HBVdb

Dataset for protein SHBs of genotype A

[Download (right click)] [Edit] [Sequences] [Repertoires]

3349 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


GQ477477_SHBs_P-A      RENITSGFLGPLHVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY738139_SHBs_P-A      MENITLGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY738143_SHBs_P-A      MENITLGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY738140_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
AY738141_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
AY738142_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
AB453988_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCLG
AB786655_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
AB786656_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPVCLG
AF083638_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLG
AF132442_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLG
AF209399_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
AY232836_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLG
AY232838_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLG
DQ298164_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLG
AY232839_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLG
AY232840_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLG
DQ298163_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAHVCLG
DQ298165_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLG
FN547249_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY232837_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAHVCLG
AJ344115_SHBs_P-A      MENITSGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KU847632_SHBs_P-A      MENITSEFQEPLPVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439906_SHBs_P-A      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGPPVCLG
AF537372_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLRRILTIPQSLDSWWTSLSFLGGAPVCLG
AB116092_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
AY230117_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLG
DQ298162_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAHVCLG
KR139742_SHBs_P-A      RENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464809_SHBs_P-A      RENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLXGSPVCLG
FJ692555_SHBs_P-A      MENITSGFPGPLHVLQAGFSLLTRILTIPQSLDSWWTSLNFLEGSPVCLG
DQ995827_SHBs_P-A      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGTPVCLG
AB194953_SHBs_P-A      MENITSGFLKPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGESPVCLG
JF439910_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439900_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
AB076679_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVPPVCRG
KF771936_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
GQ477502_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLSFLGETPVCLG
FN547352_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
EU747320_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQILDSWWNSLNFLGGSPVCLG
EF690521_SHBs_P-A      MEPITSVFLGPLFVTQAGFFLSTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB222707_SHBs_P-A      MENITSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGPPVCLG
AY152726_SHBs_P-A      MENITSGFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY653781_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847730_SHBs_P-A      KENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPGCRG
KU847719_SHBs_P-A      MENITSGFLXPLPVLQAGFXLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KP165830_SHBs_P-A      MENIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
KM606928_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439908_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
JF439744_SHBs_P-A      MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
FN547306_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCRG
EF690535_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCRG
AY653777_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
AF297625_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB116089_SHBs_P-A      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGSPVCLG
AB116082_SHBs_P-A      MENITSGLLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB076685_SHBs_P-A      MENITSGFLGPXLVLQAGFFLLTRILTIPQSLDSWWTSLNFLEGSPVCLG
FM200195_SHBs_P-A      MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FM200204_SHBs_P-A      MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FN547349_SHBs_P-A      MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KY271384_SHBs_P-A      MENITSGLLGPLRVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCRG
KU847745_SHBs_P-A      MENITSXFLRPLLELQEGFFSLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847732_SHBs_P-A      MENITSGFLRPLRVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
KU847671_SHBs_P-A      MENITSGFLGPRLVLQAGFFLLTRIRTIPQSLDSWWTSLNFLGGSPVCLG
KU847662_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEPPVCPG
GQ477469_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGIPVCHG
GQ477463_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLG
GQ184323_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTFFHCLGGSPVCLG
FJ904434_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPPVCRG
FJ709471_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692586_SHBs_P-A      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF690525_SHBs_P-A      MENITSVFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ995822_SHBs_P-A      MENITSGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFIGGSPVCLG
AY161139_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
AF090842_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB453984_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCLG
AB076690_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
EU185789_SHBs_P-A      MENIXSGLLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPVCLG
EU185788_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGAPVCLG
EU185786_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGXPVCLG
EU185787_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPXNLDSWWTSLNFLGGAPVCLG
KY493902_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847749_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KU847726_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTILQSLDLWWTSLNFLGGSTVCLG
KJ958470_SHBs_P-A      MGNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF214659_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC875254_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707599_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
JQ514283_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604308_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
JN604302_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JN604195_SHBs_P-A      MENITSGFLRPLPVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGSPVCLG
JN182334_SHBs_P-A      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN182332_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439905_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439904_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439903_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439902_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439901_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439897_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439747_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439738_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439737_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439736_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439735_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439724_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439723_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
FN547348_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FN547324_SHBs_P-A      MENTTSELLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FM200193_SHBs_P-A      MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FM200183_SHBs_P-A      MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
EU594386_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF690520_SHBs_P-A      MENITSRFLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLNFLGGSPVCLG
DQ412537_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCLG
DQ412446_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPTVCLG
AF208866_SHBs_P-A      MENITSGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLSFLGGSHVCLG
AF083637_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB786660_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH347491_SHBs_P-A      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGVPHVCRG
KY809906_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809881_SHBs_P-A      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGSPVCRG
KX357646_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847697_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGESPVCLG
KR905427_SHBs_P-A      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLEGSPVCLG
KR816137_SHBs_P-A      MENITSKFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165834_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
KP165831_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
KM606941_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVSPVCRG
KM606794_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KM606793_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KM590921_SHBs_P-A      MENITSAFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPVCLG
KF862524_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779384_SHBs_P-A      MENITSGFLGPLLVLQERFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779298_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGSPVCLG
KF771958_SHBs_P-A      MENITSEFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707589_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
JQ514287_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983903_SHBs_P-A      MENITSKFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCRG
JN983855_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604241_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439990_SHBs_P-A      MENITSGLPGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439751_SHBs_P-A      MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
JF439739_SHBs_P-A      MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
JF439734_SHBs_P-A      MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
JF439731_SHBs_P-A      MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
JF439730_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439726_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
HE652716_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
HE652711_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
HE652708_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
HE652705_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
EU859950_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGSPVCLG
EF690519_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGSPVCLG
EF547855_SHBs_P-A      MENITSRFLKPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
DQ995813_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412474_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGSPVCLG
DQ412460_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412448_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPPVCXG
AY653794_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF134134_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF083636_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809534_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809484_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB786647_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB300367_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB246336_SHBs_P-A      MENITSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB116090_SHBs_P-A      MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB116086_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB116076_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
AB076687_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQNLDLWWTSLNFLGGSPVCLG
MH464823_SHBs_P-A      RENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809910_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY493900_SHBs_P-A      MENISSGFLGPXLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847696_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXSPVCRG
KU847584_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847573_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIQQSLDSWWTSLNFLGGSPVCLG
KU711606_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVSPVCLG
KU711604_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT366467_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGESPVCLG
KR905426_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGESPVCLG
KP165704_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM983569_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM983563_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707536_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGSPVCLG
JQ514399_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ514391_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983845_SHBs_P-A      MENITSRFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439907_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439899_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439898_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
HE652707_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
GQ486419_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSXWTSLNFLGGSPVCLG
GQ477494_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477473_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGVPPECLG
GQ325792_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
FR821990_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FJ692606_SHBs_P-A      MENITSGFXXPPLVLQAGSFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ665816_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
EU859955_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859934_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ995829_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412511_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AJ627227_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILIIPQSLDSWWTSLSFLGGSPVCLG
JN226069_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCXG
JX849598_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCXG
U88095_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512455_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464820_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464810_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH272596_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCHG
KY809899_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPTVCLG
KY493896_SHBs_P-A      MENITSRFLGPLLGLQXGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY353901_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX648543_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520693_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847766_SHBs_P-A      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847761_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
KU847744_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847713_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847699_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSSLGGLPVCLG
KU847677_SHBs_P-A      MENITSGFLGPLLALQAGFFLLTRILTIPQXLDSWWTSLNFLGGSPVCLG
KU847676_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KU847666_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGSPVCLG
KU847663_SHBs_P-A      MENITSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLSFLGDLPVCHG
KU847649_SHBs_P-A      MENITSGFLGPLLVLQAGXFLLTRILTIPQNLDSWWTSLSFRGEPPVCLG
KU847637_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLSFLGGAPVCLG
KU847609_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KU847587_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847555_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847504_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTITQSIDSWWTSLNFLGGSPVCLG
KU847490_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847474_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGEPPVCLG
KT630630_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGXSPVCLG
KT630624_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPVCLG
KT630617_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR816149_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR816143_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR816128_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR816126_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR816114_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP997447_SHBs_P-A      MENITSKFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP168429_SHBs_P-A      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165832_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGESTVCLG
KP165827_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
KP165735_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
KM983578_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM983564_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM983562_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606904_SHBs_P-A      MENITSGFLGPQLVLQAGFSLLTRILIIPQSLDSWWTSLNFLGGSPVCLG
KM606873_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606706_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854698_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854689_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854686_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854685_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922421_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922420_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922419_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922418_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922417_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922416_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922415_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922414_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922409_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLARILTIPQSLDSWWTSLNFLGGSPVCLG
KF862520_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779263_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGSPVCLG
KF771960_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476024_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476022_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476018_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF214657_SHBs_P-A      MENITSGFLGPLLVLQEGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849301_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ811855_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707592_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
JQ707590_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
JQ707586_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
JQ707585_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
JQ707576_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
JQ514501_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514392_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ514297_SHBs_P-A      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514292_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514290_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514280_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983898_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983847_SHBs_P-A      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGSPVCLG
JN983839_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983834_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSLWTSLSFLGGSPVCLG
JN604237_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604220_SHBs_P-A      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLSFLGGTPECLG
JN604193_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGESPVCPG
JN182333_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN182328_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439909_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439896_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU799052_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU798998_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486119_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486077_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGXAPVCLG
GQ486076_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486062_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPPVCLG
GQ477501_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGSPVCLG
GQ477497_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
GQ477491_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
GQ477486_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477484_SHBs_P-A      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477478_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477466_SHBs_P-A      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ222207_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ184324_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547342_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
FN545840_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPPVCRG
FN295508_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN295503_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FM200199_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FM200187_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
FM200182_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
FM200180_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ709472_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692613_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692611_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLIRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692610_SHBs_P-A      MENITSGSLGPLLVLQAGFFLWTRILTIPQSLDSWWTSLNFLGESPVCLG
FJ692609_SHBs_P-A      MENITSGSLGPLLVLQAGFFLWTRILTIPQSLDSWWTSLNFLGESPVCLG
FJ692585_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692584_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692583_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692582_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692581_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692580_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692579_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692578_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859900_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLRGSPVCLG
EU594391_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGSPVCLG
EU054331_SHBs_C-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF690533_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF690531_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF690528_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCLG
EF547851_SHBs_P-A      MENITSGFLGPLLVLQAGSFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547837_SHBs_P-A      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547832_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547830_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547829_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547828_SHBs_P-A      MENIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF208113_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF103278_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
DQ995834_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
DQ459086_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412548_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412541_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412534_SHBs_P-A      MENITSGFLGPLLVVQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412528_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412523_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412522_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412517_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412501_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY738812_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512458_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
MG383607_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF979151_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
LT992441_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809930_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KY809924_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809889_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPVCRG
KY809885_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY660207_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KY353876_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372089_SHBs_P-A      MENITSGLLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847508_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630607_SHBs_P-A      MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR816131_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGSPVCLG
KR816111_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGSPVCLG
KP165833_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGESTVCLG
KP165829_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGESTVCLG
KP165828_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESTVCLG
KP165826_SHBs_P-A      MENITSGFLGPQLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165825_SHBs_P-A      MENITSGFLGPQLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGSLVCLG
KM983579_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM983568_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGSPVCLG
KM606925_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KM606860_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
KM606783_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606766_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779264_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF771920_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
KF476026_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF475991_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGSPVCLG
KC885810_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JX849315_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
JX310723_SHBs_P-A      MENITSALLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707532_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514397_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514295_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514285_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983850_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604290_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCPG
JN604136_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439964_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGSPVCLG
JF439820_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWISLNFLGGSPVCLG
JF439748_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
JF439746_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
JF439745_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
JF439743_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439742_SHBs_P-A      MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
JF439729_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439722_SHBs_P-A      MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
JF439720_SHBs_P-A      MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
HM535200_SHBs_P-A      MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HE652718_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
HE652715_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
HE652713_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
HE652712_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
HE652710_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
HE652709_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
HE652704_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLD
GQ486772_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPPVCRG
GQ486642_SHBs_P-A      MENITSGFXGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
GQ477464_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FR821994_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FR821993_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FR821992_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FR821991_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FR821989_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FR821988_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FN547273_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
FN545832_SHBs_P-A      MENITSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXHVCLG
FN545830_SHBs_P-A      MENITSGXLGXLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCHG
FN295528_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN295518_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FM200198_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ665815_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF690534_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF690532_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF690523_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF690522_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF690518_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547835_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ788725_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412447_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
U87733_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH347489_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH272667_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
MF979152_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF979144_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
MF925373_SHBs_P-A      MENITSGFPGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
LT992448_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KY809934_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809933_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809917_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809916_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809914_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809904_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KY809900_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809894_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWLTSLNSLGGSPVCLG
KY809890_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCRG
KY353934_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY353905_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPVCLG
KY271378_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX648545_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
KX372058_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KX372054_SHBs_P-A      TENITSGFLGPLXVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
KX302129_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGESPVCRG
KU847747_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847742_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
KU847738_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPGCLG
KU847722_SHBs_P-A      MENITSGFPGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847709_SHBs_P-A      MENITSGSLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847705_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCRG
KU847700_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847695_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KU847583_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847575_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPPVCRG
KU847527_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGSPVCLG
KU847486_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCRG
KU847481_SHBs_P-A      MENITSGFXGPLLVLQXGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU711607_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630608_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KT366621_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT366620_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT366516_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT235599_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR816141_SHBs_P-A      QENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR816140_SHBs_P-A      KENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR816109_SHBs_P-A      QENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR816101_SHBs_P-A      QENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP997998_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP997723_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718086_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP168424_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165783_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165706_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM983574_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
KM606964_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGSPVCLG
KM606957_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606912_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606876_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
KM606819_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ958464_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ958454_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ958453_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854701_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922430_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
KF922429_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
KF922408_SHBs_P-A      MENITSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF862522_SHBs_P-A      MENITSGFLGLLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KF779336_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGSPVCLG
KF779252_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLKLLGGSPVCLG
KF475995_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
JX849603_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGGTPVCLG
JX849306_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
JQ811853_SHBs_P-A      MENITSGFQGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707378_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGSPVCLG
JQ514401_SHBs_P-A      MENITSGFLKPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514398_SHBs_P-A      MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514385_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514384_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983873_SHBs_P-A      XENITSGFLRPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
JN226084_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGGTPVCLG
JF439977_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM467774_SHBs_P-A      MENITSGFRGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM101121_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486775_SHBs_P-A      MENITSGXLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCXG
GQ486456_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486425_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486416_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXSPVCRG
GQ486368_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
GQ486317_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486253_SHBs_P-A      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
GQ486209_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ325765_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ325764_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547364_SHBs_P-A      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
FN547363_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVPPVCXG
FN547346_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547340_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547336_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN545834_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN545826_SHBs_P-A      MENITSGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FM200214_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FM199981_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859956_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859954_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859951_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859945_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU366129_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547848_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412540_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412532_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412516_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412508_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY653779_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
X75669_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
X04820_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
U91810_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
U87736_SHBs_P-A        MENITSGFLGPLLLLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
U87728_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
U87727_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512477_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512476_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512475_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512473_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512472_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512470_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512469_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512468_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512467_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGSPVCLG
MK512466_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512465_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512464_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512461_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512460_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512459_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512457_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512456_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK127856_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK127854_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK127848_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464828_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464816_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464815_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464812_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464811_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH272679_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH272552_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH272532_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF979146_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF979143_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF925407_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF925400_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF925385_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF925368_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF925361_SHBs_P-A      MENITSGFLKPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF772351_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
M21030_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
LT992440_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809936_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809932_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809927_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KY809926_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809921_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
KY809920_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809919_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809918_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809915_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809913_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809912_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXSPVCLG
KY809909_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809907_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KY809898_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809896_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGSPVCLG
KY809888_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809880_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY697834_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY660215_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY493814_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KY382410_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY353904_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY353902_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY353890_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY353882_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY353877_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY271385_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY271377_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY213953_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX648548_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX648546_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX648544_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
