHBs_P-A      MQWNSTAFHQALKDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
AB786663_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KF476020_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNTASHISSISSRTG
GU563547_MHBs_P-A      MQWNSTAFHQTLQDSRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692562_MHBs_P-A      IQWNSTAFHQALQDPRVRGLYFPAGGSSSKILNPVPNIASHISSISSRTG
EU366129_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AY934773_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AY934772_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
AY233288_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIAFHISSISSRIG
AB076685_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AM494718_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KT347092_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGILNPVPNTASHISSISSRTG
KF922434_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTHNPVPNIASHISSISSKTG
KF922407_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNTASHISSISSRTG
JN182334_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
JN182331_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
JN182330_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
JN182324_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
JN182320_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
FJ692592_MHBs_P-A      MQWNSTAFHQALQDPKVRALYFPAGGSSSGTLNPVPNIASHISSISSRTG
AY233283_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRIG
AY233281_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTHNPVPNIASHISPISSKTG
AB076680_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTVSHISSISSRTG
AB076678_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSRTG
AB076683_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTLNPVPNIASHISSTSSRTG
AB076686_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSRTG
AB076688_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSRTG
AB076689_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSTSSRTG
AB076690_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTLNPVPNIASHISSTSSRTG
KJ010776_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVQNIVSHISSISSRTG
KJ010777_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVQNIVSHISSISSRTG
KJ010778_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVQNIVSHISSISSRTG
JN182318_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
JN182319_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
JN182321_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
JN182322_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
JN182323_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
JN182325_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
JN182326_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
JN182327_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
JN182328_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
JN182329_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
JN182332_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
JN182333_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTFNPVPNIASHISSTSSRTG
FJ692559_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
KF922429_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVQNIASHISSISSRTG
KF922430_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVQNIASHISSISSRTG
AY233282_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNTASHISSISSRTG
AY233289_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNTASHISSISSRTG
KF922406_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNTASHISSISSRTG
KF922408_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNTASHISSISSRTG
KF922409_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNTASHISSISSRTG
KT347091_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGILNPVPNTASHISSISSRTG
MF979151_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
KX357643_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KP168424_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
JN604241_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSRTLNPVPNIASHISSISSRTG
HM535205_MHBs_P-A      MQWNSTAFHQALQDPRARGLYFPAGGSSSGTLNPVPNTASHISAISSRTG
AB937795_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISLKTG
AB786659_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KT347087_MHBs_P-A      MQLNSTAFHQALQDPRVRGLYFPAGASSSGTHNPVPNIASHISSISSKTG
AB116084_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYIPAGGSSSGTLNPVPNIASHISSISSRTG
AF297625_MHBs_P-A      MQWNSTALHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
AY233274_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISPISSRTG
AY233275_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTHNPVPNIASHISSISSKTG
AY233284_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTHNPVPNIASHISSISSKTG
FJ692557_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854691_MHBs_P-A      IQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692577_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692572_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
MK512455_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYSPAGGSSSGTLNPVPNIASHISSISSRTG
MF979146_MHBs_P-A      XQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
MF979144_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
KX648548_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
KX357642_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPVGGSSSGTLNPVQNIASHISSISSRTG
KU605535_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
KT347088_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
KP168425_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KP168423_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KP168422_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854688_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KF476021_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
KF476017_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
HM535200_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FM199977_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692585_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692584_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692583_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692582_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692581_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692580_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692579_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692578_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692574_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692563_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692571_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
KF779384_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISWRTG
JX154580_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
JX154581_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
JX154582_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
JX154579_MHBs_P-A      MQWNSTTFHQALQDPRVRGLNFPAGGSSSGTLNPVPNIASHISSISSRTG
MH464825_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
MH464817_MHBs_P-A      MQWNSTAFHQALQDPRVRGLSTAAGGSSSGTLNPVPNIASHISSISSTTG
EU859952_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVQNIASHISSISSRTG
GQ331047_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVQNIASHISSISSRTG
MK512462_MHBs_P-A      AQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLPPVPNIASHISSTSSRTG
MH464823_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYXPAGGSSSGTLNPVPNIASHISSISSRTG
JN604128_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
U87727_MHBs_P-A        MHWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSTTG
MK512475_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTLNPVLNIASHISSISSRTG
KP168435_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTXNPVQNIASHISSTSSRTG
KJ854699_MHBs_P-A      MQWNSTAFHQAXKDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692576_MHBs_P-A      MQWNSTAFHQXLQDPRXRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB116093_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
U87733_MHBs_P-A        MQWNSTAFHKALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSTTG
MK512467_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
MK512466_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
MK512457_MHBs_P-A      MHWNSTPFHPALQDPRVRGLYCPAGGSSSGTLNPVPNIASHILSISSRTG
MK512468_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KP168427_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
U87728_MHBs_P-A        MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSTTG
MK512471_MHBs_P-A      VQWNSTAFHQTLQDPKVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
MH464810_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
U87734_MHBs_P-A        MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
MH464830_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
MH464829_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
MH464828_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
MH464827_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
MH464826_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
MH464824_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
MH464822_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
MH464821_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
MH464820_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
MH464819_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
MH464818_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
MH464816_MHBs_P-A      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGILNPVPNIASHISSISSRTG
MH464815_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
MH464814_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
MH464813_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
MH464809_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYXPAGGSSSGTLNPVPNIASHISSISSRTG
U87731_MHBs_P-A        MQWNSTTFHQALQDPRVRGLYFPRGGSSSGTLNPVPNIASHISSISSRTG
MK512456_MHBs_P-A      RQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
MH464811_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHXSSXSSRTG
MK512473_MHBs_P-A      MQWNSTAFQQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
MK512472_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
MK512470_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
MK512465_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
MK512464_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
MK512460_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
MH464808_MHBs_P-A      MQWNSTAFXQXXQDXRXRGLYFPAGGSSSGTLNPVPNIASHXSSISSRTG
MH464812_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
JQ023662_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASLISSISSRTG
FJ692561_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AY373429_MHBs_P-A      IQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTTASHISSISSRIG
AB453989_MHBs_P-A      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB246336_MHBs_P-A      VRWNSTTFHQTLQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
JX125364_MHBs_P-A      MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPAPTTVSHISSIFSRIG
JQ023660_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
JN604163_MHBs_P-A      VQWNSTAFHQTLQDPRARGLCPPAGGSSSGTLNPVPNIASHISSISSRTG
AB116094_MHBs_P-A      MQWNSTAFRQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
AB116086_MHBs_P-A      VKWNSTTFHQALQDPRVRSLYLPAGGSSSGTLNPVPNIASHISSISSRTG
HM011485_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISSRTG
EF103278_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYSPAGGSSSGTLNPVPNIASHISSISSRTG
AY934770_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPSIASHISSISSRTG
AB116091_MHBs_P-A      IQWNSTAFRQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
AB786651_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
JQ023661_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIVSHISSISSRTG
FJ692566_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPHIASHISSISSRTG
AY934768_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNIASHISSISSRTG
AY934766_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AY934765_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNIASHISSISSRTG
AY903452_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AY373428_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AY233279_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AY161139_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB453988_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB241115_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB116083_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYIPAGGSSSGTLNPVPNIASHISSISSRTG
MF925385_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPHIASHISSISSRTG
MF925407_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPHIASHISSISSRTG
KJ854706_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
LC051141_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AY934767_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNIASHISSISSRTG
AY934769_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNIASHISSISSRTG
AB786662_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB786656_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB786655_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FM199981_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854693_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FM199974_MHBs_P-A      MQWNSXAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854685_MHBs_P-A      XQWNSTAFHQALQDPRVRGLYSPAGGSSSGTLNPVPNIASHISSISSRTG
KR139744_MHBs_P-A      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KX357647_MHBs_P-A      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTLNPVPNTASHISSISSRTG
AB786643_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB786645_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB786646_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB786647_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB786648_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB786649_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB786652_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB786654_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB786657_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB786658_MHBs_P-A      --WNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB786660_MHBs_P-A      --WNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
KR139742_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
KM606748_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRIG
KJ854703_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
JN604186_MHBs_P-A      MLWNSTAFHQALQDPXVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692588_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHNSSISSRIG
AB937791_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB937796_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692564_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692565_MHBs_P-A      XQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KJ194506_MHBs_P-A      IQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
JN604155_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KF922426_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KM519453_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KM519452_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KF922428_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KF922427_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692567_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692590_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
MF925368_MHBs_P-A      MQWNSTAFHQALQDPRVRGLCLPAGGSSSGTLNPVPNIASHISSISSRTG
MF772353_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KX357650_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KP168434_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KP168429_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854700_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSRTG
JN604260_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
JN604150_MHBs_P-A      MQWNSTAFHQALXDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
JN604145_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
GU563545_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FM199976_MHBs_P-A      XQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
AB116090_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AF043560_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AY233276_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AY233278_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVQNIASHISSISSRTG
KX357649_MHBs_P-A      VQWNSIAFHQTLQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KP168428_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KF170754_MHBs_P-A      TQWNSTDFHQALQDPRVRGLYFPVGGSSSGTLNPVPNIASHISSISSRTG
JN604136_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
FM199980_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FM199979_MHBs_P-A      MQWNSTAFQQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB453987_MHBs_P-A      IQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
MF925373_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KP168426_MHBs_P-A      MQWNSTAFYQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854696_MHBs_P-A      MQWNSTASHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854695_MHBs_P-A      IQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854692_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KF779332_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSISSRTG
EU410082_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
DQ020003_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
DQ020002_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AY934774_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854698_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KU736919_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AY934771_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692575_MHBs_P-A      XQWNSTAFHQALQDPKVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
JN604230_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
JN604237_MHBs_P-A      MQWNSTAFHQXLQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
JQ023663_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
MF925400_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
MF772351_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KX357646_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KX357645_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KU736920_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPVGGSSSGTLNPVPNIASHISSISSRTG
KU736918_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KR139743_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPNIASHISSISSRTG
KP718085_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KP168433_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KP168432_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KP168430_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854707_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854705_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854704_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854702_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854697_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854694_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854690_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYSPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854687_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KJ854686_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KJ843183_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
JN604169_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
GU563548_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ692591_MHBs_P-A      MQWNSTXFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FM199978_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AB453986_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSTSSRIG
AB116089_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
KR905427_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPTIASHISSISSRIG
AB116088_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
MF925372_MHBs_P-A      TQWKATAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSTSSRIG
AB116082_MHBs_P-A      MQWNSTAFHQTLQDTRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
KF214662_MHBs_P-A      AQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTLNPVPTIASHISSISSKIG
AF090842_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
KF214661_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
KF214666_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYSPAGGSSSGTLNPVPTIASHISSISSRIG
AY373432_MHBs_P-A      MQWNSTAFHQALQNPKDRGLYLPAGGSSSGTLNPVPTIASHISSISSRIG
AB116092_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
AB116087_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRTG
KR905425_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
KT366466_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
KF214657_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTLNPVPTIASHISSISSRIG
KF214659_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSIFSRIG
MF925361_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
AB116085_MHBs_P-A      MQWNSTAVHQALQDPRVRGLYIPAGGSSSGTLNPVPTIASHISSISSRIG
KF214660_MHBs_P-A      IQWNSTAFHQALQDPRVRGLYLPAGGSSSGTHNPVPTIASHISSISSRIG
JN604156_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTLNPVPTIASHISSISSRIG
JN604171_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
JN604252_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
JN604261_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
KF214663_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPTIASHISSISSRIG
KF214665_MHBs_P-A      MQWNSPAFHQALQDPRVRGLYVPAGGSSSKTLNPVPTIASHISSISSRIG
KR905430_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
KR905431_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
KT366468_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
KT366469_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
KT366470_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
KT366471_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
M57663_MHBs_P-A        MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
AB241114_MHBs_P-A      MQWNSTAFHQALQDPRIRGLYFPAGGSTSGTVNPVPTIASHISSISSRIG
AB246335_MHBs_P-A      MQWNSTAFHQALQDPRIRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
AJ344115_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
AY233290_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNIASHISSISSTTG
LT992448_MHBs_P-A      MQWNSTTFHQTLQDPRVRSLYFPAGGSSSGTVNPVPNIASHISSIFSRTG
JN604193_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
JN604220_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ184324_MHBs_P-A      TQWNYTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439821_MHBs_P-A      IQWNYTTFRQAMQDPRVRGMYLPAGGSSSGTVNPAPNIASHISSISARTG
JF439868_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPALNIASHISSISARTG
AY738139_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY738143_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477495_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AF143298_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPTIASHISSISARTG
AB116076_MHBs_P-A      VQWNSTAFHQALQDPKVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JF439852_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTG
JF439867_MHBs_P-A      MQWNSTAVHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439855_MHBs_P-A      MQWNSTAFHQALQDPRVGGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439850_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPALNIASHISSISARTG
JF439846_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439841_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSISARTG
JF439834_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439836_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439840_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439833_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439835_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439837_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439838_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439839_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSRTVNPAPNIASHISSISARTG
JF439843_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439844_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439845_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439848_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439851_MHBs_P-A      MQWNSTAFHQALQDPRVGGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439853_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439854_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439856_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439857_MHBs_P-A      MQWNSTAFHQALQDPRVGGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439858_MHBs_P-A      MQWNSTAFHQALQDPRVGGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439859_MHBs_P-A      MQWNSTAFHQALQDPRVGGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439860_MHBs_P-A      MQWNSTAFHQALQDPRVGGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439865_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439847_MHBs_P-A      MQWNSTAFHQALQDPRVGGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439842_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPALNIASHISSISARTG
JF439828_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JF439820_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JF439822_MHBs_P-A      MQWNSTALHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JF439825_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JF439829_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JF439831_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JF439832_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JF439824_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439862_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPALNIASHISSISARTG
JF439849_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPALNIASHISSISARTG
JF439864_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPALNIASHISSISARTG
JF439866_MHBs_P-A      MQWNSTAFHQALQGPRVRGLYLPAGGSSSGTVNPALNIASHISSISARTG
JF439861_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPALNIASHISSISARTG
JF439952_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477500_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477478_MHBs_P-A      MQWNSTAFHQALKDTRVRGLYSPAGGSSSGTVNPAPNIASHISSISARTG
GQ477462_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ184323_MHBs_P-A      MQWNYTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY934763_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
JF439949_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477502_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477490_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477477_MHBs_P-A      TQWNSTAVHQDPQDPKVRGLCFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477463_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY233286_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439992_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439984_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439982_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSPGTVNPAPNIASHISSISARTG
GU563551_MHBs_P-A      VQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477493_MHBs_P-A      MQWSSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AF537371_MHBs_P-A      IQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
AB697511_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGIVNPAPNIASHISSISARTG
AJ309369_MHBs_P-A      TQWNSTAFHQALQDPRVRGPYFPAGGSSSGTVNPAPNIASHISSISARTG
AJ309371_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859938_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JF439983_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVDPAPNIASHISSISARTG
JF439981_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439979_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439976_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439972_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439970_MHBs_P-A      MQWNSTAFHRALQDPRVWGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439963_MHBs_P-A      MQGNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439960_MHBs_P-A      MQWNSTAFHQALQGPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439959_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439958_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439956_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439951_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439947_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477504_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477498_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477491_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859955_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSSSARTG
