HBVdb

Dataset for protein Pol of genotype A

[Download (right click)] [Edit] [Sequences] [Repertoires]

1137 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


GQ477493_Pol_P-A      MPLSYQHFRKLLLLDVGT-DAGPLEEELPRLADADLNRRVAEDLNLGNLN
AM282986_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AY707087_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AJ309369_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AJ309370_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEEPPRLADADLNRRVAEDLNLGNLN
JQ707335_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLD
GQ477469_Pol_P-A      MPLSYQSFRKLLLLDDGT-EVGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477497_Pol_P-A      MPLSYQHFRNVLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLT
AB453984_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477473_Pol_P-A      MPLSYQHFRKLLLLDVGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779210_Pol_P-A      MPLSYQHFRSLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779211_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AJ627227_Pol_P-A      MPLSYQHFRKLLLLDXGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB222707_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749822_Pol_P-A      MPLSYQHFRNVLLLDTGT-EAGLLEEELPRLADEDLNRRVAEDLNLGNLN
GQ477501_Pol_P-A      MPLSYQCFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707300_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRIAEDLNLGNLN
JQ707581_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707323_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477475_Pol_P-A      MPLSYQHFRKLLLLDDGT-EVGPLEEELPRLADADLNRRVAEDLNLGNLN
AY738140_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AY738141_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AY738142_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707333_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707327_Pol_P-A      MPLSYQHFRKLLLLDDGT-EVGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707320_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707318_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707314_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707309_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477478_Pol_P-A      MPLSYQHFRKILLLDHGA-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477477_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477463_Pol_P-A      MPLSYQLFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
DQ788725_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEELNLGNLN
L13994_Pol_P-A        MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779365_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707602_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707593_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707580_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707342_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707339_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707312_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GU563551_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGDLN
GQ477490_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477474_Pol_P-A      MPLSYQHFRKLLLLDDGT-ESGPLEEELPRLADADLNRRVAEDLHLGNLN
JQ707588_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707597_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707574_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707579_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707591_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP718095_Pol_P-A      MPLSYQHFRKLLLLDDEA-EAGPLEEEPPRLADEDLNRRVAEDLNLGNLN
KF779221_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADSDRRVAEDLNLGNLN
JQ707322_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707331_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707319_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477487_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB300366_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB480039_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB116081_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLANADLNRRVAEDLNLGNLN
AB116080_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB453980_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB116079_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB246338_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB300367_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB453979_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB453981_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB480038_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707575_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707583_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707603_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KJ843184_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779354_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779261_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707608_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707604_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707592_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707585_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707341_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707337_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707330_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707311_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707308_Pol_P-A      MPLSYQHFRRLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707302_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707299_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439762_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB116077_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KX827295_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749831_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707589_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707578_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707301_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477495_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477472_Pol_P-A      MPLSYQYFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB126580_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KX827297_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLSRRVAEDLNLGNLN
KT749833_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KJ843173_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KJ586809_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779284_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLAVSHINRRVAEDLNLGNLN
JQ707638_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707633_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707610_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707576_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707343_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707338_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477484_Pol_P-A      MPLSYQHFRKLLLLDDST-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ184324_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU414133_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707652_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707656_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KX827296_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KJ854710_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779374_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779372_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779356_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779349_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779345_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779322_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779309_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779269_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779249_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779240_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779239_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLAYADLNRRVAEDLNLGNLN
JX096953_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707615_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707598_Pol_P-A      MPLSYQHFRKLLLLDVGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707590_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707586_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707582_Pol_P-A      MPLSYQHFRKLLLLDVGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707561_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707334_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707328_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707317_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707316_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707315_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707310_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707307_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707306_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707305_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707304_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439759_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439753_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GU563555_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477476_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859939_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU594386_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU185786_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707551_Pol_P-A      MPLSYQHFRKLLLLDDGT-EVGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707567_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707568_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707571_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
Z72478_Pol_P-A        MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749838_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854709_Pol_P-A      MPLSYQHFRKLLLLDDXT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KJ843217_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADGDLNRRVAEDLNLGNLN
KF779308_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADPNRRVAEDLNLGNLN
KF779282_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779264_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707654_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707539_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707536_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707303_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477482_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ184323_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859946_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU594393_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KJ843182_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KJ843186_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KJ843218_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU414132_Pol_P-A      MPLSYQHFRKLLLLDXGT-EAGPLEEELPRLADADLNRRVAEDLNLGNXN
JX310721_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KY886219_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749836_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP718087_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KJ843188_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779367_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707655_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707651_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707649_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707648_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707641_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707640_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707639_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707636_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707533_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707540_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707542_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707553_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707558_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477491_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP718097_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP718098_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP718100_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP718092_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP718101_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP718099_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP718096_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP718094_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP718091_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP718089_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP718090_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP718088_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779273_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779274_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