KX520706_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520705_SHBs_P-A      MENVTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520704_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520703_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520702_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520701_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520700_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520699_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520698_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520697_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520696_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520695_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520694_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520692_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520691_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520690_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520689_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520688_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520687_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520684_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520680_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520679_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520678_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520677_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520675_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372099_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372084_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSTVCLG
KX372083_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372052_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372030_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372029_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX357650_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX357647_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX357645_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX357644_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX357643_SHBs_P-A      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX357642_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX302133_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX302130_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KX302106_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
KX302095_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGSPVCLG
KX264659_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264658_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264657_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264656_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264655_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264654_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264653_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264652_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264651_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264650_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264649_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264648_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264647_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264646_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264645_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264644_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264643_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264642_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264641_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264638_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264633_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264632_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264629_SHBs_P-A      MENITSGFLGPXLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264628_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264627_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264626_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264625_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264624_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264623_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264622_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264621_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264620_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264614_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264612_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264611_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264610_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264607_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264606_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264605_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264604_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264603_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264601_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264598_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264597_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264596_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX264595_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU900754_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU900753_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU900751_SHBs_P-A      MENITSGFLGPLLALQAGFFLLTSILTIPQSLDSWWTSLNFLGGSHVCLG
KU847769_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847765_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847764_SHBs_P-A      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847762_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847760_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847759_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847757_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847756_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847755_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847754_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847751_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847750_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847743_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847734_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847733_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847731_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847727_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847725_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847721_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847717_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
KU847716_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847712_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847711_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILXIPQSLDSWWTSLNFLGGSPVCLG
KU847707_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847704_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847703_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847702_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGXSPVCLG
KU847701_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGESPVCLG
KU847698_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847691_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGSPVCLG
KU847690_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGSPVCLG
KU847687_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847683_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847682_SHBs_P-A      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847670_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847667_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847660_SHBs_P-A      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847658_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWXTSLNFLGGSPVCLG
KU847654_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KU847645_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
KU847643_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847642_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847641_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSHVCLG
KU847640_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847638_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847636_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847626_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847625_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847622_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847615_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847607_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847604_SHBs_P-A      MENITSGFLGPXLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXSHVCLG
KU847594_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847588_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847582_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847572_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847570_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847563_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847559_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847557_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGESPVCLG
KU847553_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847546_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847543_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847542_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847539_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847531_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGSPVCLG
KU847517_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847514_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847506_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPPVCXG
KU847501_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847500_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847499_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847495_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847494_SHBs_P-A      MENITSGFLGPLLVLQXGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847478_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847475_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU736920_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU736918_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU605539_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU605538_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU605537_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU605536_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU605535_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU605534_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU605533_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630639_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630638_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630636_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630635_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630628_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630627_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630621_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630615_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630611_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630609_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT366628_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT366619_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT366517_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT366470_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT366469_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT366468_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT347092_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT347091_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT347088_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT347087_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT235614_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT235608_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT235600_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT235598_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT235593_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT201168_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT201167_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGSPVCLG
KT201166_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT201165_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT201161_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT201158_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT151615_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT151614_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT151611_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR905431_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR905430_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR816150_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR816146_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR816145_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGSPVCLG
KR816139_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR816130_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR816127_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR816123_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR139743_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP997730_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP997676_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718085_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP168434_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP168433_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP168432_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP168428_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP168423_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP168422_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165799_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165790_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KP165777_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165738_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165692_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165658_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165634_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165629_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM983575_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
KM983572_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
KM983570_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGESPVCLG
KM983567_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
KM983566_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
KM606930_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606927_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606864_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606832_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606826_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606788_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606780_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KM606774_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606770_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606748_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606737_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606701_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGSPVCLG
KM590919_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM590909_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM590908_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ958468_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ958467_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ958461_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ958459_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ958448_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ958443_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854707_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854706_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854705_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854704_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854703_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854702_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854700_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854699_SHBs_P-A      MENITSGFLGPLLLLQAGFFLLTRILTIPQSLDSWWTSLNFXGGSPVCLG
KJ854697_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854696_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854695_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854694_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854693_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854692_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854690_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854688_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854687_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ843183_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ194506_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ010778_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ010777_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ010776_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922437_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922436_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922435_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922434_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922433_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922428_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922427_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922426_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922425_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922424_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922407_SHBs_P-A      MENITSGFLGPLLVLRAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF922406_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF862523_SHBs_P-A      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF862519_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF862518_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF771967_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476027_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476025_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476023_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476021_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476017_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476016_SHBs_P-A      MENVTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF214666_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
KF214665_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF214663_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF214661_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF214660_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF214658_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF170754_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC885725_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC885659_SHBs_P-A      MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC875256_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC875255_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC875253_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC875252_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849323_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849314_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849297_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX154582_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX154581_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX154580_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX154579_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX125368_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGESTVCLG
JQ811888_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ811863_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ811860_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ811859_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ811858_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ811857_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ811856_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ811854_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514533_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514532_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514531_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514507_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514506_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514504_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514502_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514405_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514400_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514395_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514394_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514390_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514389_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514388_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514387_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514383_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514382_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514381_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGSPVCLG
JQ514380_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514294_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514291_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514288_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514286_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514284_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514282_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514281_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983909_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983905_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983902_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983900_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983899_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983897_SHBs_P-A      MENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983896_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983895_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983894_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983893_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983890_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
JN983888_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983884_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983883_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983882_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983880_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
JN983878_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983876_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983875_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983874_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983872_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983871_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983870_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983869_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983866_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983865_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983864_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983860_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983857_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983856_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983854_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983852_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXSPVCLG
JN983851_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983846_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGSPVCLG
JN983844_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983842_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983840_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983838_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983837_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983836_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983833_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983831_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
JN604261_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604260_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604252_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604251_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604230_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGSPVCLG
JN604217_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGSPVCLG
JN604171_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604169_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604156_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604155_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGSPVCLG
JN604145_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
JN182331_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN182330_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN182329_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN182327_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN182326_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN182325_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN182324_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN182323_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN182322_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN182321_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN182320_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN182319_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN182318_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN132119_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439943_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF298903_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HQ840709_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM772997_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM772996_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM772995_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM772994_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM535205_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM363612_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM101124_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM101123_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM101120_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM101119_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM101118_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM101117_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM101116_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM101115_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU799030_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU799025_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU799020_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
GU799009_SHBs_P-A      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU799004_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU798976_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU798964_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU563548_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU563547_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU563545_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486718_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486693_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486557_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486550_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486549_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486544_SHBs_P-A      MENVTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486514_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486510_SHBs_P-A      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486490_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486482_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486479_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486478_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486474_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486469_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486461_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486454_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486439_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486438_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486424_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486417_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486415_SHBs_P-A      MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486410_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486409_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486391_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGGSTVCPG
GQ486389_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486360_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486312_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486271_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486225_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGSPVCLG
GQ486203_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486148_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486143_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486130_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGSPVCLG
GQ486104_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGSPVCLG
GQ486103_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486092_SHBs_P-A      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486063_SHBs_P-A      MENVTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477504_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477503_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477498_SHBs_P-A      MENITSGFLGPQLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477496_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477488_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477487_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477480_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGESPVCLG
GQ477479_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
GQ477475_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
GQ477472_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGSPVCLG
GQ477468_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477467_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477465_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477462_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477461_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ414522_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ325786_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ325776_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ161813_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547343_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547341_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547321_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547312_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547309_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547308_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547305_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547238_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547235_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547216_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN545833_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN545831_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN295534_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN295533_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN295532_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN295531_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN295530_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FM200207_SHBs_P-A      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FM200203_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FM200202_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FM200201_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FM199979_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FM199978_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FM199977_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FM199976_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGSPVCLG
FM199975_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWXTSLNFLGGSPVCLG
FM199974_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ709470_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692608_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692607_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692605_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGXSPVCLG
FJ692604_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692603_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGSPVCLG
FJ692602_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692601_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692599_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692598_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGSPVCLG
FJ692597_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692596_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692595_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692592_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692591_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692590_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692588_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692577_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692576_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692574_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692571_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692566_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
FJ692563_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692559_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
FJ692558_SHBs_P-A      MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692557_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ349224_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ349222_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859953_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859949_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859948_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859947_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859946_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859944_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859943_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859942_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859941_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859940_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859939_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859938_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859937_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859936_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859935_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859933_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859932_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859931_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859930_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859929_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859928_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859927_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859926_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859925_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859924_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859923_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859922_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859921_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859920_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859919_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859918_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859917_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859916_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859915_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859914_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859913_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859912_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859911_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859910_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859909_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859908_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859907_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859906_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859905_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859904_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859903_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859902_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859901_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859899_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859898_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU594395_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU594394_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU594393_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU594392_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU594390_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU594389_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU594388_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU594387_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU594385_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU594384_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU594383_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU414133_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU414132_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU414103_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU414102_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU410082_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU159676_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU086721_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF690530_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF690529_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSHVCLG
EF690527_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF690526_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF690524_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF690517_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547853_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547850_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547849_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547847_SHBs_P-A      MENITSGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547846_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547845_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547844_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547843_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547842_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547841_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547840_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547839_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547838_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547834_SHBs_P-A      MENITSGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547833_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547831_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGSPVCLG
DQ412557_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412556_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412555_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412554_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412553_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412552_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412550_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412549_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412547_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412546_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412545_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412544_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412543_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412539_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412535_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412533_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412531_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412530_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412529_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412526_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412525_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412524_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412521_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412520_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
DQ412518_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412515_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412514_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412513_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412512_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412510_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412509_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412507_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412506_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412505_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412503_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412502_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
DQ412500_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412499_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412498_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412496_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412494_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412493_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412492_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412491_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412490_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGSPVCLG
DQ412489_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK127850_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGSPVCLG
MH464825_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGSPVCLG
KX372074_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLXFLGGSPVCLG
KU847675_SHBs_P-A      MENITSGFLGPLLVLQAGFFXLXXILTIPQSLDSWWTSLNFLGGSPVCLG
KU711605_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749822_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGSPVCLG
KP997624_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165807_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165651_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606933_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606924_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606903_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606784_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSTVCLG
KF771962_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849307_SHBs_P-A      MENITSGFLGXLXVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
JQ514393_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983901_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGESPVCLG
GQ477493_SHBs_P-A      MENITSGFLEPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSHVCLG
GQ477490_SHBs_P-A      MENITSGVLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN545837_SHBs_P-A      MENXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ904411_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH272586_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
KX372057_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
KX264631_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847657_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXXPVCLG
KU847656_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KU847554_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGSPVCLG
KU847487_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXSPVCLG
KT235603_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT151617_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT151612_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP168431_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP168426_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC836781_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604165_SHBs_P-A      MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGPXVCLG
GQ486683_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486232_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
GQ486213_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547334_SHBs_P-A      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGSLVCLG
FN545839_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN545835_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN545829_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN545828_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ349296_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU414104_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412497_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372104_SHBs_P-A      MENITSGFLXPXLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGSPVCLG
KX264635_SHBs_P-A      MENITSGFLXXLLVLQAGFFLLTRILTIPQSLDSWWXSLNFLGGSPVCLG
KU847664_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGXSPVCLG
KP168430_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165785_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXSXVCLG
KP165685_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF862525_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGPPVCLG
KF862521_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGEXPVCRG
JN604305_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
GQ486205_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486182_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCRG
KX372090_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSXLGGPXVCLG
KP165753_SHBs_P-A      MENITSGFLGPLLVXQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486249_SHBs_P-A      MENITSGXLGXLLVLQAGFFLLTRILTIPQSLDSWWTSLSXLGGSPVCLG
KX372049_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
KX372081_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
DQ412486_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547355_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGSPVCLG
GQ486770_SHBs_P-A      MENITSGLLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGXPVCXG
KU847530_SHBs_P-A      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KX276769_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGXSPVCLG
KU847564_SHBs_P-A      MENITSGFLGPLLVLQAGXFLLTRILTIPQSLDLWWTSLNFXGGSPVCLG
KU847617_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCXG
JQ707608_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
JF439732_SHBs_P-A      TENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JF439733_SHBs_P-A      TENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
EF547856_SHBs_P-A      MEDITSGFLGPLLVLQAGYWELTRILTIPQSLFSGWTSLNFLGGSPVCLG
JQ514293_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCPG
FM200216_SHBs_P-A      MENTTSGFLGPLLVLQAGCFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FM200185_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY653776_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSLWTSLNFLGEAPVCLG
AY233282_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU859952_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPACLG
GQ331047_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPACLG
MK512462_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KY809887_SHBs_P-A      TENITSGFLGPLLVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KU847688_SHBs_P-A      TENITSGFLRPLHVLQAGFXXLTRILTIPQSLXSWWTSLNFLXGSPVCLG
JQ023661_SHBs_P-A      MENITSGFLGPLLVLQAGCFLLTKILTIPQSLDSWWTSLNFLGGAPGCLG
FM200188_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412469_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGGAPVCLG
AB786663_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
AB786661_SHBs_P-A      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPAVCLG
KU847672_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSHSFLGXAPVCXG
KU847768_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSHSFLGXAPVCXG
KP165671_SHBs_P-A      MENITSGFLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
JF439721_SHBs_P-A      MEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
DQ412456_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ298161_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRIPTIPQSLDSWWTSLSFLGEAPVCPG
AY161143_SHBs_P-A      MEDITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY161144_SHBs_P-A      MEDITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF297622_SHBs_P-A      IENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB246317_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
AB116094_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK127858_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
MH464817_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
KR816115_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ023660_SHBs_P-A      MENITSGFLGPLLVLQAGCFLLTKILTIPQSLDSWWTSLNFLGGPPGCLG
FN295511_SHBs_P-A      MENITSGSLGPLLVLQAGFFWLTRILTIPQSLDSWWTSLNFLGGSPVCRG
FJ692572_SHBs_P-A      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGPPVCLG
AY233287_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY233285_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB116084_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
MK512463_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KU847681_SHBs_P-A      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPVCLG
KR905429_SHBs_P-A      MENITSGFLGPLLALQAGFFLLTKILTIPQSLDLWWTSLNFLGGSPVCLG
GQ331046_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGPPVCLG
FM200189_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692554_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF690536_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
DQ412449_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
AY738815_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY653793_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
AY653778_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
AY233290_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFPGGPPVCLG
AY233284_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
AB809477_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTPVCLG
AB453989_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLEGATVCLG
AB453986_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPPVCPG
AB194952_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLG
AB116088_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPGCLG
AB030513_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB076678_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB076680_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB076681_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB076682_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB076683_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB076686_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB076688_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB116083_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB116087_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB194950_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB241114_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB241115_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB786643_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB786645_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB786646_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB786648_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB786649_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB786651_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB786652_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB786654_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB786659_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB937791_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809901_SHBs_P-A      MENITSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY271379_SHBs_P-A      MENTSSGPLVPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847680_SHBs_P-A      MENITSGLLGPLLALQAGFFLLTKILTIPQNLDSWWTSLSFLGEPPVCLG
KU847629_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KU847614_SHBs_P-A      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCHG
KF214662_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514500_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JN983867_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRIRIIPQSLDSWWTSLSFLGGAPVCLG
JN983861_SHBs_P-A      MENITSGFLEPQLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPRVCPG
JN983832_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486686_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
FN547326_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGAPVCLG
FN547315_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
EF547854_SHBs_P-A      MERLTSGFLGPLLVLQAGSLLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412487_SHBs_P-A      MENITSGFLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412476_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412475_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412455_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGGPPVCLG
DQ412451_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412445_SHBs_P-A      MENITSGFLKPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
DQ412443_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY934764_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
AY934763_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY738814_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY738811_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY738808_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY738804_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY653780_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY233278_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
AM180624_SHBs_P-A      MENITSGFLKPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF083635_SHBs_P-A      MENITSGYLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809486_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
AB786662_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLG
AB786658_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
AB786657_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
AB453987_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
AB116085_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847651_SHBs_P-A      XENITSGSLXPLXVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847652_SHBs_P-A      XENITSGSLGPLRVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK127860_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KY809908_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809883_SHBs_P-A      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGEPPVCHG
KY353875_SHBs_P-A      MENITSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSHVCLG
KX302113_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPPACLG
KM606797_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPPVCPG
JQ514296_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JN983904_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPGCLG
JN983859_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPECRG
JN983848_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCIG
JN983835_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGAAPVCPG
FM200186_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ692573_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGSPVCLG
EF690515_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412478_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGDPPVCPG
DQ412471_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412464_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGITVCLG
AY934772_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
AY233289_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY233288_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY233283_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY233281_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY233279_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY233276_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY233275_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY233274_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY161142_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AM494718_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AM184126_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AM184125_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF297621_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF043560_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB937796_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK512471_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
MG839207_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFPGGPPVCLG
MG839206_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFPGGPPVCLG
MG839203_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFPGGPPVCLG
MF979153_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KY809937_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGPPVCLG
KY809928_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KY353897_SHBs_P-A      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGPHVCLG
KX648547_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX357649_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KX302105_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPPVCLG
KU847767_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGPPVCLG
KU847737_SHBs_P-A      MENITSGFLGPLLGLQAGFSLLTRILTIPQSLDSWWTSLNFRGGAPVCLG
KU847710_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVPHVCLG
KU847706_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGDPPVCLG
KU847693_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KU847639_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGPPVCLG
KU847631_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFQGGPPVCLG
KU847630_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGSPVCLG
KU847601_SHBs_P-A      MENITSGFLXPLXVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847578_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KU847538_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KU847533_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KU847473_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCPG
KT630616_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCPG
KR816151_SHBs_P-A      QENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCPG
KR816148_SHBs_P-A      QENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCPG
KR816133_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGDSPVCLG
KR816119_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCPG
KR816118_SHBs_P-A      QENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCHG
KR816110_SHBs_P-A      QENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCPG
KP165647_SHBs_P-A      MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWLTSLSFLGGSPVCHG
KM983573_SHBs_P-A      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEPPVCLG
KM606900_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KM590923_SHBs_P-A      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLSFLGGPTVCLG
KM519453_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM519452_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854691_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KF476020_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KC875257_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ811862_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPLCLG
JQ811861_SHBs_P-A      MENISSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSHVCLG
JQ514386_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JN983887_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCHG
JN983885_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCCG
JN983863_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPPVCLG
JN604186_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGSHVCLG
JN604128_SHBs_P-A      MENXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCHG
HQ185229_SHBs_P-A      MESTSSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
HM101122_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
HM101114_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
HM101113_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
GU798993_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
FN547338_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FN547166_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FN547157_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
FN545838_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FM200215_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
FM200181_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPXVCLG
FJ692567_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
FJ692565_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
FJ692564_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
FJ692561_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPHVCLG
EF690516_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
DQ412488_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGSPVCLG
DQ412457_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY903452_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
AB246335_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
AB116093_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCXG
AB116091_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCXG
KU847650_SHBs_P-A      --NITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY934773_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113365_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113366_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113367_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113369_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113370_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113372_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113373_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113374_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113376_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113377_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113378_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113379_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113380_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113387_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113388_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113390_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113391_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113392_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113396_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113397_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MG839201_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MG839204_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
U87735_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK127853_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
MH464830_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464829_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464827_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464826_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464824_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464822_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464821_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464819_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464818_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464814_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH464813_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MG839205_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
MG839202_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
MF925372_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
M57663_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
LC051141_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KY809931_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KY809922_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KY809886_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KY493873_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY493811_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KU847763_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KU847748_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KU847684_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KU847646_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFQGGAPVCLG
KU847605_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KU847589_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPVCLG
KU847585_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KU847565_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPVCLG
KU847548_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KU847526_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KU847520_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KU847497_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KU847489_SHBs_P-A      MENITSGXLGPLLXLQAXFFXLTRILTIPQSLDSWWTSLXFLGGXPVCLG
KT630642_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGAPVCLG
KT630641_SHBs_P-A      MXNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630637_SHBs_P-A      MXNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630612_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM983576_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM983571_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM983565_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
KM606923_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606707_SHBs_P-A      MKIITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGSPVCLG
JQ514396_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ514289_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ023663_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JN983907_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983892_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JN983889_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JN983881_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN983877_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JN983862_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JN983858_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JN983841_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JN604163_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCFG
HM363613_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
HM011485_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU799047_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
GU799040_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
GU798978_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486194_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPVCLG
GQ486156_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FN547335_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FN547331_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FN547330_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPVCLG
FN547329_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FN547328_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FN547327_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FN547325_SHBs_P-A      MENXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FN547291_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
FN547244_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547228_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPVCLG
FN545836_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FN545825_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPVCLG
FM199980_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547852_SHBs_P-A      MENITSGFLEPQLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF547836_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412485_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412484_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412483_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412481_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412480_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412479_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412477_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGAPVCLG
DQ412473_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412472_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
DQ412470_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412468_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLXFLGGSPVCLG
DQ412467_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
DQ412465_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412462_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412461_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412459_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412458_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412453_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412452_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412450_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ315786_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ315785_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ315784_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
DQ299404_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ299401_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ020003_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ020002_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY934774_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY934771_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY934770_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
AY934769_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY934768_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY934767_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY934766_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
AY934765_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY738813_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY738810_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY738809_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY738807_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
AY738806_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
AY576429_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY373432_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY373429_SHBs_P-A      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY373428_SHBs_P-A      MENITSGFLGPLLVLQAGFYLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486437_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGSPVCLG
FN547360_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
AB937795_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692612_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692575_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
JN604150_SHBs_P-A      MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFPGVXPVCLG
KU847665_SHBs_P-A      --NITSGFLGPLXVLQAGFXLLTRILTIPQSLDXWWTSLNFLGGXXVCLG
KU847635_SHBs_P-A      --NITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX648549_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPXCLG
KX264594_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPXCLG
KU847685_SHBs_P-A      MENITSGFLGPLLVLQXGFFLLTXILXIPQSLDSWWTSLNFLGGAPVCLG
KU847511_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGXPVCLG
KU847503_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILXIPQSLDSWWTSLXFLGXXPVCLG
GQ486287_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KT151613_SHBs_P-A      MEXXXXXFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847758_SHBs_P-A      MENITSXFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK127851_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
MH464808_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KU847655_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXXPVCLG
KU847560_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847551_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KT630631_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KT201164_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KP168425_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
JQ514505_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
GU799039_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547344_SHBs_P-A      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
FJ692600_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692562_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KX372085_SHBs_P-A      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLXXXPVCLG
KX264640_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY303900_SHBs_P-A      MESITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGXPVCLG
KC875258_SHBs_P-A      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547314_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547320_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FN547322_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847752_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847708_SHBs_P-A      MENTTSGFLGPLLGLQAGFSLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH272668_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486838_SHBs_P-A      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847661_SHBs_P-A      MENITSGXLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847659_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH580643_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH580642_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH580639_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH580627_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH272675_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF772353_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY353879_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
KX372088_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749831_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT201159_SHBs_P-A      MENITSGFLGPLXVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT366471_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486535_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCXG
GQ486828_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCXG
KP168435_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCXG
KU847544_SHBs_P-A      MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDXXWTSLXFLGXSPVCXG
KU847692_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCXG
AF209392_SHBs_P-A      MENITSGFLGPLPVLQAGFFLLTRIHTIPQSLDSWWTSLNFLGGSPVCLG
X51970_SHBs_P-A        MENITSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB076689_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KF771953_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606765_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPHVCLG
KF771957_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTKILTTPQSLDSWWTSLNFLGGSPVCLG
JF439872_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF065111_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606950_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606809_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSSLGGSPVCLG
JQ707547_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSLWTSLNFLGGSPVCLG
JF439875_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
JF439874_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439873_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
JF439871_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439870_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
JF439869_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697487_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT366466_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR905425_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779365_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477495_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF771968_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486369_SHBs_P-A      MENITSXFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477500_SHBs_P-A      MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606952_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606940_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707541_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ477482_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165703_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF475993_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLARILTIPQSLDSWWTSLNFLGGSPVCLG
JX849305_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486807_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165720_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849300_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486611_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486408_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ325768_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLXKILTIPQSLDSWWTSLNFLGGSPVCLG
GQ325766_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLXXILTIPQSLDSWWTSLNFLGGSPVCLG
GQ325767_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLXKILTIPQSLDSWWTSLNFLGGSPVCLG
JF439876_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439877_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439878_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439879_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439880_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439881_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439882_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439883_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB194951_SHBs_P-A      MENITSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AF208873_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809485_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFPEGTPACLG
AF083639_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLG
DQ412495_SHBs_P-A      MENITSGFLGPLLVVQAGFFLLTRILTIPQSLDSWWTSLNFXGXSPVCHG
DQ412519_SHBs_P-A      MENITSGFLGPLLVVQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCHG
KF771956_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEVPVCRG
AJ309369_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLGSWWTSLNFLGGSPVCLG
KX372101_SHBs_P-A      MENITSGFLGPLHVLQEGFFSLTRILTIPQSLDSWWTSLNFLGEAPVCLG
KP165820_SHBs_P-A      MENITSGFLGPQLVSQAGFSLLTRILAIPQSLDSWWTSLNFLGGAPVCLG
JQ023662_SHBs_P-A      MENITSGFLGPLLVLQAGCFLLTKILTIPQSLDSWWTSLNFLGGPPGCPG
AF083634_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606803_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
AF134144_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF132443_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLG
AB064314_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPGCLG
KX372095_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCPG
KF862517_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849298_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
JN604309_SHBs_P-A      MENITSGFLGPLLVLQAGSFLLTRILTIPQSLDLWWTSLNFPGGVPVCLG
KX372102_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGESPVCRG
KM606943_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVSPVCLG
KM606856_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439920_SHBs_P-A      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439916_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGAPVCLG
JF439912_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KY353889_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
KF476012_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGLPVCLG
JF439914_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486306_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGAPGCLG
AB480040_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCXG
KP997454_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KM606890_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KM606834_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
JQ707558_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707554_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707553_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ687533_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU563551_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCPG
GQ486646_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486529_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
MF772348_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KP165652_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606972_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606970_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606969_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606966_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606965_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606963_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606962_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606956_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606949_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606948_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606947_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606939_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606936_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606899_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KM606885_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606844_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KM606831_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606830_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606828_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606820_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KM606792_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606791_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606710_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KF475982_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707556_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604288_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439927_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439925_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439924_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTVPQSLDSWWTSLNFLGGAPVCLG
JF439922_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439921_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439918_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439917_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439915_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439913_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439911_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486751_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486197_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCLG
DQ412538_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCXG
KX372066_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KP165687_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF475988_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486198_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
MG383612_SHBs_P-A      MENITSGFLGPLLVLQAGXFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
JN604249_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPECXG
GQ486677_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLG
GQ486556_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGSPVCLG
GQ486426_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
GQ486165_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
GQ486587_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486120_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGXPVCLG
GQ486532_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGXPVCLG
GQ486192_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSXVCXG
JN604227_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372096_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGXPECHG
DQ412551_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGEPPVCXG
KX372056_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFXXXSPVCXG
KX372065_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXSPVCXG
KX372071_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESLVCLG
KU847541_SHBs_P-A      MENITSGFLRPQLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ707581_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
AY738816_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF090839_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF090840_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ131125_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809479_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGESPVCLG
AY034878_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
AB697493_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AM295798_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AM295799_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AM410963_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB289727_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB289737_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB205118_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
AB014370_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY653785_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB937798_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF134145_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847724_SHBs_P-A      MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGESPVCRG
KU847505_SHBs_P-A      MENITSGFLGPLLVLQXGFFLLTRILTIPQSLDSWWTSLXFLGGPTVCLG
KU847483_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGXQAVCLG
KT630625_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707587_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
JQ707583_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
JQ707579_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
AY738819_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738818_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653786_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY653775_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPHVCLG
AY230118_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLG
AY168427_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
AJ309370_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
AF129506_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809533_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGESPVCLG
AB549213_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
AB453983_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809882_SHBs_P-A      MENITSGFLGPQLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX925296_SHBs_P-A      MENITSGFLGHLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPVCLG
KM606781_SHBs_P-A      MENITSGFLKPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707604_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
JQ707596_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707580_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JN983868_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439958_SHBs_P-A      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGPPVCLG
AF537371_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF209400_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF208875_SHBs_P-A      MENIISGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF065115_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
AF065114_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTACLG
AB116078_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB116079_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB116080_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB116081_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB126580_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB222742_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB246337_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB246338_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB263406_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB289692_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB289693_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF065113_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF134138_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AM282986_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY707087_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606901_SHBs_P-A      MENITSGFLRPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779272_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707603_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPHVCRG
JQ707578_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
JQ707575_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
JQ707318_SHBs_P-A      VDNVTSVFKGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JN604190_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESLVCLG
JF439864_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQGLDSWWTSLNFLGGAPVCLG
JF439852_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDPWWTSLNFLGGSPVCLG
JF439821_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGSPVCLG
GQ486101_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
DQ412454_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
DQ236107_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPACLG
AY738820_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY738817_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF536524_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF065116_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB937797_SHBs_P-A      MENITSGFLGPRLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGESPVCLG
AB289706_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB116077_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX827293_SHBs_P-A      MENTPSGLLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGSPVCLG
KX372093_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KU847547_SHBs_P-A      TENITSGFLGPQLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPGCLG
KP997696_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQRIDSWWTSLNFLGGSPVCLG
KF771963_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLRGSPVCLG
JQ707606_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
JQ707595_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
JQ707398_SHBs_P-A      MVNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439976_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLRGSPVCLG
JF439942_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLG
JF439939_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLG
JF439938_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLG
JF439935_SHBs_P-A      MENITSGVLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLNFLGGAPVCLG
JF439866_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412482_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412466_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ236110_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ236108_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ236105_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ236104_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ236103_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ131121_SHBs_P-A      MENITSGFLVPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY902775_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY862868_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY862867_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY738822_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY738821_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY653803_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY653801_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY653800_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY653799_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY653796_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
AY653791_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY653789_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY653788_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
AY653787_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
AY311374_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY233280_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY128092_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AM295797_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AM295796_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AM295795_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AJ627228_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
AJ309371_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AJ012207_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF369544_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF369532_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF363663_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF297624_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF297623_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF209404_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF209397_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF209395_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF143298_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF134148_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF134147_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF134143_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF090841_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF090838_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGSPVCLG
AF061526_SHBs_P-A      MENITSGFLGPLLVLQAGFFLVTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF061525_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF043580_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB937794_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB937793_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB937792_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809543_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809542_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809541_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809538_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809537_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809532_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809493_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809492_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESAVCLG
AB809491_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809490_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809489_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809483_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809482_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809481_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
AB809480_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809478_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809476_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB809471_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB775201_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB775200_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB775199_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB775198_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697512_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697511_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697509_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697508_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697507_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697506_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGSPVCLG
AB697505_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697504_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697503_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697501_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697499_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697498_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697497_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697496_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697495_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697492_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
AB697491_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697489_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB697488_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB480041_SHBs_P-A      MENITSGFLGPLLMLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB480039_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB480038_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB480036_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB453982_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB453981_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB453980_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB453979_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB362931_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB300366_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB289711_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB289704_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY353895_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372048_SHBs_P-A      MENITSGLLGPLLALQAGFFLLTRILTIPQSLDLWWTSLSFLEGPHVCLG
KX372028_SHBs_P-A      MENITSGFLGPLXVLQAGFXXLTXILTIPQSLDSWWTSLNFLGGSPGCLG
KU847740_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KU847729_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLG
KU847634_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKIRTIPQSLDLWWTSLXFLGGSPVCLG
KR816116_SHBs_P-A      KENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606889_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707607_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707605_SHBs_P-A      MENITSGGLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707601_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707594_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707577_SHBs_P-A      MENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707572_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707559_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707552_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707345_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGPPVCLG
JN604298_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPHVCLG
JN604285_SHBs_P-A      MENITSGFLGPLLGSLAGFXLLTRILTIPQSLDSWWTSLSFLGGSPVCXG
JF439981_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLEGSPVCLG
JF439857_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
GQ486694_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPGCLG
AY653798_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AF209405_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGSPVCLG
U87731_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH347485_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF772347_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
M54898_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809903_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KY271382_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPPVCLG
KU847739_SHBs_P-A      MENITSGFLGPLLVLQXGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KT366521_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KR139744_SHBs_P-A      MENITSGFLGPLLVLQGGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KM606871_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606827_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCLG
KM606787_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCLG
KM606775_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779386_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779370_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779332_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779324_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTITQSLDSWWTSLNFLGGSPVCLG
KF779323_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTITQSLDSWWTSLNFLGGSPVCLG
KF779322_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTITQSLDSWWTSLNFLGGSPVCLG
KF779321_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779320_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779317_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779294_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779291_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779290_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779287_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779286_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779259_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779257_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779215_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779213_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779211_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KF771943_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCLG
KF476006_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC875260_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113409_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113408_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113407_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113406_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113405_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113404_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113403_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113402_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113401_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113398_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113385_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113384_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC113382_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849640_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849309_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX125364_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707663_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707647_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707635_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707573_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707570_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707563_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
JQ707562_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707560_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707551_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707549_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707548_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ707537_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ707325_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707305_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ514503_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JN604197_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JN604183_SHBs_P-A      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGAPVCLG
JN604181_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439993_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQGLDSWWTSLNFLGGSPVCLG
JF439991_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439989_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439987_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439975_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTVPQSLDSWWTSLNFLGGSPVCLG
JF439973_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGSPVCLG
JF439972_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439961_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439952_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439928_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECPG
JF439919_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGAPVCLG
JF439868_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439865_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439862_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439861_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439855_SHBs_P-A      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439850_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVYLG
JF439849_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439846_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439843_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSCWTSLNFLGGSPVCLG
JF439842_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439841_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439840_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439836_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439832_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGSPVCLG
GQ486834_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486776_SHBs_P-A      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGSPVCLG
AB289694_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HM195115_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
V00866_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF772349_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
KY809925_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KY809923_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KX372043_SHBs_P-A      MENITSALLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847715_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847567_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGXAPVCLG
KT630643_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KP995108_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGSTVCLG
KP718102_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165771_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165668_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606849_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF862514_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF862509_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCHG
KF779358_SHBs_P-A      MENITSGFLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779274_SHBs_P-A      MENITSGFLGPLLVLQAGCFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707557_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCHG
JQ707538_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439941_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLG
JF439940_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLG
JF439937_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLG
JF439936_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLG
JF439934_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLG
JF439933_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPECLG
JF439932_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLG
JF439930_SHBs_P-A      MENITSGFLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLG
JF439929_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPECLG
JF439867_SHBs_P-A      MANITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486856_SHBs_P-A      MENITSGLLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486691_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
AY233286_SHBs_P-A      MENITSGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MG839209_SHBs_P-A      MENITSGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY886219_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCRG
KX372103_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGSPVCRG
KX372031_SHBs_P-A      XENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSXVCLG
KU847669_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847647_SHBs_P-A      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KU736919_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718089_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165835_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KP165818_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165795_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILXIPQSLDSWWTSLNFLGGAPVCLG
KP165751_SHBs_P-A      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165741_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165723_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KP165653_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165626_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KM606811_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606802_SHBs_P-A      KENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF862515_SHBs_P-A      MENXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KF779260_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF771946_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476013_SHBs_P-A      VENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849324_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
JX849312_SHBs_P-A      MENXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
JX849311_SHBs_P-A      MENIXSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707542_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707540_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPPVCLG
JQ707539_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707535_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707533_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707374_SHBs_P-A      VENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707369_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707368_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707367_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707366_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707365_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707363_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707361_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707360_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707359_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707358_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707357_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707356_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707355_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707353_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707352_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707351_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707350_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707349_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707348_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707347_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPPVCLG
JQ707346_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707344_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707331_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707330_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707328_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707326_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707324_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707323_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707317_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707314_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707310_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707304_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ707300_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JN604317_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGPPVCLG
JF439982_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCPG
JF439979_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439965_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439923_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486836_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
GQ486747_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486741_SHBs_P-A      MENITSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486598_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486421_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
U87732_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF979149_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF772346_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
MF150687_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF150686_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX827297_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520682_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372100_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQXLDXWLTSLSFXGGSPVCLG
KX372098_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
KX372053_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KX372050_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KU847753_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847718_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749849_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749847_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749846_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749839_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749834_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630632_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KP997814_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP997726_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165837_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KP165836_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KP165810_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165805_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165802_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165794_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165793_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165791_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165789_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165788_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165786_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165784_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165782_SHBs_P-A      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
KP165781_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165780_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165778_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLG
KP165776_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165775_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165773_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165772_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165770_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165768_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165767_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165766_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165765_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165764_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165762_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165761_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165760_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165759_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165757_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165756_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165755_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165754_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165752_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165748_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165747_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165745_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165744_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165740_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165739_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165737_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165736_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165734_SHBs_P-A      MENITSGFLGPLLXLQAGFXLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165733_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165731_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165730_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165729_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165728_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165726_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165724_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165722_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KP165718_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165717_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165716_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165715_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165714_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165711_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165710_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165709_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165708_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165707_SHBs_P-A      MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165702_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165699_SHBs_P-A      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165698_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165696_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165695_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165694_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165693_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165691_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165690_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165688_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165684_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KP165683_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KP165682_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165681_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165680_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165679_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165678_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165677_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165675_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165674_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165673_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165672_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KP165669_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165667_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165665_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165664_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165663_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165662_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165661_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165657_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165654_SHBs_P-A      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165650_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165649_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165648_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165645_SHBs_P-A      MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KP165644_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165643_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165642_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165641_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165639_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KP165637_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165633_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLG
KP165632_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165631_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165630_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165628_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165627_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165625_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
KP165624_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KP165623_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165621_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165620_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM983577_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606971_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLG
KM606954_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSTVCLG
KM606945_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KM606942_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KM606938_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606926_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606921_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGESPVCLG
KM606920_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606919_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606918_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606917_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606916_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606915_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606914_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606913_SHBs_P-A      MENITSGFLGPLXVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXSPVCLG
KM606911_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606910_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KM606909_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606908_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606907_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606906_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606905_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606896_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606893_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606891_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606888_SHBs_P-A      MENITSGFLRPLLVLQAEFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606887_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606886_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606882_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606881_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606880_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606879_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606878_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606877_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606875_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KM606874_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606870_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KM606869_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606866_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606865_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606863_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606858_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606854_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606847_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606846_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606845_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606843_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606841_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606833_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606825_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606822_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606821_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
KM606817_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606816_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606815_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606814_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606813_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606810_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606808_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606807_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606806_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606805_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606804_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606800_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606798_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606786_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606785_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606782_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606779_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606778_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606773_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606769_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606768_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606749_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606746_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606742_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM606713_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KM519454_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854710_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854709_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ854708_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ843218_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ843217_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ843215_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ843214_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ843192_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ843188_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ843186_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ843184_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ843182_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ843173_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ843172_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ843166_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ586809_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF862516_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KF862512_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF862511_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF862510_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF862508_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF862507_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF862506_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF862505_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779385_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779383_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779381_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779379_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779378_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779375_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779374_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779373_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779372_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779371_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779369_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779368_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779367_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779366_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779364_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779363_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779362_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779361_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779360_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779359_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779356_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779355_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779354_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779352_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779351_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779350_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779349_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779348_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779347_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779346_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779345_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779344_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779342_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779339_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779338_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779337_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779335_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779334_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779333_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779331_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779330_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779329_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779328_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779326_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779325_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779319_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779316_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779315_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLKFLGGSPVCLG
KF779314_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779313_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779312_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779311_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSIDSWWTSLNFLGGSPVCLG
KF779310_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779309_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779308_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779307_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779306_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779305_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779304_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779299_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779297_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779295_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779293_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779283_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779282_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779281_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779280_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779279_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779277_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779276_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779275_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779273_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779271_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779270_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779269_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779268_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779266_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779265_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779262_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779261_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779258_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779256_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779255_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779254_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779253_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779251_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779249_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779248_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779247_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779246_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779245_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779244_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779243_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779240_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779239_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779238_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779234_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779232_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779231_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KF779227_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779221_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF779210_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KF771969_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF771965_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF771955_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF771952_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF771940_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF771922_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF771919_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF771918_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476014_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476011_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476010_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476009_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476008_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476007_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476005_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476004_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476003_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476002_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDPWWTSLNFLGGSPVCLG
KF476001_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476000_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF475999_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF475998_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF475997_SHBs_P-A      MENVTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF475996_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF475994_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGSPVCLG
KF475992_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF475990_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF475989_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF475987_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF475986_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF475985_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF475984_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF475983_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
KF414678_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC885883_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC885870_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC885841_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC885834_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC885788_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC885689_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC885609_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC885591_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC885582_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC885581_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC885580_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KC885570_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC836779_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC836778_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849595_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JX849321_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849320_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849319_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCLG
JX849313_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849299_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
JX849296_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849295_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849294_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX310732_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX310731_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX310730_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JX310725_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX310724_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX310722_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX310721_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX125367_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX096953_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX096952_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ911742_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707681_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707676_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707675_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707674_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707672_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707670_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707669_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707667_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707665_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707664_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707662_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707661_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707659_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707658_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707656_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707655_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707654_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707653_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707652_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707651_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707650_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707649_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707648_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707646_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707645_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707644_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707643_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707642_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707641_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707640_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707639_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707638_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707637_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707636_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707634_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707633_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707632_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707631_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707630_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707629_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707627_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707626_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707625_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707624_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707623_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707622_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707621_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707620_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707619_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707618_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707617_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707616_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
JQ707615_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707614_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707613_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707612_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707611_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707610_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707609_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707571_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707569_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707568_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707567_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707566_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707565_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707564_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707561_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ707555_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707550_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707546_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707545_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
JQ707544_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ707543_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707534_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707531_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ707420_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707419_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707418_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707417_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707416_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707415_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707414_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707413_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707412_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707411_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707410_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707409_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707408_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707407_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707406_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707405_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707404_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707403_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707402_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707400_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707399_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707397_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707396_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707395_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707394_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707393_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707392_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707391_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707390_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707389_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707388_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707387_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707386_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707385_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707383_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707382_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707381_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707380_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707379_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707377_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707376_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707375_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707373_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707372_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
JQ707371_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707370_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707364_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707362_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707354_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707343_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ707342_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707341_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707339_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707338_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707337_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ707336_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707333_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707332_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707322_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707321_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ707320_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707319_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707316_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ707315_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707313_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ707312_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ707311_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707309_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ707308_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707307_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707303_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ707302_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707301_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JQ707299_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ687529_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604319_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604315_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604307_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGSTVCLG
JN604306_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604304_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604303_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604300_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604299_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604297_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604294_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604293_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604292_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604291_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604283_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604282_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604279_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604277_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604276_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604274_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604273_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604270_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
JN604269_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604268_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604266_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
JN604262_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604257_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604255_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFQGGSPVCLG
JN604247_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604242_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604240_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604236_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604228_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604216_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604214_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSXDSWWTSLNFLGGSPVCLG
JN604204_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604200_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604194_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604191_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604185_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604184_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604180_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604179_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCLG
JN604178_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604173_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604167_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604164_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604162_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604160_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604159_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604158_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN226093_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JN107758_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF440020_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF440018_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF440016_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439992_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGSPVCLG
JF439988_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439986_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439985_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439984_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWGTSLNFLGGSPVCLG
JF439983_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439980_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439978_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439974_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439971_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439970_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439969_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439968_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439967_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439966_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439963_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439962_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439960_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439959_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439957_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439956_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439955_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439954_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439953_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439951_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439950_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439949_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439948_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439947_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439946_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439945_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439944_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439931_SHBs_P-A      MENITSGVLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439860_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439859_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439858_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439856_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439854_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439853_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439851_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439848_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439847_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439845_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439844_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439839_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439838_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439837_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439835_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439834_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439833_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439831_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439829_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439828_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439825_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439824_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
JF439822_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439778_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439777_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439775_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439774_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439773_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439772_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439771_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439770_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439769_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439768_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439767_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439766_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439765_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439764_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439763_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439762_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439761_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439760_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439759_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439758_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439757_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439756_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439755_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439754_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439753_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439752_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
J02205_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HE981729_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HE981728_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HE576989_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HE576988_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFQGGSPVCLG
GU563562_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU563558_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU563557_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
GU563555_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU563554_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU563553_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
GU563550_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GU563546_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486857_SHBs_P-A      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWLTSLSFLGESPVCLG
GQ486840_SHBs_P-A      MENXTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486829_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486813_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486727_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486714_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486712_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486710_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486697_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486668_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486663_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486631_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486615_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486603_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486601_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486599_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486597_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486583_SHBs_P-A      MENXTSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486580_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486568_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486564_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486531_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
GQ486445_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486139_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ325775_SHBs_P-A      MENITSGFLGPLXVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXSPVCLG
KP165721_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
Z72478_SHBs_P-A        MENITSGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFIGGSPVCLG
Z35717_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
X75666_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
X70185_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
X02763_SHBs_C-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
U91824_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
U91820_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
U87734_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
U87730_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
U87729_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
U87726_SHBs_P-A        MENITLGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
U87725_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK127857_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK127855_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK127849_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MK127847_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH932713_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MH165307_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MG839208_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MG383617_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MG383613_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF772350_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF772345_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
MF772344_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
LC458431_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
LC458430_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
LC311243_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
LC311242_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
LC311241_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
LC074724_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
L13994_SHBs_P-A        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809929_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809911_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809902_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809897_SHBs_P-A      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809895_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809892_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809891_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY809884_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY697846_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY697845_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY697842_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY697833_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY660208_SHBs_P-A      MENITSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY003230_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX827298_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESPVCLG
KX827296_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX827295_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX827294_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520707_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520683_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTTPQSLDSWWTSLNFLGGSPVCLG
KX520681_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX520676_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372094_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372091_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372087_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372082_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372080_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372078_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372077_SHBs_P-A      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372076_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372075_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372072_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372070_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372068_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372067_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372064_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372063_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KX372062_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372061_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372060_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KX372059_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372055_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372051_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372047_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372046_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372045_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372044_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372042_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372041_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372040_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372039_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372038_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372037_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372036_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372035_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372034_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372033_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372032_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU900752_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU900750_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847746_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KU847714_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847668_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU605532_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749850_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749844_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749843_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749842_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749840_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749838_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749837_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749836_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749835_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749832_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749830_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749829_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749826_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749825_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT749824_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630640_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KT630626_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP997737_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP997707_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP997697_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP997666_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP997619_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP997618_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718101_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718099_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718098_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718097_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718096_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718095_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718094_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718093_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718092_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718091_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718090_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718088_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718087_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP274928_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP274927_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP274925_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP244022_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP168427_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPGCLG
KP165824_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KP165823_SHBs_P-A      MENITSGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165822_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165821_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165819_SHBs_P-A      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KP165817_SHBs_P-A      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLSFLGGSPVCLG
KP165814_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165811_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165809_SHBs_P-A      MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165808_SHBs_P-A      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KP165806_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165804_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165801_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165800_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165797_SHBs_P-A      MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165750_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KP165646_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KJ843216_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF476015_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486853_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCXG
GQ486571_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
GQ486427_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCXG
GQ486309_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXXXVCLG
GQ486441_SHBs_P-A      MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLXFLGGSPVCLG
GQ486563_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KX372092_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGXPVCLG
KX372073_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPXCLG
KX372069_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPVCXG
KP165732_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KP165719_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165700_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KP165676_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXXPVCLG
KP165660_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KP165638_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JN604188_SHBs_P-A      MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
JN604172_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXSPVCPG
GQ486754_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486725_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486721_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXXVCLG
GQ486669_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486616_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KP997443_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP718100_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KP165815_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165779_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXSPVCLG
KP165774_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165763_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165758_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165749_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165742_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGSPVCLG
KP165727_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165712_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165701_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165670_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165666_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165659_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165640_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165635_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JX849318_SHBs_P-A      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
JX849308_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486782_SHBs_P-A      MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCXG
GQ486567_SHBs_P-A      MENITSGXLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486560_SHBs_P-A      MENITSGFLGPLLVLQXGFXLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KX372079_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KP165803_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP165656_SHBs_P-A      MENITSGXLGPLLVLQAGFFXLTXILTIPQSLDSWWTSLNFLGGSPVCLG
KP165813_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
KP165697_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXXPVCLG
KP165705_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXXPVCLG
KP165655_SHBs_P-A      MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
KP165796_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
AY161138_SHBs_P-A      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
KT151616_SHBs_P-A      ---ITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KU847644_SHBs_P-A      -ENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
                                               :                        .