EU859947_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859939_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EF208113_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB126580_MHBs_P-A      KQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439973_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPAPNIASHISSISARTG
AB480041_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB116077_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB205118_MHBs_P-A      MQWNSTALHQALQEPRVRGPYLPAGGSSSGTVNPAPNIASHVSSISARTG
AJ309370_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439985_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439988_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439768_MHBs_P-A      MQWNSTAFPQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439769_MHBs_P-A      MQWNSTAFPQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477503_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
GU563553_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
JN604164_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
JN604200_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
AB697493_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439767_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439774_MHBs_P-A      MQWNSTALHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439777_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF440020_MHBs_P-A      MQWNSTAFHQALQNPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTG
JF439971_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439968_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439966_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439957_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTG
GQ477487_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477479_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
GQ477472_MHBs_P-A      MQWNSTAFHQDLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859934_MHBs_P-A      IQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
EU594387_MHBs_P-A      IQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
DQ788725_MHBs_P-A      TQWNSTAVHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AF090841_MHBs_P-A      MQWNSTAFHQVLQDPRVRGLYFPAGGFSSGTVNPAPNIASHISSISARTG
AB549213_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB480036_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JN604270_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604167_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439991_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439989_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439987_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439986_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439980_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439978_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439977_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439974_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439969_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439967_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439965_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439964_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439962_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439955_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439954_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439953_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439950_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439948_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439946_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439945_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439944_MHBs_P-A      MQWNSTAFHQALQDPRVGGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439943_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GU563550_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477488_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
GQ477484_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477482_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477466_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477464_MHBs_P-A      MQWNSTAFHQALQNPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859956_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSSSARTG
EU859953_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859944_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
EU859921_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859907_MHBs_P-A      MQWNSTAFHQALQDPRVRDLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU747320_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
EU414133_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
DQ131121_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY233280_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AF297622_MHBs_P-A      MQWNSTALHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB697492_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB064314_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
AB116078_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
AB116079_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB116080_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB116081_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB246337_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB246338_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB263406_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB300366_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB300367_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB453979_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB453980_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB453981_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB453982_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB453983_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
AB480038_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB480039_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB480040_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYXPAGGSSSGTVNPAPNIASHISSISARTG
AB697487_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604288_MHBs_P-A      MQWNSTVFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHXSSISARTG
JN604162_MHBs_P-A      MQWNSTAFHQALRDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604300_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPTIASHISSISARTG
JN604216_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTG
AB697512_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTG
JN604173_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604160_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604159_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604158_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439766_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439765_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439764_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439763_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439762_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439761_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439760_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439759_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439758_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439757_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439756_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439755_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439754_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439753_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439752_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GU563562_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GU563558_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GU563557_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GU563555_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GU563554_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GU563546_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477496_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
GQ477486_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477467_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
GQ477461_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ414522_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
FJ349224_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859954_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859951_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859949_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859948_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859946_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859945_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859943_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859942_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859941_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859940_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859937_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859936_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859935_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859933_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859932_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859931_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859930_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859929_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859928_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859927_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859926_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859925_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859924_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859923_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859922_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859920_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859919_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859918_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859917_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859916_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859915_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859914_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859913_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859912_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859911_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859910_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859909_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859908_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859906_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859905_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859904_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859903_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859902_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859901_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859900_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859899_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU859898_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU594395_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU594394_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU594393_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU594392_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU594391_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU594390_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU594389_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU594388_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU594386_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU594384_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU594383_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU414132_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU159676_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU086721_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY902775_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY862868_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY862867_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY707087_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY128092_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
AM410963_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AM295799_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AM295798_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AM295797_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AM295795_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AM282986_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AJ012207_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AF297624_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AF090840_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AF090839_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AF043580_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB937798_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB937794_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB937793_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB937792_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB775201_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB775200_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB775199_MHBs_P-A      MQWNSTAFHQXLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB775198_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB697509_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB697508_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB697507_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB697505_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB697504_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB697503_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB697501_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB697499_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB697498_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB697497_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB697496_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB697495_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB697491_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB697488_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIXSHISSISARTG
AB697489_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY738142_MHBs_P-A      MQWNSTAFHQALQDPRVRGLSFPAGGSSSGTVNPAPNIASHISSISARTG
AY738140_MHBs_P-A      MQWNSTAFHQALQDPRVRGLSFPAGGSSSGTVNPAPNIASHISSISARTG
AY738141_MHBs_P-A      MQWNSTAFHQALQDPRVRGLSFPAGGSSSGTVNPAPNIASHISSISARTG
DQ298161_MHBs_P-A      MQWNSIAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
DQ298162_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
DQ298163_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
DQ298165_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY230117_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY230118_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY232839_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY232836_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISAWTG
AY232838_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISAWTG
AY232840_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
DQ298164_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604308_MHBs_P-A      MQWNSTAFHQALKNPKVRGLYFPAGGSSSGTGNPAPNIASHISSISGRTG
JF439990_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB937797_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYLPAGGSSSXTVNPAPNIASHISSXSARTG
JF439931_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439935_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB222707_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439870_MHBs_P-A      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439877_MHBs_P-A      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439878_MHBs_P-A      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439873_MHBs_P-A      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439875_MHBs_P-A      MQWNSTAFHQALLDPRVTGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439869_MHBs_P-A      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439871_MHBs_P-A      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439874_MHBs_P-A      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439876_MHBs_P-A      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439879_MHBs_P-A      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439880_MHBs_P-A      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439881_MHBs_P-A      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439882_MHBs_P-A      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439883_MHBs_P-A      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439872_MHBs_P-A      MQWNSTAFHQALLNPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY232837_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY152726_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAQNIASHISSISARTG
LT992441_MHBs_P-A      MQWNSTTFQQALQDPRVRGLYFPAGGSSSGTVSPVPNIASHISSISSRTG
JF439930_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AF537372_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707368_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707345_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARIG
JQ707350_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707352_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707353_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707359_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707360_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707366_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707369_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707370_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707358_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707346_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707349_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707355_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707356_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707363_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707365_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JF439933_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477501_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439912_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439914_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439915_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHLSSISARTG
JF439927_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439937_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIAPHISSISARTG
JF439938_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439939_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439941_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIAPHISSISARTG
JF439942_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439916_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439928_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439929_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439932_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439934_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439936_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439940_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439925_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439917_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439921_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439923_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439911_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439913_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439918_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISPISARTG
JF439919_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439920_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439922_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439924_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
MF979149_MHBs_P-A      MQWNSTAFHQALQDPKIRXLNLPAGGSSLGTRNPVPTIASHISSISSTTG
KF476023_MHBs_P-A      MQWNSTAFRRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTG
JN604290_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JN604266_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
GQ477475_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477465_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF476002_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGPVNPAPNIASHISSISARTG
HE576989_MHBs_P-A      MQWNPTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477473_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477468_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AF090838_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSETVNPAPNIASHISSISARTG
JQ707318_MHBs_P-A      VQWNSAVFHQALQDPRVRGLYFPGGGSSSGTVNRAPNIASHISSISPRTG
JN604309_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439961_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477480_MHBs_P-A      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB362931_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
MF772348_MHBs_P-A      LRRTSTXXXXXHLQWRVRDLCLPAGGSSSGTVNPAPNIASHISSISARTG
KT151615_MHBs_P-A      MQWNSTAFRQALQDPRVRGLYFPAGGSSSGTLNPAPTIASHISSISXRIG
KF476016_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNTASHISSISARTG
JN604305_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISLISARTG
JN604183_MHBs_P-A      TQWXXNAFXQDLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AF536524_MHBs_P-A      MQWNSTALHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB453984_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB014370_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
U87736_MHBs_P-A        MQWNSTAFHKALQYPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KX827298_MHBs_P-A      MQWNSTVFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KJ854701_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KF476012_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF475984_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604307_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604302_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604181_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF439975_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
HE576988_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477497_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU594385_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AY034878_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
AF297621_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASLISSISSTTG
AB697506_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF476026_MHBs_P-A      MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTG
KF476027_MHBs_P-A      MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTG
KU605536_MHBs_P-A      MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTG
KU605537_MHBs_P-A      MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTG
KU605538_MHBs_P-A      MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTG
KU605539_MHBs_P-A      MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTG
EU185789_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTX
EU185787_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
EU185788_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AJ627227_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477469_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KX827293_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF476008_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPSIASHISSISARTG
KF475994_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707576_MHBs_P-A      MQWNSTAFHQALQDPRVKGLNFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707367_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707351_MHBs_P-A      TQWNSTAFHQALKDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JN604298_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JN604293_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
JF439993_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
U87726_MHBs_P-A        MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHMCPISARTG
LT992440_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISSRIG
KJ843172_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779381_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSTSARTG
JX125367_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSVTTG
JQ707595_MHBs_P-A      MQWNSTAFHQALQDPRVKGLNFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707339_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707319_MHBs_P-A      MQWNSTAFHQALQDLRVRGLYFPAGGSSSGTVNPATNIASHISSISARTG
JN604268_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
JN604249_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604190_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604179_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
MF979153_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSTTG
MF979143_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSTTG
KT749822_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718086_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
KF922437_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSTTG
KF922436_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSTTG
KF922435_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSTTG
KF779370_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779356_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTG
KF779349_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTG
KF779295_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779291_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779270_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
KF779231_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF476013_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISPISARTG
KF476006_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF475996_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF475992_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF475985_MHBs_P-A      MQWNSTAFHQALRDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707605_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARSG
JQ707554_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTG
JQ707550_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707537_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707344_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707337_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604285_MHBs_P-A      MQWNSTAFHQALQDPXVXGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604282_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604197_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
GQ477494_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
Z72478_MHBs_P-A        MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779320_MHBs_P-A      MQWNSTAFLQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779260_MHBs_P-A      MQWNSTAFHQALQDPRVRGLNFPAGGSSSGTVNPAPNIASHISSISARTG
KF476025_MHBs_P-A      MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTG
KF476024_MHBs_P-A      MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTG
KF476022_MHBs_P-A      MQWNSTAFHRALQDPRVRGLYFPAGGSSSGTLNPVPNIVSHISSISSTTG
KF476005_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF475997_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF475995_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JX310730_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
JQ707608_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707599_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707592_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707590_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707589_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707586_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707585_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707364_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707362_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707361_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707357_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707354_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707348_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707347_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707342_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707341_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707333_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707320_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707317_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707311_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707308_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707302_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707299_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604297_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