Z35717_Pol_P-A        MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KY382410_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KX827293_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749843_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749830_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP718093_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KJ854708_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KJ843216_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KJ843215_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KJ843214_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KJ843192_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KJ843172_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KJ843166_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779383_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779375_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779368_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779307_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779306_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779305_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779281_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779280_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779279_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779277_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779271_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779253_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779252_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JX310723_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707637_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707632_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707626_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707624_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707623_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707621_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707620_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707619_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707618_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707616_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707613_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707612_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707611_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707537_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707321_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707313_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439766_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439765_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439764_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439763_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439761_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439760_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439758_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439757_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439756_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439755_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439754_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439752_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GU563554_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GU563550_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477503_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477470_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859953_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859948_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859947_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859945_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU594383_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KU605532_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749844_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749832_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779243_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707562_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707559_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707552_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707550_Pol_P-A      MPLSYQHFRKLLLLDDGI-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707535_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
HE576988_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477498_Pol_P-A      MPLSYQHFRKLLLLDVGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859951_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859943_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859940_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU594388_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF779336_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477500_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477468_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859955_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859949_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
MH932713_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
LC311242_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
LC311241_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
LC074724_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KY003230_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749850_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749840_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749835_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749829_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749824_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KM606749_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KM606746_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KM606742_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KM519454_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779373_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779369_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779352_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779351_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779346_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779248_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779247_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779246_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779227_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JX310722_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707548_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GU563562_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GU563546_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477461_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ414522_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
FJ349224_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859956_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859954_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859942_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859941_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859937_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859936_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859935_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859933_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859932_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859931_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859930_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859929_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859919_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859918_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859915_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859914_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859912_Pol_P-A      MPLSYQHFRKLLLVDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859904_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU594395_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU594394_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU594392_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU594391_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU594390_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU594389_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU185787_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707544_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707531_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779231_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GU563557_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU185789_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GU563553_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
MF772345_Pol_P-A      MPLSYQHFRKLVLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
MF772348_Pol_P-A      MPLSYQHFRKLLLLDDGT-ESGPLEEELPRLADADLNRRVAEDLNLGNLN
MF772347_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
MF772344_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
MF772346_Pol_P-A      MPLSYQHFRKLVLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
MF772350_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
DQ298161_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGDPN
DQ298163_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGDPN
DQ298164_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGDPN
DQ298165_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPIEEELPRLADADPNRRVAEDLNLGDPN
KF779213_Pol_P-A      MPLSYQHFRKLLLIDDGT-EAGPLEEELPRLADADLNRRVAEDLHLRNLN
KF779215_Pol_P-A      MPLSYQHFRKLLLIDDGT-EAGPLEEELPRLADADLNRRVAEDLHLRNLN
AJ344115_Pol_P-A      MPLSYHHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477464_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AY152726_Pol_P-A      MPLSYQHFRNVLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
X51970_Pol_P-A        MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477502_Pol_P-A      MPLSYQHFRKLLLLDHET-EAGPLEEELPRLADADLNRRVAEDLNLGDLN
GQ477499_Pol_P-A      MPLSYQHFRKLLLLDVGT-DAGPLEEELPRLADANLNRRVAEDLNLGNLN
AB205118_Pol_P-A      MPLSYQHFRKQLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707398_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AF090838_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNPN
JQ707367_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707401_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477480_Pol_P-A      MPLSYQHFRKLLLLDVGT-DAGPLEEELPRLADADLNRRVAEDLNLGNLN
AF090841_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB116076_Pol_P-A      MPLSYQHFRKLLLLDAGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439767_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439768_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439769_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439774_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF439777_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JF440020_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749839_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEQELPRLADADLNRRVAEDLNLGNLN
KF779234_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707358_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AY034878_Pol_P-A      MPLSYQHFRKLLLLDNGT-DAGPLEEELPRLADADLNRRVAEDLNLGNLN
AF537372_Pol_P-A      MPLSYQHFRKLLLLDVGA-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AJ627228_Pol_P-A      MPLSYQFFRKLLLLDDET-EVGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749834_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLAYADLNRRVAEDLNLGNLN
KT749846_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749847_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749849_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707374_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477462_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLHLGDLN
KF779265_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADAYLNRRVAEDLNLGNLN
KF779263_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707346_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477494_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AY233286_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB362931_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB014370_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
X70185_Pol_P-A        MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP995108_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGDLN
JQ707378_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707369_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707365_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707363_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707361_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707356_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707355_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707352_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707349_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707345_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707340_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707329_Pol_P-A      MPLSYQNFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477465_Pol_P-A      MPLSYQHFRKLLFVDDGS-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AY738139_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697511_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707366_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707353_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707380_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707368_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGSLEEELPRLADADLNRRVAEDLNLGNLN
JQ707360_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707359_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707350_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707347_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707324_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707326_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707354_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707362_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707370_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JX096952_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707635_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRHADADLNRRVAEDLNLGNLN
JQ707634_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707419_Pol_P-A      MPLSYQHFRKLLLLDDGT-GAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707418_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707415_Pol_P-A      MPLSYQHFRKLLLLDEGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707399_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707387_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707383_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707377_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707371_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707364_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707357_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707348_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779316_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779311_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADPNRRVAEDLNLGNLN
JQ707587_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707351_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477504_Pol_P-A      MPLSYQHFRKLLLLDEGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477466_Pol_P-A      MPLSYQHFRKLLLLDVGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AY902775_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AY738143_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AY233280_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AF537371_Pol_P-A      MPLSYQRFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLD
JQ707375_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707391_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707406_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707397_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707373_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707376_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707379_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707381_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707382_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707384_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707385_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707386_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707388_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707389_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707390_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707392_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707393_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707394_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707396_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707400_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707402_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707403_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707395_Pol_P-A      MPLSYQHFRKLLLLDDGT-AAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707404_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707405_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707407_Pol_P-A      MPLSYQHFRKLLLLDEGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707408_Pol_P-A      MPLSYQHFRKLLLLDEGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707409_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707410_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707411_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707412_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707413_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707414_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707416_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707417_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707420_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KX827294_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779259_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707607_Pol_P-A      MPLSYQHFRKLLLLDVGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707372_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707344_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB453983_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779320_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779314_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707653_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AF536524_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB453982_Pol_P-A      MPLSYQHFRKLLLLDVGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB064314_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGSLEEELPRLADADLNRRVAEDLNLGNLN
KF779312_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779328_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779330_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779331_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779335_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779342_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779358_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779359_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779333_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779361_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779324_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779297_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLYRRVAEDLNLGNLN
KF779293_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779283_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779255_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707630_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707606_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707600_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707595_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707584_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707577_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477486_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859934_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859900_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU594387_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AF143298_Pol_P-A      MPLSYQQFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AF090839_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859950_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779298_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779287_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779290_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779291_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779294_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779286_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779323_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779315_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779310_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779304_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779325_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779258_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779337_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779338_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779339_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779360_Pol_P-A      MLLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779262_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779256_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707599_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707332_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ687533_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLANADLNRRVAKDLNLGNLN
EU747320_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP718102_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELXRLADADLNRRVAEDLNLGNLN
KF779364_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779348_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779344_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779319_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779317_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779295_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779276_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779275_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779238_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707650_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707647_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707646_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707645_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707644_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707643_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707642_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707627_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707617_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707614_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707609_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707547_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707538_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707532_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707325_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB480036_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707622_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707625_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707628_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707629_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707631_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779321_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779386_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP274925_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADGDLNRRVAEDLNLGNLN
KF779378_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779363_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779362_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779268_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADASLNRRVAEDLNLGNLN
KF779257_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779254_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707674_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707661_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707605_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707601_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707596_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707594_Pol_P-A      MPLSYQHFRKLLLLDVGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707572_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707545_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707554_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707555_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707556_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707563_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707564_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707565_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707336_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GU563558_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477488_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859924_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859920_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859911_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU086721_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AM410963_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AM295797_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AM295795_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697512_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697509_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697501_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697492_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697489_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697488_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697487_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB549213_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB246337_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
X02763_Pol_C-A        MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLHRRVAEDLNLGNLN
KT749825_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779379_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779326_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779251_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707672_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707549_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
HE576989_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859944_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
EU594384_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697493_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697495_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB775198_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB775199_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB775200_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB775201_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB937792_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB937793_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB937794_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707534_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707541_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707543_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707546_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707557_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707560_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707566_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707569_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707570_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707573_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779244_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779245_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779266_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779299_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779329_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVPEDLNLGNLN
KF779347_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
LC458430_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779385_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779371_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779350_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779355_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
LC458431_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779232_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AF090840_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB116078_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
LC311243_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KX827298_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749837_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP274928_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779381_Pol_P-A      MPLSYQHFRKLLLLDDGT-EVGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779272_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707681_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707676_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707675_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707670_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707669_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707667_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707665_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707664_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707663_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707662_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707659_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ707658_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