GQ477477_SHBs_P-A      QNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-PCLIFLLVLLD
AY738139_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738143_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738140_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738141_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738142_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB453988_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB786655_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB786656_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF083638_SHBs_P-A      QNSQSPTTNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF132442_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF209399_SHBs_P-A      QNSQSPTSNHSPTSCPPNCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY232836_SHBs_P-A      QNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY232838_SHBs_P-A      QNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ298164_SHBs_P-A      QNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY232839_SHBs_P-A      QNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY232840_SHBs_P-A      QNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ298163_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ298165_SHBs_P-A      QNSQSPTRNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547249_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLALLD
AY232837_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYHWMCLRRFIIFLFILL-LCLIFLLVLLE
AJ344115_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILL-LCLIFLLVLLD
KU847632_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYHSMCLRRFIIFLFILL-LCLIFLLVLLD
JF439906_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF537372_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116092_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY230117_SHBs_P-A      QNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ298162_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR139742_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLVD
MH464809_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLVD
FJ692555_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ995827_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB194953_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439910_SHBs_P-A      QNSQFPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439900_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFTIFLFILL-LCLIFLLVLLD
AB076679_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILL-LCLIFLLVLLD
KF771936_SHBs_P-A      QNSQCPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477502_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547352_SHBs_P-A      QNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU747320_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690521_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB222707_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY152726_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653781_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847730_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847719_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCRRRFIIFLFILL-LCLIFLLVLLD
KP165830_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606928_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439908_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439744_SHBs_P-A      QNSQFPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547306_SHBs_P-A      QNSQSPTSNHSPISCPLICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690535_SHBs_P-A      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653777_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF297625_SHBs_P-A      QNSQYPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116089_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116082_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB076685_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200195_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200204_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547349_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY271384_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847745_SHBs_P-A      QNSQSPTSNHSPTFCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847732_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
KU847671_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847662_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLGLLD
GQ477469_SHBs_P-A      QNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477463_SHBs_P-A      QNSQSPTCNHSPTSCPPICPGYRWMCLRRFIISLFILL-LCLIFLLVLLD
GQ184323_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ904434_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIISLFILL-LCLIFLLVLLD
FJ709471_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692586_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCQRRFIIFLFILL-LCLIFLLVLLD
EF690525_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIISLCILL-LCLIFLLVLLD
DQ995822_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY161139_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF090842_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB453984_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB076690_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU185789_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLGLLD
EU185788_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLGLLD
EU185786_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLGPLD
EU185787_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLGLLD
KY493902_SHBs_P-A      QNSQSPTSNHSLTXCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847749_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847726_SHBs_P-A      QNSQSPTSNHSQTSCPPTCPGYRWMCLRRFIIFLFILL-QCLIFLLVLLD
KJ958470_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF214659_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC875254_SHBs_P-A      QNSQSPTSNHSPTSRPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707599_SHBs_P-A      QNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514283_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIISLFILL-LCLIFLLVLLD
JN604308_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLCILL-LCLICLLALLD
JN604302_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILL-LCLIFLLGLLD
JN604195_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN182334_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVPLD
JN182332_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLG
JF439905_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439904_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439903_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439902_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439901_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439897_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439747_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439738_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439737_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439736_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439735_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439724_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439723_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547348_SHBs_P-A      QNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547324_SHBs_P-A      QNSQSLTSKHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200193_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200183_SHBs_P-A      QSSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU594386_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVFLD
EF690520_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLILLLVLLD
DQ412537_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILL-LCLIFSLVLLD
DQ412446_SHBs_P-A      QNSQXPTSNHSPTSCPPICPGYRWMWLRRFIIFLFILL-LCLIFLLVLLD
AF208866_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF083637_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLGLLD
AB786660_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH347491_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809906_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809881_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLSILL-LCLIFLLVLLD
KX357646_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847697_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LYLIFLLGLLD
KR905427_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816137_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165834_SHBs_P-A      QNSQSPTSNHSPTSCPPTCLGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165831_SHBs_P-A      QNSQSPTSNHSPTSCPPTCLGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606941_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606794_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606793_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM590921_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862524_SHBs_P-A      PNSQSPTSNHSPISCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779384_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779298_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771958_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707589_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514287_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983903_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983855_SHBs_P-A      QNSQCPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604241_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439990_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439751_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439739_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439734_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439731_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439730_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439726_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HE652716_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HE652711_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HE652708_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLSVLLD
HE652705_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859950_SHBs_P-A      QDSQSPTSNHSPTSCPRICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690519_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547855_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLVD
DQ995813_SHBs_P-A      QNXQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIXLLVLLD
DQ412474_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412460_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412448_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653794_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILL-LCLIFLLVLLD
AF134134_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF083636_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809534_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809484_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB786647_SHBs_P-A      QNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB300367_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB246336_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116090_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116086_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116076_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB076687_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLQRFIIFLFILL-LCLIFLLVLLD
MH464823_SHBs_P-A      QNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLVD
KY809910_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY493900_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMXLRRFIIFLFILL-LCLIFLLVLLD
KU847696_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILL-LCLIFLLVLLD
KU847584_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847573_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU711606_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU711604_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT366467_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR905426_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165704_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLGLLD
KM983569_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM983563_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707536_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514399_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514391_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983845_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMSLRRFIIFLFILL-LCLIFLLVLLD
JF439907_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439899_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439898_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HE652707_SHBs_P-A      QNSQSPTSNHSPTSSPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486419_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477494_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477473_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ325792_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FR821990_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692606_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
FJ665816_SHBs_P-A      QNSQSPTSNHSPTSCPPNCHGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859955_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859934_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ995829_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412511_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AJ627227_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN226069_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849598_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
U88095_SHBs_P-A        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512455_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464820_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVPLD
MH464810_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH272596_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809899_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY493896_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY353901_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX648543_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520693_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847766_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847761_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847744_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847713_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847699_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847677_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847676_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847666_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILL-LCLTFLLVLLD
KU847663_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847649_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847637_SHBs_P-A      QNSQCPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLL-LCLIFLLVLLD
KU847609_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847587_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847555_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847504_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847490_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847474_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630630_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630624_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLL-LCLIFLLVLLD
KT630617_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816149_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816143_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLALLD
KR816128_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816126_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816114_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP997447_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP168429_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165832_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165827_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165735_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM983578_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILL-LCLIFLLVLLD
KM983564_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILL-LCLIFLLVLLD
KM983562_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILL-LCLIFLLVLLD
KM606904_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606873_SHBs_P-A      QNSQSPTSNHSPTSCPQNCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606706_SHBs_P-A      QNSQSPTSDHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854698_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854689_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854686_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854685_SHBs_P-A      QNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF922421_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMFLRRFIIFLFILL-LCLIFLLVLLD
KF922420_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMFLRRFIIFLFILL-LCLIFLLVLLD
KF922419_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
KF922418_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
KF922417_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
KF922416_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
KF922415_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
KF922414_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
KF922409_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862520_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779263_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771960_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476024_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476022_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476018_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF214657_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849301_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ811855_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707592_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707590_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707586_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707585_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707576_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514501_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514392_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514297_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514292_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514290_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514280_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983898_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983847_SHBs_P-A      QNSQSPTSNHSPTSCHPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983839_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983834_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604237_SHBs_P-A      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604220_SHBs_P-A      QNSQSPTSNHSPTSCPPNCPGYRWMCLRRFIIFLFILL-LCLIFLLGLLD
JN604193_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLGLLD
JN182333_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN182328_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439909_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439896_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU799052_SHBs_P-A      QNSQSPTSNHSPISCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU798998_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486119_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486077_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486076_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486062_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477501_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477497_SHBs_P-A      QNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477491_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477486_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477484_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477478_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477466_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ222207_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ184324_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFFLVLLD
FN547342_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN545840_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN295508_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN295503_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200199_SHBs_P-A      QNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200187_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200182_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200180_SHBs_P-A      QNSQSLTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ709472_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFSLVLLD
FJ692613_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692611_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692610_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692609_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692585_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692584_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692583_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692582_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692581_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692580_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692579_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692578_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859900_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU594391_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU054331_SHBs_C-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690533_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690531_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690528_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547851_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547837_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547832_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547830_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547829_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547828_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF208113_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILL-LCLIFLLVLLD
EF103278_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILQ-LCLIFLLVLLD
DQ995834_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ459086_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412548_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412541_SHBs_P-A      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412534_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412528_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412523_SHBs_P-A      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412522_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412517_SHBs_P-A      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412501_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738812_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512458_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MG383607_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF979151_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
LT992441_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809930_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809924_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809889_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809885_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY660207_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY353876_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372089_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847508_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630607_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816131_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816111_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165833_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165829_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165828_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165826_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILL-LCLIFLLVLLD
KP165825_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILL-LCLIFLLVLLD
KM983579_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
KM983568_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606925_SHBs_P-A      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606860_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606783_SHBs_P-A      QNSQSPTSNHSPTSCPLICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606766_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779264_SHBs_P-A      QNSQSPTSNHSPTSCPLICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771920_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILL-LCLIFLLVLLD
KF476026_SHBs_P-A      QNSQSPTSNHSPTSSPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF475991_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC885810_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849315_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX310723_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707532_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514397_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514295_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514285_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983850_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604290_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFHFILL-LCLIFLLVLLD
JN604136_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439964_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439820_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439748_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439746_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439745_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439743_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFTLL-LCLIFLLVLLD
JF439742_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439729_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439722_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439720_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM535200_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HE652718_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HE652715_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HE652713_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HE652712_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HE652710_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HE652709_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HE652704_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486772_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486642_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477464_SHBs_P-A      QNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FR821994_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FR821993_SHBs_P-A      QNSQSPTSNHSPTSCLPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FR821992_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FR821991_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FR821989_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FR821988_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547273_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN545832_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
FN545830_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN295528_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN295518_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLTFLLVLLD
FM200198_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ665815_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIILLFILL-LCLIFLLVLLD
EF690534_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690532_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690523_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690522_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690518_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547835_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFIPL-LCLIFLLVLLD
DQ788725_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCPIFLLVLLD
DQ412447_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
U87733_SHBs_P-A        QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLDLLD
MH347489_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH272667_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF979152_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF979144_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF925373_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
LT992448_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809934_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809933_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809917_SHBs_P-A      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809916_SHBs_P-A      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809914_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809904_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809900_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809894_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809890_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY353934_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY353905_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY271378_SHBs_P-A      QNSQSPNSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX648545_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372058_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372054_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRLMYLRRFIIFLFILL-LCLIFLLVLLD
KX302129_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847747_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847742_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847738_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847722_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847709_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847705_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847700_SHBs_P-A      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847695_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847583_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847575_SHBs_P-A      QNSQSPXSNHSPTSCPPICPGYRWMCLRXFIIFLFILL-LCLIFLLVLLD
KU847527_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847486_SHBs_P-A      QKSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847481_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU711607_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630608_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT366621_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT366620_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT366516_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT235599_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816141_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816140_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816109_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816101_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGCRLMYLRRFIIFLFILL-LCLIFLLVLLD
KP997998_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP997723_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP718086_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP168424_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165783_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165706_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM983574_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606964_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606957_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606912_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606876_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606819_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ958464_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ958454_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ958453_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854701_SHBs_P-A      QNSQSPTCNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF922430_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF922429_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF922408_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862522_SHBs_P-A      QNSQAPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLICLLVLLD
KF779336_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779252_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF475995_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRRMCLRRFIIFLFILL-LCLIFLLVLLD
JX849603_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849306_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ811853_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707378_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514401_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514398_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514385_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514384_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983873_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN226084_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439977_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM467774_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM101121_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486775_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486456_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486425_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLX
GQ486416_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486368_SHBs_P-A      QNSQSPTXNHSPTSCPPICPGYRWMCLRXFIIFLFILL-LCLIFLLVLLD
GQ486317_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486253_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486209_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ325765_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ325764_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547364_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547363_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547346_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547340_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
FN547336_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
FN545834_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN545826_SHBs_P-A      QNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200214_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM199981_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859956_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859954_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859951_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859945_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU366129_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRXMCLRRFIIFLFILL-LCLIFLLVLLD
EF547848_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412540_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412532_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412516_SHBs_P-A      QNXQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412508_SHBs_P-A      QNXQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653779_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
X75669_SHBs_P-A        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
X04820_SHBs_P-A        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
U91810_SHBs_P-A        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
U87736_SHBs_P-A        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
U87728_SHBs_P-A        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
U87727_SHBs_P-A        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLDLLD
MK512477_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512476_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512475_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512473_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512472_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512470_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512469_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512468_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512467_SHBs_P-A      QNSQSPTSNHSPTSCAPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512466_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512465_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512464_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512461_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
MK512460_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512459_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512457_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512456_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK127856_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK127854_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK127848_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464828_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464816_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464815_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464812_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464811_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH272679_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH272552_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH272532_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF979146_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF979143_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF925407_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF925400_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF925385_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF925368_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF925361_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF772351_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
M21030_SHBs_P-A        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
LT992440_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809936_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809932_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809927_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809926_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809921_SHBs_P-A      QNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809920_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809919_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809918_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809915_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809913_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809912_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809909_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809907_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809898_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809896_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809888_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809880_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY697834_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY660215_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY493814_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY382410_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY353904_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY353902_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY353890_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY353882_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY353877_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY271385_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY271377_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY213953_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX648548_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX648546_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX648544_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520706_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520705_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520704_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520703_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520702_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520701_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520700_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520699_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520698_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520697_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520696_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520695_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520694_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520692_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520691_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520690_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520689_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520688_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520687_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520684_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520680_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520679_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520678_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520677_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520675_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372099_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372084_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372083_SHBs_P-A      QNSQSPTXNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372052_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372030_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372029_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX357650_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX357647_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX357645_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX357644_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX357643_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX357642_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX302133_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX302130_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX302106_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX302095_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264659_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264658_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264657_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264656_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264655_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264654_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264653_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264652_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264651_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264650_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264649_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264648_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264647_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264646_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264645_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264644_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264643_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264642_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264641_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264638_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264633_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264632_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264629_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264628_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264627_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264626_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264625_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264624_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264623_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264622_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264621_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264620_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264614_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264612_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264611_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264610_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264607_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264606_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264605_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264604_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264603_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264601_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264598_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264597_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264596_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264595_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU900754_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU900753_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU900751_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847769_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847765_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847764_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847762_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847760_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847759_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847757_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847756_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847755_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847754_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847751_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847750_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847743_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847734_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847733_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
KU847731_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847727_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847725_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847721_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847717_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847716_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847712_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847711_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847707_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847704_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847703_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847702_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847701_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847698_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847691_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847690_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847687_SHBs_P-A      QNSQSPTSNHSPTCCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847683_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847682_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847670_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847667_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847660_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILL-LCLIFLLVLLD
KU847658_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRXMCLRRFIIFLFILL-LCLIFLLVLLD
KU847654_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847645_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847643_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847642_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847641_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFSLVLLD
KU847640_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
KU847638_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847636_SHBs_P-A      QNSQXPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847626_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847625_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILX-LCLIFLLVLLD
KU847622_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847615_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847607_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847604_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847594_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847588_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847582_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847572_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847570_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847563_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847559_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847557_SHBs_P-A      QNSQSPTSNHSQTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847553_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847546_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847543_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMXLRRFIIFLFILL-LCLIFLLVLLD