JN604247_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
JN604240_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604214_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
JN604194_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604172_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
MF772347_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
MF772344_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KT749849_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KT749847_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KT749846_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KT749839_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KT749834_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KJ843184_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779322_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
KF779313_MHBs_P-A      VQWNSTVFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KF476014_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNNASHISSISARTG
JX125368_MHBs_P-A      MQWNSTAFHQALHDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707607_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707536_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707326_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707316_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604274_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JN604242_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604227_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JN604188_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
X51970_MHBs_P-A        MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
X02763_MHBs_C-A        MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
V00866_MHBs_P-A        MQWNSTALHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
U87732_MHBs_P-A        MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
MF772346_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
MF772345_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KY382410_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KU605532_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTG
KT749825_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KT151617_MHBs_P-A      VKWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718093_MHBs_P-A      MQWNSTAFHQALKDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718089_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KM519454_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYSPAGGSSSGTVNPAPNIPSHISSISARTG
KF779386_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
KF779383_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSIYARTG
KF779374_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779373_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
KF779372_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779371_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779367_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
KF779352_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
KF779348_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779347_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
KF779346_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
KF779345_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779344_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779335_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSLGTVNPAPNIASHISSISARTG
KF779334_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
KF779326_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
KF779309_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779308_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779307_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779306_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779305_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779298_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779294_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779293_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNLAPNIASHISSISARTG
KF779290_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779287_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KF779286_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KF779283_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSRTVNPAPNIASHISSISARTG
KF779282_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779281_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779280_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779276_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779275_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779274_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779273_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779272_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KF779271_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779269_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779265_MHBs_P-A      MQWNSTAFHQALRDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779264_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779255_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISTRTG
KF779249_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779248_MHBs_P-A      MQWNSTAFHQALKDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779247_MHBs_P-A      MQWNSTAFHQALKDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779246_MHBs_P-A      MQWNSTAFHQALKDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779239_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779238_MHBs_P-A      MQWNSTAFHQALKDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779234_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779215_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779213_MHBs_P-A      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF476015_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTG
KF476011_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF476010_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF476009_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF476007_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF476004_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF476003_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF476001_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF476000_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISAGTG
KF475999_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF475998_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF475993_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF475991_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF475990_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF475989_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF475988_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF475987_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF475986_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF475983_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF475982_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JX310723_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JX310722_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JX096953_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
JX096952_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
JQ707596_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707571_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707569_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707561_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707553_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIVSHISSISARTG
JQ707543_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707542_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707540_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707539_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707538_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707535_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707533_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707532_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707398_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNTASHISSISARTG
JQ707397_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707391_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707388_MHBs_P-A      MQWNATAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707372_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707324_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707315_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707301_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ687533_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604315_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSTSARTG
JN604306_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604304_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604303_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604299_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604294_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JN604292_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604291_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604283_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604279_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604277_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604276_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604273_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JN604269_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JN604262_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604257_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604228_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604204_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604191_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604185_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604184_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604180_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604178_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
U87735_MHBs_P-A        MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KT749832_MHBs_P-A      VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779321_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779319_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779311_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779254_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779211_MHBs_P-A      MQWNSTAFHQPLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779210_MHBs_P-A      MQWNSTAFHQPLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707604_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707577_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707331_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707330_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707328_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707322_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707314_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISLISARTG
JQ707313_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707305_MHBs_P-A      MKWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707300_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISLISARTG
JN604176_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604236_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KY886219_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KX827297_MHBs_P-A      MQWNSTALHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KT151612_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718102_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KJ843188_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779324_MHBs_P-A      MQWNSTAFHKALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779316_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779221_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707656_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707655_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707654_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707653_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707652_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707651_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707650_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707649_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707648_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707647_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707646_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707645_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707643_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707642_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707641_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707640_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHTSSISARTG
JQ707639_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707638_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707636_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707633_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707627_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707615_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707601_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707579_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707564_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707380_MHBs_P-A      TQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707338_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707323_MHBs_P-A      IQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
Z35717_MHBs_P-A        MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
X70185_MHBs_P-A        MQWNSTAFHQALQDPKVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
U87730_MHBs_P-A        MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
U87729_MHBs_P-A        MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
U87725_MHBs_P-A        MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
MH932713_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
MF772350_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
MF772349_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
LC458431_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
LC458430_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
LC311243_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
LC311242_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
LC311241_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
LC074724_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
L13994_MHBs_P-A        MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KY003230_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KX827296_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KX827295_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KX827294_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KT749850_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KT749844_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KT749843_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KT749842_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KT749840_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KT749838_MHBs_P-A      MQWTSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KT749837_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KT749836_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KT749835_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KT749831_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KT749830_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KT749829_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KT749826_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KT749824_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KT151614_MHBs_P-A      MQWXSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP995108_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718101_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718099_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718098_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718097_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718096_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718095_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718094_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718092_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718091_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718090_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718088_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718087_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP274928_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP274927_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KP274925_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KM606749_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KM606746_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSICARTG
KM606742_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KJ854710_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KJ854709_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KJ854708_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KJ843218_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KJ843217_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KJ843216_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KJ843215_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KJ843214_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KJ843192_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KJ843186_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KJ843182_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KJ843173_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KJ843166_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KJ586809_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSRSGTVNPAPNIASHISSISARTG
KF779385_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779379_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779378_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779375_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779369_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779368_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779366_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
KF779365_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779364_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779363_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779362_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779361_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779360_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779359_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779358_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779355_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779354_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779351_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779350_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779342_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779339_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779338_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779337_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779336_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779333_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779331_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779330_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779329_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779328_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779325_MHBs_P-A      MQWNSTAFHKALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779323_MHBs_P-A      MQWNSTAFHQAPQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779317_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779315_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779314_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779312_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779310_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779304_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779299_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779297_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779279_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779277_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779268_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779266_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779263_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779262_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779261_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779259_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779258_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779257_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779256_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779253_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779252_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779251_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779245_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779244_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779243_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779240_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KF779227_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KC875260_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JX310732_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JX310731_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JX310725_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JX310724_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JX310721_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707681_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707676_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIAFHISSISARTG
JQ707675_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707674_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707672_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707670_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707669_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707667_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707665_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707664_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707663_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707662_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707661_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707659_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707658_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707637_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707635_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707634_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707632_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707631_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707630_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707629_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707626_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707625_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707624_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707623_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707622_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707621_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707620_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707619_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707618_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707617_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707616_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707614_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707613_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707612_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707611_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707610_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707609_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707606_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707603_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707594_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707587_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707583_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707581_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707580_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707578_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707575_MHBs_P-A      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707573_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707572_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707570_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707568_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707567_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707566_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707565_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707563_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707562_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707560_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707559_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707558_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707557_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707556_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707555_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707552_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707551_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707549_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707548_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707547_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707546_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707545_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707544_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707541_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707534_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707531_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707420_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707419_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707418_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707417_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707416_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707415_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707414_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707413_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707412_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707411_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707410_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707409_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707408_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707407_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707406_MHBs_P-A      MQWNSTAFHLALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707405_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707404_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707403_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707402_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707400_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707399_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707396_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707395_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707394_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707393_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707392_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707390_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707389_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707387_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707386_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707385_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707383_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707382_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707381_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707379_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707378_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707377_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707376_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707375_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707374_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707373_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707371_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707343_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707336_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707332_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707325_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707321_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707312_MHBs_P-A      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707310_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707309_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JQ707307_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707304_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707303_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ687529_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604319_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KP718100_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JQ707644_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604317_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