JQ687529_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477479_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859928_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859927_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859926_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859925_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859923_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859922_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859921_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859917_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859916_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859913_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859909_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859908_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859907_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859906_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859905_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859903_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859901_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859899_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859898_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLANADLNRRVAEDLNLGNLN
EU594385_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EF208113_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AY862868_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AY862867_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AJ012207_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AF043580_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB937798_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697508_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697507_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697506_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697505_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697504_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697503_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697499_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697498_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697497_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697496_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB697491_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB480041_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749842_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT749826_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779366_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KF779313_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859938_Pol_P-A      MPLSYQHFRKLLLLDVGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859910_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
EU859902_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB480040_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477467_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP274927_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
GQ477496_Pol_P-A      MPLSYQHFRKLLLLDDGT-ESGPLEEELPRLADADLNRRVAEDLNLGNLN
AB937797_Pol_P-A      MPLSYQHFRKLLLLDXGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AY128092_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
DQ315785_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
LT992441_Pol_P-A      MPLSYQHFRKLLLLDD---EAGPLEEELPRLADEDLNRRVAEDLNLGNPN
GQ331046_Pol_P-A      MPLSYQHFRKLLLLDEGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNPN
EU859952_Pol_P-A      MPLSYQHFRKLLLLDEGT-EVGPLEEELPRLADEDLNRRVAKDLNLGNLN
GQ331047_Pol_P-A      MPLSYQHFRKLLLLDEGT-EVGPLEEELPRLADEDLNRRVAKDLNLGNPN
AB194950_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
HM363612_Pol_P-A      MPLSYQHFRKLLLLDDGT-EVGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692554_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADEDLNHRVAEDLNLGNLN
FN545831_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADEDLNHRVAEDLNLGNLN
FN545836_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADEDLNHRVAEDLNLGNLN
FJ692613_Pol_P-A      MPLSYQHFRRLLLLDDEI-EAGPLEDELPRLADEDLNHRVAEDLNLGNLT
FJ692599_Pol_P-A      MPLSYRHFLKLLLLDDET-EAGPLEDELPRLADEDLNHRVAEDLNLGNLN
FJ692611_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEDELPRLADEGLNRRVAEDLNLGNLN
FJ692595_Pol_P-A      MPLSYQHFRKLLLLDNDT-EAGPLEDELPRLADEDLNHRVAEDLNLGNLN
FJ692598_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEDELPRLADEDLNHRVAEDLNLGNLN
FJ692593_Pol_P-A      MPLSYQHFRKLLLLDD---EAGPLEDELPRLADEDLNHRVAEDLNLGNLN
FJ692607_Pol_P-A      MPLSYQHFRKLLLLDEET-EAGPLEDELPRLADEDLNHRVAEDLNLGNLN
FJ692603_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEDELPRLADEELNHRVAEDLNLGNLN
FJ692609_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEDVLPRLADEDLNHRVAEDLNLGNLN
FJ692608_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEDELPRLADEDLNHRVAEDLNLGNLN
FJ692606_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEDELPRLADEDLNHRVAEDLNLGNLN
FJ692601_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEDELPRLADEDLNHRVAEDLNLGNLN
FJ692610_Pol_P-A      MPLSYQHFRKLLLLDDEX-EAGPLEDVLPRLADEDLNHRVAEDLNLGNLN
FJ692596_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEDELPRLADEDLNHRVAEDLNLGNLN
FJ692612_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEDELPRLADEDLNHRVAEDLNLGNLN
FJ692605_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEDVLPRLADEDLNHRVAEDLNLGNLN
FJ692604_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEDELPRLADEDLNHRVAEDLNLGNLN
FJ692597_Pol_P-A      MPLSYQHFRKLLLLDXXS-EAGPLEDELPRLADEDLNHRVAEDLNLGNLN
FJ692600_Pol_P-A      MPLSYQHFRKLLLLDDXT-EAGPLEDELPRLADEDLNHRVAEDLNLGNLN
FJ692602_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEDELPRLADEDLNHRVAEDLNLGNLN
FN545833_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FN545834_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY934763_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
FN545830_Pol_P-A      MPLSYQHFRKLLLLDEGT-EVGPLEEELPRLADEDLNRRVAEDLNLGNLN
FN545840_Pol_P-A      MPLSYQHFRKLLLLDEGT-EVGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ349296_Pol_P-A      MPLSYQHFRKLLLLDVGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FN545826_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439731_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439723_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439732_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439733_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439745_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439750_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439751_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439727_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439741_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439729_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439748_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDPNLGNLN
JF439746_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439740_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439743_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439747_Pol_P-A      MPLSYRHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439730_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439735_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439737_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439724_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439721_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439736_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439738_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439725_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439728_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439742_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439734_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439744_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439722_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JF439739_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH580627_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH580639_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH580642_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH580643_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FN545829_Pol_P-A      MPLSYQHFRKLLLLDEGT-ELGPLEEELPRLADEDLNRRVAEDLNLGNLN
FN545828_Pol_P-A      MPLSYQHFRKLLLLDEGT-QAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FN545835_Pol_P-A      MPLSYQHFRKLLLLDEGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FN545832_Pol_P-A      MPLSYQHFRKLLLLDXGT-EVGPLEEELPRLADEDLNRRVAEDLNLGNLN
HM363613_Pol_P-A      MPLSYQHFRKLLLLDDGT-EVGPLEEELPRLADEDLNRRVAEDLNLGNLN
EU054331_Pol_C-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
FN545825_Pol_P-A      MPLSYQHFLKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEXLNLGNLN
KM606737_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FN545838_Pol_P-A      MPLSYQHFRKLLLLDYGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AB194951_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB194952_Pol_P-A      MPLSYQHFRKLLLLDDGT-EVGPLEEELPRLADEDLNRRVAEDLNLGNLN
AM184125_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AY934764_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
GQ161813_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AM180624_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGXLN
AM184126_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
LT992448_Pol_P-A      MPLSYQHFRKLLLLDD---EAGPLEEELPRLADEGLNRRVAEDLNLGNPN
AY233290_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922418_Pol_P-A      MPLSYHHFRKLLLLDDEA-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922420_Pol_P-A      MPLSYHHFRKLLLLDDEA-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922414_Pol_P-A      MPLSYHHFRKLLLLDDEA-ETGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922415_Pol_P-A      MPLSYHHFRKLLLLDDEA-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922416_Pol_P-A      MPLSYHHFRKLLLLDDEA-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922421_Pol_P-A      MPLSYHHFRKLLLLDDEA-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922417_Pol_P-A      MPLSYHHFRKLLLLDDEA-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922419_Pol_P-A      MPLSYHHFRKLLLLDDEA-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922437_Pol_P-A      MPLSYQSFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922435_Pol_P-A      MPLSYQSFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922436_Pol_P-A      MPLSYQSFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KU605536_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KU605537_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KU605538_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KU605539_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464817_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEELNLGNLN
AB076679_Pol_P-A      MPLSYQHFRKLLLLDEET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MK512462_Pol_P-A      MPLSYQHFRKLLLLDDET-EVGPLEEELPRLADEDLNRRVAEDLNLGNLN
MK512456_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MK512470_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KP168422_Pol_P-A      MPLSYQHFRKLLLLDXET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MK512472_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MK512464_Pol_P-A      MPLSYQHFRKLLFLDDET-EAGPLEEELPRLADEDFNRRVAEDLNLGNLN
MK512467_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MK512457_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KU736918_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KU736919_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MK512460_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLANKNLNRRVAKDLNLGNLN
MK512474_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRPADEDLNRRVAEDLNLGNLN
FM199981_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRXVAEDLNLGNLN
GU563547_Pol_P-A      MPLSYQHFRKLLLLDDET-EVGPLEEELPRLADEDLNRRVAEDLNLGNLN
MK512473_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MK512468_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FM199978_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FM199976_Pol_P-A      MPLSYQHFRKLLLLDDET-EXGPLEEELPRLADEDLNRRVAEDLNLGNLN
FM199977_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEDELPRLADEDLNRRVAEDLNLGNLN
GU563548_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FM199980_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FM199979_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FM199974_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
GU563545_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KT347091_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692587_Pol_P-A      MPLSYQHFRKLLLLDDAT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY233275_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY233281_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922429_Pol_P-A      MPLSYQLFRRLLLLDDEA-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922430_Pol_P-A      MPLSYQLFRRLLLLDDEA-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
HM535205_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY233283_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY233274_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAGDLNLGNLN
KJ010777_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY233289_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY233282_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ010776_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ010778_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464812_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY233285_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KU605533_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KU605534_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KT347092_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922407_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEGLNRRVAEDLNLGNLN
HM535200_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KT347088_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922409_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464810_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KX648548_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KU605535_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922408_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464813_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464814_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464818_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922406_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464815_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464825_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464828_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464829_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464824_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464830_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464826_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464822_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464827_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464819_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464821_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KP168427_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