KU847542_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847539_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847531_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847517_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847514_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847506_SHBs_P-A      QNSQSPTSNHSXTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847501_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILX-LCLIFLLVLLD
KU847500_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILX-LCLIFLLVLLD
KU847499_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847495_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847494_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847478_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847475_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU736920_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU736918_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU605539_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU605538_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU605537_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU605536_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU605535_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU605534_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU605533_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630639_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630638_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630636_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630635_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630628_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630627_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630621_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630615_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630611_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630609_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT366628_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT366619_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT366517_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT366470_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT366469_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT366468_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT347092_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT347091_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT347088_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT347087_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT235614_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT235608_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT235600_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT235598_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT235593_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT201168_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT201167_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT201166_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT201165_SHBs_P-A      QNSLSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT201161_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT201158_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT151615_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT151614_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT151611_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR905431_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR905430_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816150_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816146_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816145_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816139_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816130_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816127_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816123_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR139743_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP997730_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP997676_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP718085_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP168434_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP168433_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP168432_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP168428_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP168423_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP168422_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165799_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165790_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIXLFILL-LCLIFLLVLLD
KP165777_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165738_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165692_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165658_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165634_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165629_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM983575_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM983572_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM983570_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM983567_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM983566_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606930_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606927_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606864_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606832_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606826_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606788_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606780_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606774_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606770_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606748_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606737_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606701_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM590919_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM590909_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM590908_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ958468_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ958467_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ958461_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ958459_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ958448_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ958443_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854707_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854706_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854705_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854704_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854703_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854702_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854700_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854699_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854697_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854696_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854695_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854694_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854693_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854692_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854690_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854688_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854687_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ843183_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ194506_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ010778_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ010777_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ010776_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF922437_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF922436_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF922435_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF922434_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF922433_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF922428_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF922427_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF922426_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF922425_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF922424_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF922407_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF922406_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862523_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862519_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862518_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771967_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476027_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476025_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476023_SHBs_P-A      QNSQSPTSNHSPTPCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476021_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476017_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476016_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMWLRRFIIFLFILL-LCLIFLLVLLD
KF214666_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF214665_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF214663_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF214661_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF214660_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF214658_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF170754_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC885725_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC885659_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC875256_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC875255_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC875253_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC875252_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849323_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849314_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849297_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLXD
JX154582_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX154581_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX154580_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX154579_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX125368_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ811888_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ811863_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ811860_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ811859_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ811858_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ811857_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ811856_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ811854_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514533_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514532_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514531_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514507_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514506_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514504_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514502_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514405_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514400_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514395_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514394_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514390_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514389_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514388_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514387_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514383_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514382_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514381_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514380_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514294_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514291_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514288_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514286_SHBs_P-A      QNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514284_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514282_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514281_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983909_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983905_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983902_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983900_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983899_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983897_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983896_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983895_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983894_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983893_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983890_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983888_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMFLRRFIIFLFILL-LCLIFLLVLLD
JN983884_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983883_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983882_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983880_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983878_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983876_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983875_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983874_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983872_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983871_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983870_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
JN983869_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983866_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983865_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983864_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983860_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983857_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983856_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983854_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983852_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983851_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983846_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983844_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983842_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983840_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983838_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983837_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983836_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983833_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983831_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFTLL-LCLIFLLVLLD
JN604261_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604260_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
JN604252_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604251_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604230_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLXLLD
JN604217_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604171_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604169_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604156_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604155_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604145_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN182331_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN182330_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN182329_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN182327_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN182326_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN182325_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN182324_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN182323_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN182322_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN182321_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN182320_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN182319_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN182318_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN132119_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439943_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF298903_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HQ840709_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM772997_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM772996_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM772995_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM772994_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM535205_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM363612_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM101124_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM101123_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM101120_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM101119_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM101118_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM101117_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM101116_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM101115_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU799030_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU799025_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU799020_SHBs_P-A      QNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU799009_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU799004_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU798976_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU798964_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU563548_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU563547_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU563545_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486718_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486693_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486557_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486550_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486549_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486544_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486514_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486510_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486490_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486482_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486479_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486478_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486474_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486469_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486461_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486454_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486439_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486438_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486424_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486417_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486415_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486410_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486409_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486391_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486389_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486360_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486312_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486271_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486225_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486203_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486148_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486143_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486130_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486104_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486103_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486092_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486063_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477504_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477503_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477498_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477496_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477488_SHBs_P-A      QSSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477487_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477480_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477479_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477475_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477472_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477468_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477467_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477465_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477462_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477461_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ414522_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ325786_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ325776_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ161813_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547343_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
FN547341_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547321_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547312_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547309_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547308_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547305_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547238_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547235_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547216_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN545833_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN545831_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN295534_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN295533_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN295532_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN295531_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN295530_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200207_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200203_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200202_SHBs_P-A      QNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200201_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM199979_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM199978_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM199977_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM199976_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM199975_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM199974_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ709470_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692608_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692607_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRXIIFLFILL-LCLIFLLVLLD
FJ692605_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692604_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692603_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692602_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692601_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692599_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692598_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692597_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692596_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692595_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692592_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692591_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692590_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692588_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692577_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692576_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692574_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692571_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692566_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692563_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692559_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692558_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692557_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ349224_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ349222_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859953_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFSLVLLD
EU859949_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859948_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859947_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859946_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859944_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859943_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859942_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859941_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859940_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859939_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859938_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859937_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859936_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859935_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859933_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859932_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859931_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859930_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859929_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859928_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859927_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859926_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859925_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859924_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859923_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859922_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859921_SHBs_P-A      QNSQSPTFNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859920_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859919_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859918_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859917_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859916_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859915_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859914_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859913_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859912_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859911_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859910_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859909_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859908_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859907_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859906_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859905_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859904_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859903_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859902_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859901_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859899_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU859898_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU594395_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU594394_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU594393_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU594392_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU594390_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU594389_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU594388_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU594387_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU594385_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU594384_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU594383_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU414133_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU414132_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU414103_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU414102_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU410082_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU159676_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU086721_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690530_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690529_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690527_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690526_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690524_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690517_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547853_SHBs_P-A      QNSQSPTCNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547850_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547849_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547847_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547846_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547845_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547844_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547843_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547842_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547841_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547840_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547839_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547838_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILL-LCLIFLLVLLD
EF547834_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547833_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547831_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412557_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412556_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412555_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412554_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412553_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412552_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412550_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412549_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412547_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412546_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412545_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412544_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412543_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412539_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412535_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412533_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412531_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412530_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412529_SHBs_P-A      QNSQSPTXNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412526_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412525_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412524_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412521_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412520_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412518_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412515_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412514_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412513_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412512_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412510_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412509_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412507_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412506_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412505_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412503_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412502_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412500_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412499_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412498_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412496_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLALLD
DQ412494_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412493_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412492_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412491_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412490_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412489_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMXLRRFIIFLFILL-LCLIFLLVLLD
MK127850_SHBs_P-A      QDSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILL-LCLIFLLVLLD
MH464825_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372074_SHBs_P-A      QNSQSPXSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIXXLVLLD
KU847675_SHBs_P-A      QNSQXPTSNHSPTSCPXXCPGYRXMCLRRFIIFLFILL-LCLIFLLVLLD
KU711605_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT749822_SHBs_P-A      QDSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILL-LCLIFLLVLLD
KP997624_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165807_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165651_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606933_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606924_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606903_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606784_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771962_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849307_SHBs_P-A      QNSQXPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIXLLVLLD
JQ514393_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983901_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477493_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477490_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN545837_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ904411_SHBs_P-A      QNSQSPTFNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH272586_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372057_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264631_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847657_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847656_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847554_SHBs_P-A      QNSQXPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847487_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT235603_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT151617_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT151612_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP168431_SHBs_P-A      QNSQSPTSNHSPTSCPLICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP168426_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC836781_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604165_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRXMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486683_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486232_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486213_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547334_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN545839_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN545835_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN545829_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN545828_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ349296_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EU414104_SHBs_P-A      QNSQSPTSNHSPTSCPXICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412497_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372104_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264635_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847664_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP168430_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165785_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165685_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862525_SHBs_P-A      QXSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862521_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604305_SHBs_P-A      QNSRSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486205_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486182_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372090_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165753_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486249_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372049_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372081_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412486_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIXFLFILL-LCLIFLLVLLD
FN547355_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486770_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLALLD
KU847530_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX276769_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFXLL-LCLIFLLVLLD
KU847564_SHBs_P-A      QNSQSPTSNHXPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847617_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707608_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439732_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILP-LCLIFLLVLLD
JF439733_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILP-LCLIFLLVLLD
EF547856_SHBs_P-A      QNSQSPPSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514293_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFTIFLFILL-LCLIFLLVLLD
FM200216_SHBs_P-A      QNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200185_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653776_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY233282_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFVIFLFILL-LCLIFLLVLLD
EU859952_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ331047_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512462_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809887_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLVD
KU847688_SHBs_P-A      QNSQSPTSNHSPTSXPPICXGYRWMCLRHFIIFLFILL-LCLIFLLVLLD
JQ023661_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200188_SHBs_P-A      QNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412469_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIISLFILL-LCLIFLLVLLD
AB786663_SHBs_P-A      QNSQFPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB786661_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847672_SHBs_P-A      QNSQXPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847768_SHBs_P-A      QNSQXPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165671_SHBs_P-A      PNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439721_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412456_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ298161_SHBs_P-A      QNSQSPTSNHSPTCCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY161143_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY161144_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF297622_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB246317_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILL-LCLIFLLVLLD
AB116094_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK127858_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464817_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816115_SHBs_P-A      QNSQSPTSNHSPTYCPPICPGYRWTXLRRFIIFLFILL-LCLIFLLVLLD
JQ023660_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN295511_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692572_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY233287_SHBs_P-A      QNSQSPTSNHSPTSRPPICPGYRGMCLRRFIIFLFILL-LCLIFLLVLLD
AY233285_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116084_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512463_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847681_SHBs_P-A      HDSQSPTSNHSPTSCPPTCPGYPWMCLRRFIIFLFILL-LCLIFLLVLLD
KR905429_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ331046_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200189_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692554_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690536_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412449_SHBs_P-A      QNSQSPTSNHSPTSCPLTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738815_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653793_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653778_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY233290_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY233284_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809477_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB453989_SHBs_P-A      QNSQSPTSNHSPTSCPPTCAGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB453986_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB194952_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116088_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB030513_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB076678_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB076680_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB076681_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB076682_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
AB076683_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB076686_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB076688_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116083_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116087_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB194950_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB241114_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB241115_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB786643_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB786645_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB786646_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB786648_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB786649_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB786651_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB786652_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB786654_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB786659_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB937791_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809901_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCRRRFIIFLFILL-LCLIFLLVLLD
KY271379_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847680_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLGLLD
KU847629_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYRRRFIIFLFILL-LCLIFLLVLLD
KU847614_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILL-LCLIFLLVLLD
KF214662_SHBs_P-A      QNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514500_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983867_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983861_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILL-LCLIFLLVLLD
JN983832_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLICLLVLLD
GQ486686_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547326_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547315_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIISLFILL-LCLIFLLVLLD
EF547854_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412487_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412476_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412475_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412455_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRXMCLRRFIIFLFXLL-LCLIFLLVLQD
DQ412451_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLGLLD
DQ412445_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412443_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY934764_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY934763_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738814_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738811_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738808_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738804_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653780_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY233278_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AM180624_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF083635_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809486_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB786662_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB786658_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB786657_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB453987_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116085_SHBs_P-A      QNSQSPTSNHSPTFCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847651_SHBs_P-A      QNSQSPTSNHSPTSCPPICXGYRWXXLRRFIIFLFILL-LCLIFLLVLLD
KU847652_SHBs_P-A      QNSQSPTSNHSPTSCPPICXGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK127860_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809908_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809883_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIISLFILL-LCLIFLLVLLD
KY353875_SHBs_P-A      QNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX302113_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606797_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514296_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983904_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983859_SHBs_P-A      QNSQCPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983848_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983835_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200186_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692573_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILL-LCLIFLLVLLD
EF690515_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412478_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412471_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412464_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY934772_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY233289_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY233288_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY233283_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY233281_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY233279_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY233276_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY233275_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY233274_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY161142_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AM494718_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AM184126_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AM184125_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF297621_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF043560_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB937796_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK512471_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MG839207_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MG839206_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MG839203_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF979153_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809937_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809928_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY353897_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX648547_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX357649_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX302105_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847767_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847737_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847710_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847706_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847693_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847639_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847631_SHBs_P-A      QNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847630_SHBs_P-A      QNSQCPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847601_SHBs_P-A      QNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847578_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847538_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847533_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847473_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630616_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816151_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