KX276769_MHBs_P-A      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISARTG
KF779232_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
JN604165_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JN604314_MHBs_P-A      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
                                             . *         .               

AY161138_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
AB194951_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGA
FN545832_MHBs_P-A      DPAPTMENITSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGX
AB194952_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
FN545825_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGA
HM363613_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FN545828_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FN545830_MHBs_P-A      DPAPTMENITSGXLGXLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FN545829_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FN545833_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH580627_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH580639_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH580642_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH580643_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FN545834_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FN545835_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692554_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439732_MHBs_P-A      DPAPTTENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439733_MHBs_P-A      DPAPTTENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
FJ692613_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439751_MHBs_P-A      DPAPTMENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGP
JF439722_MHBs_P-A      DPAPTMENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGP
JF439731_MHBs_P-A      DPAPTMENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGP
JF439734_MHBs_P-A      DPAPTMENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGP
JF439739_MHBs_P-A      DPAPTMENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGP
JF439742_MHBs_P-A      DPAPTMENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGP
JF439744_MHBs_P-A      DPAPTMENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGP
JF439720_MHBs_P-A      DPAPTMENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGP
JF439743_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
FJ692606_MHBs_P-A      DPAPTMENITSGFXXPPLVLQAGSFLLTRILTIPQSLDSWWTSLNFLGGS
AY934764_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
AM180624_MHBs_P-A      DPAPTMENITSGFLKPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ349296_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FN545838_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439896_MHBs_P-A      DPAPTMENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439909_MHBs_P-A      DPAPTMENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439902_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439904_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439897_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439907_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439738_MHBs_P-A      DPAPTMENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439724_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439721_MHBs_P-A      DPAPTMEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439730_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439735_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439736_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439737_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439747_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439903_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439905_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439723_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
AB194950_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692609_MHBs_P-A      DPAPTMENITSGSLGPLLVLQAGFFLWTRILTIPQSLDSWWTSLNFLGES
FJ692610_MHBs_P-A      DPAPTMENITSGSLGPLLVLQAGFFLWTRILTIPQSLDSWWTSLNFLGES
JF439906_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGP
AM184125_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AM184126_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU054331_MHBs_C-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KM606737_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439908_MHBs_P-A      DPAPTMENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439748_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
GQ161813_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FN545831_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692599_MHBs_P-A      DPAQTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439745_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439746_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439726_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439729_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439898_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439899_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439900_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439901_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439910_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
FN545836_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ692598_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGS
JN604217_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGS
HM363612_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692608_MHBs_P-A      DPVPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692603_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGS
FJ692595_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692596_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692597_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692600_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692601_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692602_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692604_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692612_MHBs_P-A      DPAQTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692605_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGXS
FJ692611_MHBs_P-A      DPAPTMENITSGFLGPLLVLQAGFFLLIRILTIPQSLDSWWTSLNFLGGS
FJ692607_MHBs_P-A      DPAQTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KR905429_MHBs_P-A      DPATNMENITSGFLGPLLALQAGFFLLTKILTIPQSLDLWWTSLNFLGGS
FJ692558_MHBs_P-A      DPALNMENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922420_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922421_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922417_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922418_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922419_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922414_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922415_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922416_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KR905426_MHBs_P-A      DPAPNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGES
KT366467_MHBs_P-A      DPAPNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGES
KJ854689_MHBs_P-A      DPATNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604251_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB076687_MHBs_P-A      DPALNMENITSGFLRPLLVLQAGFFLLTRILTIPQNLDLWWTSLNFLGGS
AB076679_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVP
AY233287_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB786661_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGP
AY233285_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB076682_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922433_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FN545826_MHBs_P-A      DPAPNMENITSGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ331046_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGP
AB076681_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476018_MHBs_P-A      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KU605533_MHBs_P-A      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KU605534_MHBs_P-A      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP168431_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB786663_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
KF476020_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
GU563547_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692562_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGX
EU366129_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY934773_MHBs_P-A      DPASNMDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY934772_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
AY233288_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB076685_MHBs_P-A      DPASNMENITSGFLGPXLVLQAGFFLLTRILTIPQSLDSWWTSLNFLEGS
AM494718_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT347092_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922434_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922407_MHBs_P-A      DPALNMENITSGFLGPLLVLRAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN182334_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGS
JN182331_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN182330_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN182324_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN182320_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692592_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY233283_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY233281_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB076680_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB076678_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB076683_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB076686_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB076688_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB076689_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
AB076690_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
KJ010776_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ010777_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ010778_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN182318_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN182319_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN182321_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN182322_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN182323_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN182325_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN182326_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN182327_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN182328_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN182329_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN182332_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN182333_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692559_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922429_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922430_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY233282_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY233289_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922406_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922408_MHBs_P-A      DPALNMENITSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922409_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLARILTIPQSLDSWWTSLNFLGGS
KT347091_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF979151_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KX357643_MHBs_P-A      DPAPNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP168424_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604241_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
HM535205_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB937795_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB786659_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT347087_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB116084_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AF297625_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY233274_MHBs_P-A      DPAWNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY233275_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY233284_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ692557_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854691_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
FJ692577_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692572_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGP
MK512455_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF979146_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF979144_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KX648548_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KX357642_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KU605535_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT347088_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP168425_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGX
KP168423_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP168422_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854688_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476021_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476017_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
HM535200_MHBs_P-A      DPALNMENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FM199977_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692585_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692584_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692583_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692582_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692581_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692580_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692579_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692578_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692574_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692563_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692571_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779384_MHBs_P-A      DPATNMENITSGFLGPLLVLQERFFLLTRILTIPQSLDSWWTSLNFLGGS
JX154580_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JX154581_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JX154582_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JX154579_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464825_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGS
MH464817_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859952_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ331047_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MK512462_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
MH464823_MHBs_P-A      DPALNRENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604128_MHBs_P-A      DPAPNMENXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
U87727_MHBs_P-A        DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MK512475_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP168435_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854699_MHBs_P-A      DPAPNMENITSGFLGPLLLLQAGFFLLTRILTIPQSLDSWWTSLNFXGGS
FJ692576_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB116093_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
U87733_MHBs_P-A        DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MK512467_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGS
MK512466_MHBs_P-A      DPVSNMENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MK512457_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MK512468_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP168427_MHBs_P-A      DPAGNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
U87728_MHBs_P-A        DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MK512471_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
MH464810_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
U87734_MHBs_P-A        DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464830_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464829_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464828_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464827_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464826_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464824_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464822_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464821_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464820_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464819_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464818_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464816_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464815_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464814_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464813_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464809_MHBs_P-A      DPALNRENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLXGS
U87731_MHBs_P-A        DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MK512456_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464811_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MK512473_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MK512472_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MK512470_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MK512465_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MK512464_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MK512460_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH464808_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGX
MH464812_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ023662_MHBs_P-A      GPATNMENITSGFLGPLLVLQAGCFLLTKILTIPQSLDSWWTSLNFLGGP
FJ692561_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
AY373429_MHBs_P-A      DPAPNMDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB453989_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLEGA
AB246336_MHBs_P-A      DPAPNMENITSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGS
JX125364_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ023660_MHBs_P-A      GPATNMENITSGFLGPLLVLQAGCFLLTKILTIPQSLDSWWTSLNFLGGP
JN604163_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB116094_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB116086_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
HM011485_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EF103278_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
AY934770_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
AB116091_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB786651_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ023661_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGCFLLTKILTIPQSLDSWWTSLNFLGGA
FJ692566_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY934768_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY934766_MHBs_P-A      DPAANMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
AY934765_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY903452_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
AY373428_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFYLLTRILTIPQSLDSWWTSLNFLGGS
AY233279_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY161139_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
AB453988_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
AB241115_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB116083_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF925385_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF925407_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854706_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
LC051141_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY934767_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY934769_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB786662_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
AB786656_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGA
AB786655_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FM199981_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854693_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FM199974_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854685_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KR139744_MHBs_P-A      DPALNMENITSGFLGPLLVLQGGFFLLTRILTIPQSLDSWWTSLNFLGGX
KX357647_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB786643_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB786645_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB786646_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB786647_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB786648_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB786649_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB786652_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB786654_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB786657_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB786658_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB786660_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KR139742_MHBs_P-A      DPALNRENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KM606748_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854703_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604186_MHBs_P-A      DPAKNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGS
FJ692588_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB937791_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB937796_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692564_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
FJ692565_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
KJ194506_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604155_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGS
KF922426_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KM519453_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KM519452_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922428_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922427_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692567_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
FJ692590_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF925368_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF772353_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KX357650_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP168434_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP168429_MHBs_P-A      DLAPNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGS
KJ854700_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604260_MHBs_P-A      DPXPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604150_MHBs_P-A      DPAPNMENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFPGVX
JN604145_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGES
GU563545_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
FM199976_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGS
AB116090_MHBs_P-A      DPAPNMENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AF043560_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY233276_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY233278_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX357649_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
KP168428_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF170754_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604136_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FM199980_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FM199979_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB453987_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925373_MHBs_P-A      DPAPNMENITSGFPGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP168426_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854696_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854695_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854692_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779332_MHBs_P-A      DPAKNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU410082_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
DQ020003_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
DQ020002_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY934774_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854698_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KU736919_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY934771_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692575_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGX
JN604230_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGS
JN604237_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ023663_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925400_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF772351_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KX357646_MHBs_P-A      DPAANMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KX357645_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KU736920_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KU736918_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KR139743_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP718085_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP168433_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP168432_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP168430_MHBs_P-A      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854707_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854705_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854704_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854702_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854697_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854694_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854690_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854687_MHBs_P-A      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854686_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ843183_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604169_MHBs_P-A      DPAANMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GU563548_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ692591_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FM199978_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB453986_MHBs_P-A      DPAANMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGP
AB116089_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGS
KR905427_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLEGS
AB116088_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGS
MF925372_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB116082_MHBs_P-A      DPAPNMENITSGLLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF214662_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AF090842_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF214661_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF214666_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY373432_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB116092_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB116087_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KR905425_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT366466_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF214657_MHBs_P-A      DPAPNMENITSGFLGPLLVLQEGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF214659_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF925361_MHBs_P-A      DPAPNMENITSGFLKPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB116085_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF214660_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604156_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604171_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604252_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604261_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF214663_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF214665_MHBs_P-A      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KR905430_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KR905431_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT366468_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT366469_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT366470_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT366471_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
M57663_MHBs_P-A        DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB241114_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB246335_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGX
AJ344115_MHBs_P-A      DPVTNMENITSGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLSFLGGS
AY233290_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFPGGP
LT992448_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604193_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGES
JN604220_MHBs_P-A      NPVTNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
GQ184324_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439821_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGS
JF439868_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY738139_MHBs_P-A      DPVTNMENITLGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGS
AY738143_MHBs_P-A      DPVTNMENITLGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477495_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AF143298_MHBs_P-A      DPVTNMENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB116076_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439852_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDPWWTSLNFLGGS
JF439867_MHBs_P-A      DPVTNMANITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439855_MHBs_P-A      DPVTNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439850_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439846_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439841_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439834_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439836_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439840_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439833_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439835_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439837_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439838_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439839_MHBs_P-A      DSVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439843_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSCWTSLNFLGGS
JF439844_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439845_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439848_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439851_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439853_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439854_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439856_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439857_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439858_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439859_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439860_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439865_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439847_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439842_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439828_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439820_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWISLNFLGGS
JF439822_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439825_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439829_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439831_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439832_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGS
JF439824_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439862_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439849_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439864_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQGLDSWWTSLNFLGGA
JF439866_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439861_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439952_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477500_MHBs_P-A      DPVTNMENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGS
GQ477478_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477462_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ184323_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTFFHCLGGS
AY934763_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439949_MHBs_P-A      GPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477502_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLSFLGET
GQ477490_MHBs_P-A      DPVTNMENITSGVLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477477_MHBs_P-A      DPVKNRENITSGFLGPLHVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477463_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
AY233286_MHBs_P-A      DPVTNMENITSGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439992_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGS
JF439984_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWGTSLNFLGGS
JF439982_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GU563551_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477493_MHBs_P-A      DPVTNMENITSGFLEPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AF537371_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697511_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AJ309369_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLGSWWTSLNFLGGS
AJ309371_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859938_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439983_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439981_MHBs_P-A      DPVTNMENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLEGS
JF439979_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439976_MHBs_P-A      DPVTSMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLRGS
JF439972_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439970_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439963_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439960_MHBs_P-A      DPVTDMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439959_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439958_MHBs_P-A      DPVTNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGP
JF439956_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439951_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439947_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477504_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
GQ477498_MHBs_P-A      DPVTNMENITSGFLGPQLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477491_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU859955_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859947_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859939_MHBs_P-A      DPVTNMENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EF208113_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB126580_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439973_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGS
AB480041_MHBs_P-A      DPVTNMENITSGFLGPLLMLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB116077_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB205118_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGES
AJ309370_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGES
JF439985_MHBs_P-A      DPVANMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439988_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439768_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439769_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477503_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GU563553_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604164_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604200_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697493_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439767_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439774_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439777_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF440020_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439971_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439968_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439966_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439957_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477487_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477479_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGS
GQ477472_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGS
EU859934_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU594387_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
DQ788725_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AF090841_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB549213_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB480036_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604270_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGES
JN604167_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439991_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439989_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439987_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439986_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439980_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439978_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439977_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439974_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439969_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439967_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439965_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439964_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGS
JF439962_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439955_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439954_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439953_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439950_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439948_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439946_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439945_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439944_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439943_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GU563550_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477488_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477484_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGS
GQ477482_MHBs_P-A      DPVANMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477466_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGS
GQ477464_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859956_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859953_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859944_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859921_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859907_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU747320_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQILDSWWNSLNFLGGS
EU414133_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
DQ131121_MHBs_P-A      DPVTNMENITSGFLVPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY233280_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AF297622_MHBs_P-A      DPVTNIENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697492_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGES
AB064314_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB116078_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB116079_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB116080_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB116081_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB246337_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB246338_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB263406_MHBs_P-A      DPVANMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB300366_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB300367_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB453979_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB453980_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB453981_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB453982_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB453983_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB480038_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB480039_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB480040_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697487_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604288_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604162_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604300_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604216_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697512_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604173_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604160_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604159_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604158_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439766_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439765_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439764_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439763_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439762_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439761_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439760_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439759_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439758_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439757_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439756_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439755_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439754_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439753_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439752_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GU563562_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GU563558_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GU563557_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GU563555_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GU563554_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GU563546_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477496_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477486_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477467_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477461_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ414522_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ349224_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859954_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859951_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859949_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859948_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859946_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859945_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859943_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859942_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859941_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859940_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859937_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859936_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859935_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859933_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859932_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859931_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859930_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859929_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859928_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859927_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859926_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859925_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859924_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859923_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859922_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859920_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859919_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859918_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859917_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859916_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859915_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859914_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859913_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859912_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859911_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859910_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859909_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859908_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859906_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859905_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859904_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859903_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859902_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859901_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859900_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLRGS
EU859899_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU859898_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU594395_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU594394_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU594393_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU594392_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU594391_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGS
EU594390_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU594389_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU594388_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU594386_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU594384_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU594383_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU414132_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU159676_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU086721_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY902775_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY862868_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY862867_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY707087_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY128092_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AM410963_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AM295799_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AM295798_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AM295797_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AM295795_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AM282986_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AJ012207_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AF297624_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AF090840_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AF090839_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AF043580_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB937798_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB937794_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB937793_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB937792_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB775201_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB775200_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB775199_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB775198_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697509_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697508_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697507_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697505_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697504_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697503_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697501_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697499_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697498_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697497_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697496_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697495_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697491_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697488_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697489_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY738142_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY738140_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY738141_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ298161_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRIPTIPQSLDSWWTSLSFLGEA
DQ298162_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEA
DQ298163_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEA
DQ298165_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEA
AY230117_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEA
AY230118_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEA
AY232839_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEA
AY232836_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEA
AY232838_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEA
AY232840_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEA
DQ298164_MHBs_P-A      DPVRNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEA
JN604308_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGS
JF439990_MHBs_P-A      DPVTNMENITSGLPGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFLGGS
AB937797_MHBs_P-A      DPVTNMENITSGFLGPRLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGES
JF439931_MHBs_P-A      DPATNMENITSGVLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439935_MHBs_P-A      DPATNMENITSGVLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLNFLGGA
AB222707_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGP
JF439870_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGES
JF439877_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439878_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439873_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGES
JF439875_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGES
JF439869_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439871_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439874_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439876_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439879_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439880_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439881_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439882_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439883_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439872_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY232837_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEA
AY152726_MHBs_P-A      DPVTNMENITSGFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
LT992441_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439930_MHBs_P-A      DPATNMENITSGFLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF537372_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLRRILTIPQSLDSWWTSLSFLGGA
JQ707368_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707345_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGP
JQ707350_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707352_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707353_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707359_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707360_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707366_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707369_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707370_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707358_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707346_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707349_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707355_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707356_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707363_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707365_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JF439933_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGA
GQ477501_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGS
JF439912_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439914_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439915_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439927_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439937_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439938_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439939_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439941_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439942_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439916_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGA
JF439928_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439929_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439932_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439934_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439936_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439940_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439925_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439917_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439921_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439923_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439911_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439913_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439918_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439919_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGA
JF439920_MHBs_P-A      DPVTNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439922_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439924_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTVPQSLDSWWTSLNFLGGA
MF979149_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476023_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604290_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGES
JN604266_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477475_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGES
GQ477465_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476002_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDPWWTSLNFLGGS
HE576989_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477473_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGVP
GQ477468_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AF090838_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGS
JQ707318_MHBs_P-A      DPVRNVDNVTSVFKGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604309_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGSFLLTRILTIPQSLDLWWTSLNFPGGV
JF439961_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ477480_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGES
AB362931_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF772348_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGS
KT151615_MHBs_P-A      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476016_MHBs_P-A      DPALNMENVTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604305_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGS
JN604183_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGA
AF536524_MHBs_P-A      DPVTNMENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB453984_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
AB014370_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
U87736_MHBs_P-A        DPVSNMENITSGFLGPLLLLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KX827298_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGES
KJ854701_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476012_MHBs_P-A      GPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGL
KF475984_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604307_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGS
JN604302_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JN604181_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439975_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTVPQSLDSWWTSLNFLGGS
HE576988_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFQGGS
GQ477497_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGS
EU594385_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY034878_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGS
AF297621_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB697506_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGS
KF476026_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476027_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KU605536_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KU605537_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KU605538_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KU605539_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU185789_MHBs_P-A      DPVTNMENIXSGLLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGA
EU185787_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPXNLDSWWTSLNFLGGA
EU185788_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGA
AJ627227_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILIIPQSLDSWWTSLSFLGGS
GQ477469_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGI
KX827293_MHBs_P-A      DPVTNMENTPSGLLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGS
KF476008_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF475994_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGS
JQ707576_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707367_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707351_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JN604298_MHBs_P-A      DPVTNMENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JN604293_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF439993_MHBs_P-A      DPVANMENITSGFLGPLLVLQAGFFLLTRILTIPQGLDSWWTSLNFLGGS
U87726_MHBs_P-A        DPVTNMENITLGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
LT992440_MHBs_P-A      DPVPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ843172_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779381_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JX125367_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707595_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707339_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707319_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604268_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604249_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGX
JN604190_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGES
JN604179_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
MF979153_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
MF979143_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749822_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGS
KP718086_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922437_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922436_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF922435_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779370_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779356_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779349_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779295_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779291_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779270_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779231_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF476013_MHBs_P-A      DPVTNVENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476006_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF475996_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF475992_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF475985_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707605_MHBs_P-A      DPVTNMENITSGGLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707554_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707550_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707537_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ707344_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707337_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604285_MHBs_P-A      DPVTNMENITSGFLGPLLGSLAGFXLLTRILTIPQSLDSWWTSLSFLGGS
JN604282_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604197_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ477494_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
Z72478_MHBs_P-A        DPVTNMENITSGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFIGGS
KF779320_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779260_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476025_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476024_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476022_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476005_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF475997_MHBs_P-A      DPVTNMENVTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF475995_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JX310730_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ707608_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707599_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707592_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707590_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707589_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707586_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707585_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707364_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707362_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707361_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707357_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707354_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707348_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707347_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEP
JQ707342_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707341_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707333_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707320_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707317_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707311_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707308_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707302_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707299_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604297_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604247_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604240_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604214_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSXDSWWTSLNFLGGS
JN604194_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604172_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXS
MF772347_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF772344_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749849_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749847_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749846_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749839_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749834_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ843184_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779322_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTITQSLDSWWTSLNFLGGS
KF779313_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476014_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JX125368_MHBs_P-A      DPVANMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGES
JQ707607_MHBs_P-A      DPVTNMENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707536_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGS
JQ707326_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707316_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604274_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604242_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604227_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604188_MHBs_P-A      DPVTNMENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGX
X51970_MHBs_P-A        DPVTNMENITSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
X02763_MHBs_C-A        DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
V00866_MHBs_P-A        DPVTIMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
U87732_MHBs_P-A        DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF772346_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
MF772345_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGES
KY382410_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KU605532_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749825_MHBs_P-A      DPASNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT151617_MHBs_P-A      DPVANMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP718093_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP718089_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KM519454_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779386_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779383_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779374_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779373_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779372_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779371_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779367_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779352_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779348_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779347_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779346_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779345_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779344_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779335_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779334_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779326_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779309_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779308_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779307_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779306_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779305_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779298_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGS
KF779294_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779293_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779290_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779287_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779286_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779283_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779282_MHBs_P-A      DPVKNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779281_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779280_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779276_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779275_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779274_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGCFLLTRILTIPQSLDSWWTSLNFLGGS
KF779273_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779272_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779271_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779269_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779265_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779264_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779255_MHBs_P-A      DPVANMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779249_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779248_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779247_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779246_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779239_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779238_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779234_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779215_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779213_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476015_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476011_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476010_MHBs_P-A      DPVANMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476009_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476007_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476004_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476003_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476001_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF476000_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF475999_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF475998_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF475993_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLARILTIPQSLDSWWTSLNFLGGS
KF475991_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGS
KF475990_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF475989_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF475988_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF475987_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF475986_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF475983_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGES
KF475982_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JX310723_MHBs_P-A      DPVTNMENITSALLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JX310722_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JX096953_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JX096952_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707596_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707571_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707569_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707561_MHBs_P-A      DLVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ707553_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707543_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707542_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707540_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEP
JQ707539_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707538_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707535_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707533_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707532_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707398_MHBs_P-A      DPVTNMVNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707397_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707391_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707388_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707372_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707324_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707315_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707301_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ687533_MHBs_P-A      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604315_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604306_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604304_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604303_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604299_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604294_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604292_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604291_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604283_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604279_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604277_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604276_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604273_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604269_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604262_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604257_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604228_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604204_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604191_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604185_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604184_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604180_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604178_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
U87735_MHBs_P-A        DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749832_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779321_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779319_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779311_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSIDSWWTSLNFLGGS
KF779254_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779211_MHBs_P-A      DPVANMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF779210_MHBs_P-A      DPVANMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ707604_MHBs_P-A      DHVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707577_MHBs_P-A      DPVTNMENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707331_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707330_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707328_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707322_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707314_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707313_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ707305_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ707300_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JN604176_MHBs_P-A      DPVTNMENITSGFLGPPLVLQAGFFLLTRILTIXKSLDSWWTSLNFLGGX
JN604236_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KY886219_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KX827297_MHBs_P-A      DPVTNMENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT151612_MHBs_P-A      DPVANMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP718102_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ843188_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779324_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTITQSLDSWWTSLNFLGGS
KF779316_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779221_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707656_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707655_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707654_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707653_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707652_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707651_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707650_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707649_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707648_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707647_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707646_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707645_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707643_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707642_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707641_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707640_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707639_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707638_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707636_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707633_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707627_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707615_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707601_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707579_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707564_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707380_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707338_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707323_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
Z35717_MHBs_P-A        DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
X70185_MHBs_P-A        DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
U87730_MHBs_P-A        DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
U87729_MHBs_P-A        DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
U87725_MHBs_P-A        DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MH932713_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF772350_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF772349_MHBs_P-A      DPVVNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
LC458431_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
LC458430_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
LC311243_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
LC311242_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
LC311241_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
LC074724_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
L13994_MHBs_P-A        DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KY003230_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KX827296_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KX827295_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KX827294_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749850_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749844_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749843_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749842_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749840_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749838_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749837_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749836_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749835_MHBs_P-A      DLVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749831_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749830_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749829_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749826_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT749824_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KT151614_MHBs_P-A      DPVANMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP995108_MHBs_P-A      DPVANMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGS
KP718101_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP718099_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP718098_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP718097_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP718096_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP718095_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP718094_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP718092_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP718091_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP718090_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP718088_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP718087_MHBs_P-A      DPVXNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP274928_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP274927_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP274925_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KM606749_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KM606746_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KM606742_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854710_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854709_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ854708_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ843218_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ843217_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ843216_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ843215_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ843214_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ843192_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ843186_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ843182_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ843173_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ843166_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ586809_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779385_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779379_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779378_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779375_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779369_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779368_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779366_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779365_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779364_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779363_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779362_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779361_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779360_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779359_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779358_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLNFLGGS
KF779355_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779354_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779351_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779350_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779342_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779339_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779338_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779337_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779336_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGS
KF779333_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779331_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779330_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779329_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779328_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779325_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779323_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTITQSLDSWWTSLNFLGGS
KF779317_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779315_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLKFLGGS
KF779314_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779312_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779310_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779304_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779299_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779297_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779279_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779277_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779268_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779266_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779263_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGS
KF779262_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779261_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779259_MHBs_P-A      DPVANMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779258_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779257_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779256_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779253_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779252_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLKLLGGS
KF779251_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779245_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779244_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779243_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779240_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KF779227_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KC875260_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JX310732_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JX310731_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JX310725_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JX310724_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JX310721_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707681_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707676_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707675_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707674_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707672_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707670_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707669_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707667_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707665_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707664_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707663_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707662_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707661_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707659_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707658_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707637_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707635_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707634_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707632_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707631_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707630_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707629_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707626_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707625_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707624_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707623_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707622_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707621_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707620_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707619_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707618_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707617_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707616_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707614_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707613_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707612_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707611_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707610_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707609_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707606_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707603_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707594_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707587_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707583_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707581_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707580_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707578_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707575_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707573_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707572_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707570_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707568_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707567_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707566_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707565_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707563_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707562_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707560_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707559_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707558_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707557_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707556_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707555_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707552_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707551_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707549_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707548_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ707547_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSLWTSLNFLGGS
JQ707546_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707545_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGS
JQ707544_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ707541_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707534_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707531_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ707420_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707419_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707418_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707417_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707416_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707415_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707414_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707413_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707412_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707411_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707410_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707409_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707408_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707407_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707406_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707405_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707404_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707403_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707402_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707400_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707399_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707396_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707395_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707394_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707393_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707392_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707390_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707389_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707387_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707386_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707385_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707383_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707382_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707381_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707379_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707378_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGS
JQ707377_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707376_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707375_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707374_MHBs_P-A      DPVTNVENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707373_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707371_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707343_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ707336_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707332_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707325_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
JQ707321_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ707312_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ707310_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707309_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ707307_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JQ707304_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ707303_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ687529_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604319_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KP718100_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGX
JQ707644_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604317_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGP
KX276769_MHBs_P-A      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGXS
KF779232_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JN604165_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGP
JN604314_MHBs_P-A      DPVTNMENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLXFLGGS
                       .      .                     :  :    .     :      

AY161138_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLVLCLIFL
AB194951_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FN545832_MHBs_P-A      HVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFL
AB194952_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FN545825_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
HM363613_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FN545828_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FN545830_MHBs_P-A      PVCHGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FN545829_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FN545833_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH580627_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH580639_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH580642_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH580643_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FN545834_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FN545835_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692554_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439732_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILP-LCLIFL
JF439733_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILP-LCLIFL
FJ692613_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439751_MHBs_P-A      PVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
JF439722_MHBs_P-A      PVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
JF439731_MHBs_P-A      PVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
JF439734_MHBs_P-A      PVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
JF439739_MHBs_P-A      PVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
JF439742_MHBs_P-A      PVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
JF439744_MHBs_P-A      PVCRGQNSQFPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
JF439720_MHBs_P-A      PVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
JF439743_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFTLL-LCLIFL
FJ692606_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFL
AY934764_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AM180624_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ349296_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FN545838_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439896_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439909_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439902_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439904_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439897_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439907_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439738_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439724_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
JF439721_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439730_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439735_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439736_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439737_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439747_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439903_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439905_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439723_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB194950_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692609_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692610_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439906_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AM184125_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AM184126_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU054331_MHBs_C-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KM606737_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439908_MHBs_P-A      PVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439748_MHBs_P-A      PVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
GQ161813_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FN545831_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692599_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439745_MHBs_P-A      PVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
JF439746_MHBs_P-A      PVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
JF439726_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439729_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439898_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439899_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439900_MHBs_P-A      PVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFTIFLFILL-LCLIFL
JF439901_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439910_MHBs_P-A      PVCLGQNSQFPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FN545836_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692598_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFL
JN604217_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFL
HM363612_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692608_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692603_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692595_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692596_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692597_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692600_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692601_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692602_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692604_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692612_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692605_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692611_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692607_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRXIIFLFILL-LCLIFL
KR905429_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692558_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
KF922420_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMFLRRFIIFLFILL-LCLIFL
KF922421_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMFLRRFIIFLFILL-LCLIFL
KF922417_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFL
KF922418_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFL
KF922419_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFL
KF922414_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFL
KF922415_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFL
KF922416_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFL
KR905426_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KT366467_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854689_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604251_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB076687_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLQRFIIFLFILL-LCLIFL
AB076679_MHBs_P-A      PVCRGQNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILL-LCLIFL
AY233287_MHBs_P-A      PVCLGQNSQSPTSNHSPTSRPPICPGYRGMCLRRFIIFLFILL-LCLIFL
AB786661_MHBs_P-A      AVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY233285_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB076682_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILL-LCLIFL
KF922433_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FN545826_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ331046_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB076681_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF476018_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KU605533_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KU605534_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KP168431_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPLICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786663_MHBs_P-A      PVCLGQNSQFPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF476020_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GU563547_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692562_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRXMCLRRFIIFLFILL-LCLIFL
EU366129_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRXMCLRRFIIFLFILL-LCLIFL
AY934773_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFL
AY934772_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY233288_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB076685_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AM494718_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KT347092_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF922434_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF922407_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182334_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182331_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182330_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182324_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182320_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692592_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFL
AY233283_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY233281_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB076680_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB076678_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB076683_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB076686_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB076688_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB076689_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB076690_MHBs_P-A      PVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ010776_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ010777_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ010778_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182318_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182319_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182321_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182322_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182323_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182325_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182326_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182327_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182328_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182329_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182332_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN182333_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692559_MHBs_P-A      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF922429_MHBs_P-A      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF922430_MHBs_P-A      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY233282_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFVIFLFILL-LCLIFL
AY233289_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF922406_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF922408_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF922409_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KT347091_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MF979151_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KX357643_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KP168424_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604241_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
HM535205_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB937795_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786659_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KT347087_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116084_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AF297625_MHBs_P-A      PVCLGQNSQYPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY233274_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY233275_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY233284_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692557_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854691_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692577_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692572_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MK512455_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MF979146_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MF979144_MHBs_P-A      PVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KX648548_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KX357642_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KU605535_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KT347088_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KP168425_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KP168423_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KP168422_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854688_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF476021_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF476017_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
HM535200_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FM199977_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692585_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692584_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692583_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692582_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692581_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692580_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692579_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692578_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692574_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692563_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692571_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF779384_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JX154580_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JX154581_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JX154582_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JX154579_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464825_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464817_MHBs_P-A      PVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859952_MHBs_P-A      PACLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ331047_MHBs_P-A      PACLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MK512462_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464823_MHBs_P-A      PVCLGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604128_MHBs_P-A      PVCHGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
U87727_MHBs_P-A        PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MK512475_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KP168435_MHBs_P-A      PVCXGQNSQSPTSNHSPTSCPPICPGYRWMXLRRFIIFLFILL-LCLIFL
KJ854699_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692576_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116093_MHBs_P-A      PVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
U87733_MHBs_P-A        PVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MK512467_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCAPICPGYRWMCLRRFIIFLFILL-LCLIFL
MK512466_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MK512457_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MK512468_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KP168427_MHBs_P-A      PGCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
U87728_MHBs_P-A        PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MK512471_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464810_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
U87734_MHBs_P-A        PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464830_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464829_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464828_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464827_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464826_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464824_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464822_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464821_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464820_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464819_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464818_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464816_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464815_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464814_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464813_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464809_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
U87731_MHBs_P-A        PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MK512456_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464811_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MK512473_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MK512472_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MK512470_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MK512465_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MK512464_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MK512460_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464808_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MH464812_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JQ023662_MHBs_P-A      PGCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692561_MHBs_P-A      HVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
AY373429_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB453989_MHBs_P-A      TVCLGQNSQSPTSNHSPTSCPPTCAGYRWMCLRRFIIFLFILL-LCLIFL
AB246336_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JX125364_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLSILL-LCLIFL
JQ023660_MHBs_P-A      PGCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604163_MHBs_P-A      PVCFGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116094_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116086_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
HM011485_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EF103278_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILQ-LCLIFL
AY934770_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116091_MHBs_P-A      PVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786651_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JQ023661_MHBs_P-A      PGCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692566_MHBs_P-A      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY934768_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY934766_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY934765_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY903452_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPNCPGYRWMCLRRFIIFLFILL-LCLIFL
AY373428_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY233279_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY161139_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB453988_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB241115_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116083_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MF925385_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MF925407_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854706_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