DQ020002_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MK512471_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MK512475_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KX357646_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692592_Pol_P-A      MPLSYQHFRKLLLLDVET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY233288_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MK512465_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY233284_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KP168424_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KP168425_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JN182333_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JN182332_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922433_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922434_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JN182323_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JN182320_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB076678_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JN182327_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JN182326_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JN182324_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JN182318_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JN182321_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JN182325_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JN182329_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JN182330_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JN182331_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY934772_Pol_P-A      MPLSYQHFRKLLLLDDET-EVGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY934766_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KP168426_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AM494718_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY934773_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KP168423_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JX154579_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JX154580_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JX154581_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
JX154582_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB116084_Pol_P-A      MPLSYQHFRKLLLLDDAT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
HM011485_Pol_P-A      MPLSYQHFRKLLLLDDET-KAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB116092_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB116083_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
EF103278_Pol_P-A      MPLSYQHFRRLLLLDVET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY161139_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KT151612_Pol_P-A      MPLSYQHFRKLLLLEEEA-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KT151617_Pol_P-A      MPLSYQHFRKLLLLEEEA-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB937795_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MF925368_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB116094_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
LT992440_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADEDLNRRVAEDLNLGNPN
KP168433_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP168431_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854701_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLT
KT347087_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464809_Pol_P-A      MPLSYQHFRKLLLLDAEL-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464823_Pol_P-A      MPLSYQHFRKLLLLDAEL-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464808_Pol_P-A      MPLSYQHFXKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB116088_Pol_P-A      MPLSYQHFRKLLLLDNEA-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB453986_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB453987_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB116093_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
MF925362_Pol_P-A      MPLSYQHFRKLLLLDDEA-KAGPLEEELPRLADEDLNRRVAEDLNLGNLN
DQ020003_Pol_P-A      MPLSYQHFRKLLLLDDVT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY233287_Pol_P-A      MPLSYQHFRKLLLLDDEI-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB116086_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNPN
KJ854685_Pol_P-A      MPLSYQHFRKLLLLDVET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY373428_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB246336_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB116085_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF214657_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF214660_Pol_P-A      MPLSYQHFRKLLLLDDET-EVGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY934767_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY373429_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLVEELPRLADEDLNRRVAEDLNLGNLN
AY233276_Pol_P-A      MPLSYQHFRKLLLLDDEI-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY934770_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY934768_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY934765_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY934771_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KX357649_Pol_P-A      MPLSYQHFRKLLLLDVET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB241115_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MF925385_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KP168429_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KP168428_Pol_P-A      MPLSYQHFRKLLLLDVAT-EXGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF214662_Pol_P-A      MPLSYQHFRKLLLLDDET-EVGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692566_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY233279_Pol_P-A      MPLSYQHFRKLLLLDDEI-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB241114_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB246335_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KP168430_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY233278_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB453989_Pol_P-A      MPLSYQHFRKLLLLDNDT-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB116087_Pol_P-A      MPLSYQHFRKLLLLDDES-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY903452_Pol_P-A      MPLSYQHFRKLLLLD--A-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464820_Pol_P-A      MPLSYQHFRKLLLLDDEI-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MF925400_Pol_P-A      MPLSYQHFRKLLLLDVET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KX357650_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KP168432_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF214659_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF214663_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB116082_Pol_P-A      MPLSYQHFRKLLLLDVET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KR905431_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854687_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MF772351_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MF772353_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KT151614_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF214661_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY934769_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464811_Pol_P-A      MPLSYQHFRKLLLLDAEL-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MF925407_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MF925372_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KR905427_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNPN
AF090842_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB453988_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB116089_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KT366470_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ194506_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB937791_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB937796_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KX357647_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KT151615_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854707_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854695_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854688_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854690_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
EU410082_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KP718085_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KP718086_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
LC051141_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KT366468_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KR905430_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY934774_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KX357645_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KX357643_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KX357642_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KU736920_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KT366467_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KR905426_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854699_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922428_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MF925373_Pol_P-A      MPLSYQHFRKLLLLDVET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KX276769_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEELNLGNLN
KM606748_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854700_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KP168434_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854698_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854693_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KT366471_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922427_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KT366469_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KT366466_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KR905425_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KM519452_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854694_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MF925361_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KM519453_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922426_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922424_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF922425_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
MH464816_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF779384_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AY373432_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF779332_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB116091_Pol_P-A      MPLSYQHFRKLLLLDDET-EVGPLEEELPRLADEDLNRRVAEDLNLGNLN
KF214666_Pol_P-A      MPLSYQHFRKLLLLDDE---VGPLEEELPRLADEDLNRRVAEDLNLGNLN
JQ023661_Pol_P-A      RPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAKDLNLGNLN
JQ023662_Pol_P-A      RPLSYQHFRKLLLFDDET-EAGPLKEELPRLADENLNRRVAKDLNLGNLN
JQ023663_Pol_P-A      RPLSYQHFRKLLLFDDET-EAGPLKEELPRLANENLNRRVAKNLNLGNLN
KF214665_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692576_Pol_P-A      MPLSYQHFRKLLLLEDDP-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692562_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692559_Pol_P-A      MPLSYQXFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGXLN
EU366129_Pol_P-A      MPLSYQHFRKLLLLDVES-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KR905429_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854696_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854691_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692575_Pol_P-A      MPLSYQHFRKLLLLDDET-EXGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854706_Pol_P-A      MPLSYQRFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854702_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854692_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854689_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854703_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ843183_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854697_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AF043560_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854704_Pol_P-A      MPLSYQHFRKLLLLDEET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854705_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692577_Pol_P-A      MPLSYQHFRKLLLLDVGT-DAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KJ854686_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692578_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692579_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692580_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692581_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692582_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692583_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692584_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692585_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692571_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRHVAEDLNLGNLN
FJ692591_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692564_Pol_P-A      MPLSYQHFRKLLLLDDEA-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692565_Pol_P-A      MPLSYQHFRKLLLLDDEX-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692590_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692567_Pol_P-A      MPLSYQHFRRLLLLDVET-EAGPLEEELPRLADEDLNRRVAEDLNLGNXN
FJ692558_Pol_P-A      MPLSYQHFRKLLLLDDET-VAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692557_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692563_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692574_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692561_Pol_P-A      MPLSYQHFRXLLLLDVEP-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692572_Pol_P-A      MPLSYQHFRKLLLLDVET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ692588_Pol_P-A      MPLSYQHFRKLLLLDDETGKAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AY161138_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
KP168435_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEELNLGNLN
AF297622_Pol_P-A      MPLSYQHFRRLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AF297624_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
AF297621_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AB116090_Pol_P-A      MPLSYPHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
AF297625_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
FJ904434_Pol_P-A      MPLSYQHFRKLLLLDDGT-EAGPLEEELPRLADADLNRRVAEDLNLGNLN
MK512455_Pol_P-A      MPLSYQHFRKLLLLDVET-EAGPLEEELPRLADEDLNRRVAKDLNLGNLN
KX648547_Pol_P-A      MPLSYQHFRKLLLLDDEA-AAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KC875252_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KC875259_Pol_P-A      MPLSYQHFRKLVLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
DQ315786_Pol_P-A      MPLSYQHFRKLLLLDDET-EVGPLEEELPRLADEDLNRRVAEDLNLGNLN
KC875258_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KC875253_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KC875257_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KC875251_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KC875255_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
KC875256_Pol_P-A      MPLSYQHFRKLLLLDDET-EAGPLEEELPRLADEDLNRRVAEDLNLGNLN
                        ***  *   ::.:      * : :   * *     . :.   :*    

GQ477493_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPEIHLQEDIINRCEHFVG
AM282986_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AY707087_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AJ309369_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AJ309370_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707335_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477469_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477497_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB453984_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477473_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779210_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779211_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AJ627227_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB222707_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749822_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCEQFVG
GQ477501_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707300_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707581_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707323_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWKTPSFPKIHLQEDIINRCQQFVG
GQ477475_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
AY738140_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AY738141_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AY738142_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707333_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707327_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707320_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707318_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707314_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707309_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477478_Pol_P-A      VNIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477477_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCEQFVG
GQ477463_Pol_P-A      VSIPWTHKVGNFTGLYSSKVPIFNPEWQTPSFPKIHLQEDIINRCEQFVG
DQ788725_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPKIHLQEDIINRCQQFVG
L13994_Pol_P-A        VSIPWTHKVGNFTGLYSSTVPVFNPEWQSPSFPKIHLQEDIINRCQQFVG
KF779365_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707602_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707593_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707580_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707342_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707339_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707312_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GU563551_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCEQFVG
GQ477490_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477474_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPLFNPDWQTPSFPKIHLQEDIINRCQQFVG
JQ707588_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707597_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707574_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707579_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707591_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KP718095_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
KF779221_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707322_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707331_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707319_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477487_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB300366_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB480039_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB116081_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB116080_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB453980_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB116079_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB246338_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB300367_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB453979_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB453981_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB480038_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707575_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707583_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707603_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KJ843184_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779354_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIHRCQQFVG
KF779261_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707608_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707604_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707592_Pol_P-A      VNIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707585_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707341_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707337_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707330_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707311_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707308_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707302_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707299_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JF439762_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB116077_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KX827295_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIHRCQQFVG
KT749831_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707589_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707578_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707301_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477495_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477472_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB126580_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KX827297_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749833_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KJ843173_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KJ586809_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779284_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707638_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707633_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQLVG
JQ707610_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707576_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707343_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707338_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477484_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
GQ184324_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU414133_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707652_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707656_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KX827296_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIHRCQQFVG
KJ854710_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779374_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779372_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779356_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779349_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779345_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779322_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779309_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779269_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779249_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779240_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLREDIINRCQQFVG
KF779239_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIHRCQQFVG
JX096953_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707615_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707598_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707590_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707586_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
JQ707582_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707561_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707334_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707328_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707317_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707316_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707315_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707310_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707307_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707306_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707305_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707304_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JF439759_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKILLQEDIINRCQQFVG
JF439753_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GU563555_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
GQ477476_Pol_P-A      VSIPWTHKVGNFSGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859939_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCEQFVG
EU594386_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
EU185786_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707551_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707567_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707568_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707571_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
Z72478_Pol_P-A        VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
KT749838_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
KJ854709_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KJ843217_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779308_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779282_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779264_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707654_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQLVG
JQ707539_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707536_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707303_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477482_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPQWQTPSFPKIHLQEDIINRCQQFVG
GQ184323_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859946_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU594393_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KJ843182_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KJ843186_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KJ843218_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU414132_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JX310721_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KY886219_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749836_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KP718087_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KJ843188_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779367_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707655_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707651_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707649_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707648_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707641_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707640_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707639_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707636_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707533_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707540_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707542_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707553_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707558_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477491_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KP718097_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPNIHLQEDIIDRCQQFVG
KP718098_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
KP718100_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
KP718092_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
KP718101_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
KP718099_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
KP718096_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
KP718094_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
KP718091_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
KP718089_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
KP718090_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
KP718088_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
KF779273_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779274_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
Z35717_Pol_P-A        VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KY382410_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KX827293_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749843_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749830_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KP718093_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KJ854708_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPTIHLQEDIINRCQQFVG
KJ843216_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KJ843215_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KJ843214_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KJ843192_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KJ843172_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KJ843166_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779383_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779375_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779368_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779307_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCHQFVG
KF779306_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779305_Pol_P-A      VSIAWTHKVGNFTGLYSSTVAIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779281_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779280_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779279_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779277_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779271_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779253_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779252_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JX310723_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707637_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707632_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707626_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707624_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707623_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707621_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707620_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707619_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707618_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707616_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707613_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707612_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707611_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707537_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707321_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707313_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JF439766_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JF439765_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JF439764_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JF439763_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JF439761_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JF439760_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JF439758_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JF439757_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JF439756_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JF439755_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JF439754_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JF439752_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GU563554_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GU563550_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
GQ477503_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477470_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859953_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859948_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859947_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859945_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU594383_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPNIHLQEDIINRCQQFVG
KU605532_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749844_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749832_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779243_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCHQFVG
JQ707562_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707559_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707552_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707550_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707535_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
HE576988_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477498_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859951_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859943_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
EU859940_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU594388_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779336_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477500_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCEQFVG
GQ477468_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859955_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859949_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
MH932713_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
LC311242_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
LC311241_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
LC074724_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KY003230_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749850_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749840_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749835_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749829_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749824_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
KM606749_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KM606746_Pol_P-A      VSIPWTHKVGNFTGLYSSKVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KM606742_Pol_P-A      VSIPWTHKVGNFTGLYSSKVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KM519454_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779373_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779369_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779352_Pol_P-A      VSIPWTHKVGNFTGLYSSKVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779351_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779346_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779248_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779247_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779246_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779227_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JX310722_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707548_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GU563562_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GU563546_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477461_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ414522_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
FJ349224_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859956_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859954_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
EU859942_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859941_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
EU859937_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859936_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859935_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859933_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
EU859932_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859931_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859930_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859929_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859919_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859918_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859915_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859914_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859912_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859904_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU594395_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU594394_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU594392_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU594391_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU594390_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU594389_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU185787_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFXPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707544_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707531_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779231_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GU563557_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU185789_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCXQFVG
GU563553_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
MF772345_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
MF772348_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQHFVG
MF772347_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
MF772344_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
MF772346_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
MF772350_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
DQ298161_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPNIHLQEDIIDRCQQFVG
DQ298163_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPNIHLQEDIIDRCQQFVG
DQ298164_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPNIHLQEDIIDRCQQFVG
DQ298165_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPNIHLQEDIIDRCQQFVG
KF779213_Pol_P-A      VSIPWTHKVGNVTGLYSSTVPIFNPEWKTPSFPKIHLQEDIINRCQQFVG
KF779215_Pol_P-A      VSIPWTHKVGNVTGLYSSTVPIFNPEWKTPSFPKIHLQEDIINRCQQFVG
AJ344115_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
GQ477464_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AY152726_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPKIHLQEDIINRCQQFVG
X51970_Pol_P-A        VSIPWTHKVGNFTGLYSSTAPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477502_Pol_P-A      VSIPWTHKVGNFSGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477499_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
AB205118_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707398_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AF090838_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCEQFVG
JQ707367_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707401_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477480_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AF090841_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB116076_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JF439767_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
JF439768_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
JF439769_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
JF439774_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
JF439777_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
JF440020_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
KT749839_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779234_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707358_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AY034878_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AF537372_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AJ627228_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749834_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749846_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749847_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749849_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707374_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477462_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779265_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLHEDIINRCQQFVG
KF779263_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707346_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477494_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPKIHLQEDIINRCQQFVG
AY233286_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB362931_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB014370_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPNIHLQEDIINRCQQFVG
X70185_Pol_P-A        VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KP995108_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707378_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707369_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707365_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707363_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707361_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707356_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707355_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707352_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLREDIINRCQQFVG
JQ707349_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707345_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707340_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707329_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477465_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AY738139_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB697511_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIINRCQQFVG
JQ707366_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707353_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707380_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707368_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707360_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707359_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707350_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707347_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707324_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707326_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707354_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707362_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707370_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JX096952_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707635_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707634_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707419_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707418_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707415_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707399_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707387_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707383_Pol_P-A      VSIPWTHKVGNFTGLYSSTEPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707377_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707371_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707364_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707357_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707348_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779316_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWKTPSFPQIHLQEDIINRCQQFVG
KF779311_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707587_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707351_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477504_Pol_P-A      VSIPWTHKVGNFTGLYSSKVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