LC051141_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY934767_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY934769_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786662_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786656_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786655_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FM199981_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854693_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FM199974_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854685_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-LCLIFL
KR139744_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KX357647_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786643_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786645_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786646_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786647_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786648_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786649_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786652_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786654_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786657_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786658_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB786660_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KR139742_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KM606748_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854703_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604186_MHBs_P-A      HVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692588_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB937791_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB937796_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692564_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692565_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ194506_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604155_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF922426_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KM519453_MHBs_P-A      PVCLGQNSQPPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KM519452_MHBs_P-A      PVCLGQNSQPPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF922428_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF922427_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692567_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692590_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MF925368_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MF772353_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KX357650_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KP168434_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KP168429_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854700_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604260_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFL
JN604150_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604145_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GU563545_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FM199976_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116090_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AF043560_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY233276_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY233278_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KX357649_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KP168428_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF170754_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604136_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FM199980_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FM199979_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB453987_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MF925373_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KP168426_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854696_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854695_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854692_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF779332_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU410082_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
DQ020003_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
DQ020002_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY934774_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854698_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KU736919_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY934771_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692575_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604230_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604237_MHBs_P-A      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JQ023663_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MF925400_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MF772351_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KX357646_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KX357645_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KU736920_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KU736918_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KR139743_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KP718085_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KP168433_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KP168432_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KP168430_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854707_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854705_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854704_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854702_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854697_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854694_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854690_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854687_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ854686_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KJ843183_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604169_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GU563548_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ692591_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FM199978_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB453986_MHBs_P-A      PVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
AB116089_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KR905427_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116088_MHBs_P-A      PGCLGQNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFL
MF925372_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116082_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF214662_MHBs_P-A      PVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AF090842_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF214661_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF214666_MHBs_P-A      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY373432_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116092_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116087_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KR905425_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KT366466_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF214657_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF214659_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
MF925361_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116085_MHBs_P-A      PVCLGQNSQSPTSNHSPTFCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF214660_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604156_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604171_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604252_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604261_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF214663_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KF214665_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KR905430_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KR905431_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KT366468_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KT366469_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KT366470_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
KT366471_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
M57663_MHBs_P-A        PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB241114_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB246335_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AJ344115_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILL-LCLIFL
AY233290_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFL
LT992448_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604193_MHBs_P-A      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604220_MHBs_P-A      PECLGQNSQSPTSNHSPTSCPPNCPGYRWMCLRRFIIFLFILL-LCLIFL
GQ184324_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFF
JF439821_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439868_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILL-LCLIFL
AY738139_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY738143_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477495_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AF143298_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116076_MHBs_P-A      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439852_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFTIFLFILL-LCLIFL
JF439867_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439855_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439850_MHBs_P-A      PVYLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439846_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439841_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439834_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439836_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439840_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439833_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439835_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439837_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439838_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439839_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439843_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439844_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439845_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439848_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439851_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439853_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439854_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439856_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439857_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439858_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439859_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439860_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439865_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439847_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439842_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILL-LCLIFL
JF439828_MHBs_P-A      PVCLGQNSPSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439820_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439822_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439825_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439829_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439831_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439832_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439824_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439862_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPIRPGYRWMCLRRFIIFLFILL-LCLIFL
JF439849_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILL-LCLIFL
JF439864_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILL-LCLIFL
JF439866_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLSILL-LCLIFL
JF439861_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILL-LCLIFL
JF439952_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIMFLFILL-LCLIFL
GQ477500_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILL-LCLIFL
GQ477478_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477462_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILL-LCLIFL
GQ184323_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY934763_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439949_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477502_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477490_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477477_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-PCLIFL
GQ477463_MHBs_P-A      PVCLGQNSQSPTCNHSPTSCPPICPGYRWMCLRRFIISLFILL-LCLIFL
AY233286_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439992_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439984_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439982_MHBs_P-A      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GU563551_MHBs_P-A      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477493_MHBs_P-A      HVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AF537371_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697511_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGXRWMCLRRFIIFLFILL-LCLIFL
AJ309369_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AJ309371_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859938_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439983_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439981_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439979_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439976_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFTIFLFILL-LCLIFL
JF439972_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPSYRWMCLRRFIIFLFILL-LCLIFL
JF439970_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439963_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439960_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439959_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439958_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439956_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLVFL
JF439951_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439947_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477504_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477498_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477491_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859955_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859947_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859939_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EF208113_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILL-LCLIFL
AB126580_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439973_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB480041_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116077_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB205118_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AJ309370_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFTIFLFILL-LCLIFL
JF439985_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439988_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439768_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439769_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477503_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GU563553_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604164_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604200_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697493_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439767_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439774_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439777_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF440020_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439971_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439968_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439966_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439957_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477487_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477479_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477472_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859934_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU594387_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
DQ788725_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCPIFL
AF090841_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB549213_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB480036_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604270_MHBs_P-A      PVCLGQNSQSPTSNHSXTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604167_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPNCPGYRWMCLRRFIIFLFILL-LCLIFL
JF439991_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439989_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439987_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439986_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439980_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439978_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439977_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439974_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439969_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439967_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439965_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439964_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439962_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439955_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439954_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439953_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439950_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439948_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439946_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439945_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439944_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439943_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GU563550_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477488_MHBs_P-A      PVCLGQSSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477484_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477482_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477466_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477464_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859956_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859953_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFS
EU859944_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859921_MHBs_P-A      PVCLGQNSQSPTFNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859907_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU747320_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU414133_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
DQ131121_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY233280_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMRLRRFIIFLFILL-LCLIFL
AF297622_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697492_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB064314_MHBs_P-A      PGCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116078_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116079_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116080_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB116081_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB246337_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB246338_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB263406_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB300366_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB300367_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB453979_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB453980_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB453981_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB453982_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB453983_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB480038_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB480039_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB480040_MHBs_P-A      PVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697487_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604288_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604162_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604300_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604216_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697512_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604173_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604160_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604159_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JN604158_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439766_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439765_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439764_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439763_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439762_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439761_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439760_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439759_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439758_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439757_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439756_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439755_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439754_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439753_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
JF439752_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GU563562_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GU563558_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GU563557_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GU563555_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GU563554_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GU563546_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477496_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477486_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477467_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ477461_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
GQ414522_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
FJ349224_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859954_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859951_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859949_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859948_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859946_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859945_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859943_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859942_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859941_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859940_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859937_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859936_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859935_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859933_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859932_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859931_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859930_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859929_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859928_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859927_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859926_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859925_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859924_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859923_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859922_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859920_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859919_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859918_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859917_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859916_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859915_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859914_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859913_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859912_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859911_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859910_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859909_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859908_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859906_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859905_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859904_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859903_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859902_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859901_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859900_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859899_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU859898_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU594395_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU594394_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU594393_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU594392_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU594391_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU594390_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU594389_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU594388_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU594386_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU594384_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU594383_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU414132_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU159676_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
EU086721_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY902775_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY862868_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY862867_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY707087_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AY128092_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AM410963_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AM295799_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AM295798_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AM295797_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AM295795_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AM282986_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AJ012207_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AF297624_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AF090840_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AF090839_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AF043580_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB937798_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB937794_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB937793_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB937792_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB775201_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB775200_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB775199_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB775198_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697509_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697508_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697507_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697505_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697504_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697503_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697501_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697499_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697498_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697497_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697496_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFL
AB697495_MHBs_P-A      PVCLGQNSQSPTSNHSPTSCPPICPG