GQ477466_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AY902775_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AY738143_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AY233280_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AF537371_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707375_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707391_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707406_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707397_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707373_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707376_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707379_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707381_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707382_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707384_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707385_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707386_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707388_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707389_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707390_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707392_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707393_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707394_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707396_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707400_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707402_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707403_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707395_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707404_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707405_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707407_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707408_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707409_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707410_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707411_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707412_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707413_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707414_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707416_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707417_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707420_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KX827294_Pol_P-A      VSIPWTHKAGNFTGLYSSTVPIFNPGWQTPSFPKIHLQEDIIHRCQQFVG
KF779259_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPRIHLQEDIINRCQQFVG
JQ707607_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707372_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707344_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB453983_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779320_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779314_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707653_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AF536524_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB453982_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIINRCQQFVG
AB064314_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779312_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIHRCQQFVG
KF779328_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIHRCQQFVG
KF779330_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIHRCQQFVG
KF779331_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIHRCQQFVG
KF779335_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779342_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIHRCQQFVG
KF779358_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIHRCQQFVG
KF779359_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIHRCQQFVG
KF779333_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779361_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPNIHLQEDIINRCQQFVG
KF779324_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779297_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779293_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779283_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779255_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPRIHLQEDIINRCQQFVG
JQ707630_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIINRCQQFVG
JQ707606_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707600_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707595_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707584_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707577_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GQ477486_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859934_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQIPSFPKIHLQEDIINRCQQFVG
EU859900_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIINRCQQFVG
EU594387_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AF143298_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AF090839_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLHEDIINRCQQFVG
EU859950_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779298_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779287_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779290_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779291_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779294_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779286_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779323_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779315_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779310_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINGCQQFVG
KF779304_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779325_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779258_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779337_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779338_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779339_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779360_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779262_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779256_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707599_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707332_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ687533_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPRIHLQEDIINRCQQFVG
EU747320_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KP718102_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWKTPSFPKIHLQEDIINRCQQFVG
KF779364_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPRIHLQEDIINRCQQFVG
KF779348_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779344_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779319_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779317_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779295_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779276_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779275_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779238_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707650_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707647_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707646_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707645_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707644_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707643_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707642_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707627_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707617_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707614_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707609_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707547_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707538_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707532_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707325_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB480036_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707622_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707625_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707628_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707629_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707631_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779321_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779386_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KP274925_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779378_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPNFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779363_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779362_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779268_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779257_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIINRCQQFVG
KF779254_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707674_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIIDRCQQFVG
JQ707661_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIIDRCQQFVG
JQ707605_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707601_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707596_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707594_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707572_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707545_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707554_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707555_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707556_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707563_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707564_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707565_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707336_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
GU563558_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIIDRCQQFVG
GQ477488_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU859924_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIINRCQQFVG
EU859920_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIINRCQQFVG
EU859911_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIINRCQQFVG
EU086721_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AM410963_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AM295797_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AM295795_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB697512_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB697509_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB697501_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB697492_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB697489_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB697488_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB697487_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB549213_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB246337_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
X02763_Pol_C-A        VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749825_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779379_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779326_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779251_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707672_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIIDRCQQFVG
JQ707549_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
HE576989_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIINRCQQFVG
EU859944_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
EU594384_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
AB697493_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB697495_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB775198_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB775199_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB775200_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB775201_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB937792_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB937793_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB937794_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707534_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707541_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707543_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707546_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707557_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707560_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707566_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707569_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707570_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
JQ707573_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779244_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779245_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779266_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779299_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779329_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779347_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
LC458430_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779385_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779371_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779350_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779355_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
LC458431_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779232_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPRIHLQEDIINRCQQFVG
AF090840_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
AB116078_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
LC311243_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPXFNPEWQTPSFPKIHLQEDIINRCQQFVG
KX827298_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KT749837_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIINRCQQFVG
KP274928_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIINRCQQFVG
KF779381_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQFVG
KF779272_Pol_P-A      VSIPWTHKVGNFTGLYSSSVPIFNPEWQTPSFPKIHLQEDIIDRCQQFVG
JQ707681_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIIDRCQQFVG
JQ707676_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIIDRCQQFVG
JQ707675_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIIDRCQQFVG
JQ707670_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIIDRCQQFVG
JQ707669_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIIDRCQQFVG
JQ707667_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIIDRCQQFVG
JQ707665_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIIDRCQQFVG
JQ707664_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIIDRCQQFVG
JQ707663_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIIDRCQQFVG
JQ707662_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPKIHLQEDIIDRCQQFVG
JQ707659_Pol_P-A      VSIPWTHKVGNFTGLYSSTVPIFNPDWQTPS