KR816148_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
KR816133_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816119_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
KR816118_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR816110_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
KP165647_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM983573_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606900_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM590923_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM519453_SHBs_P-A      QNSQPPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM519452_SHBs_P-A      QNSQPPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854691_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476020_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC875257_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ811862_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ811861_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514386_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983887_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983885_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983863_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604186_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604128_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HQ185229_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM101122_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM101114_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM101113_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU798993_SHBs_P-A      QNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547338_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547166_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547157_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN545838_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200215_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM200181_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692567_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692565_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692564_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692561_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF690516_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412488_SHBs_P-A      LNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412457_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLXVLLD
AY903452_SHBs_P-A      QNSQSPTSNHSPTSCPPNCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB246335_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116093_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116091_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847650_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY934773_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113365_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113366_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113367_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113369_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113370_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113372_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113373_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113374_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113376_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113377_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113378_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113379_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113380_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113387_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113388_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113390_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113391_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113392_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113396_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
KC113397_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
MG839201_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
MG839204_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLFILL-LCLIFLLVLLD
U87735_SHBs_P-A        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK127853_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464830_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464829_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464827_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464826_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464824_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464822_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464821_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464819_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464818_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464814_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464813_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MG839205_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MG839202_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF925372_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
M57663_SHBs_P-A        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
LC051141_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809931_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809922_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809886_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY493873_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY493811_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847763_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847748_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847684_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847646_SHBs_P-A      QNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847605_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847589_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847585_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847565_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847548_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847526_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847520_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847497_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847489_SHBs_P-A      QNSQCPTSNHSPTSCPPICPGYRWMCLRRFIIFLFXLL-LCLIFLLVLLD
KT630642_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630641_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630637_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630612_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM983576_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM983571_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM983565_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606923_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606707_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514396_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514289_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ023663_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983907_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIISLFILL-LCLIFLLVLLD
JN983892_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983889_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983881_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIISLFILQ-LCLIFLLVLLD
JN983877_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983862_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983858_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983841_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604163_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM363613_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM011485_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU799047_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU799040_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU798978_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486194_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486156_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547335_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547331_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547330_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547329_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547328_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547327_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547325_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547291_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547244_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547228_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN545836_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLXD
FN545825_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FM199980_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
EF547852_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
EF547836_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412485_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412484_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412483_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412481_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412480_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412479_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412477_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412473_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412472_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412470_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412468_SHBs_P-A      QNSQXPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLGLLD
DQ412467_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412465_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412462_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412461_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412459_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412458_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412453_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412452_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412450_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ315786_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILL-LCLIFLLVLLD
DQ315785_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ315784_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ299404_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ299401_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ020003_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ020002_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY934774_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY934771_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY934770_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY934769_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY934768_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY934767_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY934766_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLALLD
AY934765_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738813_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738810_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738809_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738807_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738806_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY576429_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY373432_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY373429_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY373428_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486437_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547360_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB937795_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692612_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692575_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604150_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847665_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847635_SHBs_P-A      QNSQXPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX648549_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX264594_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847685_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847511_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847503_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486287_SHBs_P-A      QNSQXPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
KT151613_SHBs_P-A      QNSQSPTSNHSPTFCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847758_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MK127851_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH464808_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847655_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847560_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847551_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRXMCLRRFIIFLFILL-LCLIFLLVLLD
KT630631_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT201164_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP168425_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514505_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU799039_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLVD
FN547344_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692600_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FJ692562_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRXMCLRRFIIFLFILL-LCLIFLLVLLD
KX372085_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRXMCLRRFIIFLFILL-LCLIFLLVLLD
KX264640_SHBs_P-A      QNXQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY303900_SHBs_P-A      QNXQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC875258_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
FN547314_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIXLFILL-LCLIFLLVLLD
FN547320_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIXLFILL-LCLIFLLVLLD
FN547322_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIXLFILL-LCLIFLLVLLD
KU847752_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLPILL-LCLIFLLVLLD
KU847708_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILL-LCLIFLLVLLD
MH272668_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486838_SHBs_P-A      QNSQSPTXNHSPTSCPPICPGYRWMCLRRFIIXLFILL-XCLIFLLVLLD
KU847661_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIXLFILL-LCLIFLLVLLD
KU847659_SHBs_P-A      XNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIXLFILL-LCLIFLLVLLD
MH580643_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH580642_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH580639_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH580627_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH272675_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF772353_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY353879_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372088_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT749831_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT201159_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMXLRXFIIXLFILL-LCLIFLLVLLD
KT366471_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486535_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486828_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP168435_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMXLRRFIIFLFILL-LCLIFLLVLLD
KU847544_SHBs_P-A      QNSQSPTXNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847692_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLXLLD
AF209392_SHBs_P-A      QNSRSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
X51970_SHBs_P-A        QNSRSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB076689_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771953_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606765_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771957_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439872_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF065111_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606950_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606809_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707547_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439875_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439874_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439873_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439871_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439870_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439869_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697487_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT366466_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR905425_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779365_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477495_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771968_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLALLD
GQ486369_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477500_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILL-LCLIFLLVLLD
KM606952_SHBs_P-A      QNSQSPTSNHSPTSCHPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606940_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707541_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ477482_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165703_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF475993_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849305_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIXFLFILL-LCLIFLLVLLD
GQ486807_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165720_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849300_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486611_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486408_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMXLRRFIIFLFILL-LCLIFLLVLLD
GQ325768_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ325766_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFXLVLLD
GQ325767_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439876_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439877_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439878_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439879_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439880_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439881_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439882_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439883_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB194951_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF208873_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLYILL-LCLIFLLVLLD
AB809485_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILL-LCLIFLLVLLD
AF083639_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412495_SHBs_P-A      QNSXSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412519_SHBs_P-A      QNSLSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771956_SHBs_P-A      QNSQSPTSNHSPISCPPNCPGYRWMCLRHFIIFLFILL-LCLIFLLVLLD
AJ309369_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372101_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIISLCILL-LCLIFLLVLLD
KP165820_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILL-LCLIFLLVLLD
JQ023662_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLXLLD
AF083634_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606803_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF134144_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF132443_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB064314_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372095_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYHWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862517_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849298_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604309_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYPWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372102_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606943_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606856_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439920_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLILLLVLLD
JF439916_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439912_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLTFLLVLLD
KY353889_SHBs_P-A      QNSQCPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476012_SHBs_P-A      QNSQSPTSNRSPTSCPPICPGYRWMCLRRFTIFLFILL-LCLIFLLVLLD
JF439914_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486306_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB480040_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP997454_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRXMCLRRFIIFLFILL-LCLIFLLVLLD
KM606890_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606834_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707558_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707554_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707553_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ687533_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GU563551_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486646_SHBs_P-A      QNSQSPTSNHSPTSCPXICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486529_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF772348_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILL-LCLIFLLVLLD
KP165652_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606972_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606970_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606969_SHBs_P-A      QNSQSPTSNHSPTSCPPNCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606966_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606965_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606963_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606962_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606956_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606949_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606948_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606947_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILL-LCLIFLLVLLD
KM606939_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606936_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606899_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCRRRFIIFLFILL-LCLIFLLVLLD
KM606885_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606844_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606831_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606830_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606828_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606820_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606792_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606791_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606710_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILL-LCLIFLLVLLD
KF475982_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWVCLRRFIIFLFILL-LCLIFLLVLLD
JQ707556_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604288_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439927_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439925_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439924_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439922_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439921_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439918_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439917_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439915_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439913_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439911_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486751_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486197_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412538_SHBs_P-A      QNSQCPXSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372066_SHBs_P-A      QNSQCPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFXLGLLD
KP165687_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF475988_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486198_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MG383612_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYXXMFLRRFIIFLFILL-LCLIFLLVLLD
JN604249_SHBs_P-A      QNSQCPTSNHSPTSCPPTCPGYXWMCLRXFIIFLFILL-XCLIFXLVLLD
GQ486677_SHBs_P-A      QNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486556_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486426_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486165_SHBs_P-A      QNSQXPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486587_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486120_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYXWMCLRXFIIFLFILL-LCLIFLLVLLD
GQ486532_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486192_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604227_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372096_SHBs_P-A      QNSXXPTSNHSPTSCPPTCPGYRWMCLRRFIIFLXILL-LCLIFLLVLLD
DQ412551_SHBs_P-A      QNXQSXTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372056_SHBs_P-A      QNSQXPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372065_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372071_SHBs_P-A      QNSQCPTSNHSPTSCPPSCPGYRLMCLRRFIIFLFILL-LCLIFLLVLLD
KU847541_SHBs_P-A      QNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707581_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738816_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF090839_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF090840_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ131125_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809479_SHBs_P-A      QNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY034878_SHBs_P-A      QNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697493_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AM295798_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AM295799_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AM410963_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB289727_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB289737_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB205118_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB014370_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653785_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB937798_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF134145_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847724_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILL-LCLIFLLVLLD
KU847505_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847483_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630625_SHBs_P-A      QNSQSPTSNHSPTSCPLICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707587_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707583_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707579_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738819_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738818_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653786_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653775_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY230118_SHBs_P-A      QNSQSPTCNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY168427_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AJ309370_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFTIFLFILL-LCLIFLLVLLD
AF129506_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809533_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB549213_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB453983_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809882_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
KX925296_SHBs_P-A      QNSQSPTSNHSPTFCPQICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606781_SHBs_P-A      QNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707604_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707596_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYPWMYLRRFIIFLFILL-LCLIFLLVLLD
JQ707580_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN983868_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLICLLVLLD
JF439958_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF537371_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF209400_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF208875_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF065115_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF065114_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116078_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116079_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116080_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116081_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB126580_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB222742_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB246337_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB246338_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB263406_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB289692_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB289693_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF065113_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF134138_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AM282986_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY707087_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606901_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779272_SHBs_P-A      QNSQFPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707603_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707578_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707575_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707318_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604190_SHBs_P-A      QNSQFPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILL-LCLIFLLVLLD
JF439864_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILL-LCLIFLLVLLD
JF439852_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFTIFLFILL-LCLIFLLVLLD
JF439821_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486101_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLCILL-LCLIFLLVLLD
DQ412454_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ236107_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738820_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738817_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF536524_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF065116_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLXRFIISLFILL-LCLIFLLVLLD
AB937797_SHBs_P-A      QNSQSPTSNHSPTSCPXICXGYRWMCLRRFIIFLFILP-LCLIFLLVLLD
AB289706_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB116077_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX827293_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372093_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847547_SHBs_P-A      QNSQSPTSNHXPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP997696_SHBs_P-A      QNSQSPTSDHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771963_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707606_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707595_SHBs_P-A      QNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707398_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439976_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFTIFLFILL-LCLIFLLVLLD
JF439942_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIISLFILL-LCLIFLLVLLD
JF439939_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439938_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439935_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-PCLIFLLVLLD
JF439866_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLSILL-LCLIFLLVLLD
DQ412482_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ412466_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ236110_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ236108_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ236105_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ236104_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLLRFIIFLFILL-LCLIFLLVLLD
DQ236103_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
DQ131121_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY902775_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY862868_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY862867_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738822_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY738821_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653803_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653801_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653800_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653799_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653796_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653791_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653789_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653788_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653787_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY311374_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY233280_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMRLRRFIIFLFILL-LCLIFLLVLLD
AY128092_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AM295797_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AM295796_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AM295795_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AJ627228_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AJ309371_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AJ012207_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF369544_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF369532_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF363663_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF297624_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF297623_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF209404_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF209397_SHBs_P-A      QSSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF209395_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF143298_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF134148_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF134147_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF134143_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFTLL-LCLIFLLVLLD
AF090841_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF090838_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF061526_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF061525_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILL-LCLIFLLVLLD
AF043580_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB937794_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB937793_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB937792_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809543_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809542_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809541_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809538_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809537_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809532_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809493_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809492_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809491_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809490_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809489_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809483_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809482_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809481_SHBs_P-A      QNSQSPTSNHSPTSCPPMCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809480_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809478_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809476_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB809471_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB775201_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB775200_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB775199_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB775198_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697512_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697511_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGXRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697509_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697508_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697507_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697506_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697505_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697504_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697503_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697501_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697499_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697498_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697497_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697496_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697495_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697492_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697491_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697489_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB697488_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB480041_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB480039_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB480038_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB480036_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB453982_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB453981_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB453980_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB453979_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB362931_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB300366_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB289711_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB289704_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY353895_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372048_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372028_SHBs_P-A      QNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847740_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847729_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847634_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRXIIFLFILL-LCLIFLLVLLD
KR816116_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606889_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707607_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707605_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707601_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707594_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707577_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707572_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707559_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707552_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707345_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604298_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604285_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVXLD
JF439981_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439857_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486694_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY653798_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AF209405_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
U87731_SHBs_P-A        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MH347485_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF772347_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
M54898_SHBs_P-A        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809903_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY271382_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847739_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT366521_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KR139744_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606871_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606827_SHBs_P-A      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606787_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606775_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779386_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779370_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779332_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779324_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779323_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779322_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779321_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779320_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779317_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779294_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779291_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779290_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779287_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779286_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779259_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779257_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779215_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779213_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779211_SHBs_P-A      QNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771943_SHBs_P-A      QNSQSPTCNHSPTSCPQTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476006_SHBs_P-A      QNSQSPTSNHSPTSCPPIRPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC875260_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC113409_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC113408_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC113407_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC113406_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC113405_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC113404_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC113403_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC113402_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC113401_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC113398_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC113385_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC113384_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC113382_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849640_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLYILL-LCLIFLLVLLD
JX849309_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLYILL-LCLIFLLVLLD
JX125364_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLSILL-LCLIFLLVLLD
JQ707663_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707647_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707635_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707573_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707570_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707563_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707562_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707560_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707551_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707549_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707548_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707537_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707325_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707305_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ514503_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604197_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604183_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604181_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439993_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439991_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439989_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439987_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439975_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVPLD
JF439973_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439972_SHBs_P-A      QNSQSPTSNHSPTSCPPICPSYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439961_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439952_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIMFLFILL-LCLIFLLVLLD
JF439928_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439919_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439868_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILL-LCLIFLLVLLD
JF439865_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439862_SHBs_P-A      QNSQSPTSNHSPTSCPPIRPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439861_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILL-LCLIFLLVLLD
JF439855_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439850_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439849_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILL-LCLIFLLVLLD
JF439846_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439843_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439842_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILL-LCLIFLLVLLD
JF439841_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439840_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439836_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439832_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486834_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486776_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AB289694_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
HM195115_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
V00866_SHBs_P-A        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF772349_SHBs_P-A      QNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809925_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY809923_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372043_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847715_SHBs_P-A      QNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847567_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630643_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP995108_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP718102_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165771_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165668_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606849_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862514_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862509_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779358_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779274_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707557_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707538_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439941_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439940_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439937_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439936_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439934_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439933_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439932_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439930_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439929_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439867_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486856_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486691_SHBs_P-A      QNSQXPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
AY233286_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MG839209_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KY886219_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372103_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372031_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847669_SHBs_P-A      QNSQSPTSNHSPTSXPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847647_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRXMCLRRFIIFLFILL-LCLIFLLVLLD
KU736919_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP718089_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165835_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165818_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIISLFILL-LCLIFLLVLLD
KP165795_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165751_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165741_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165723_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165653_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165626_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606811_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606802_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862515_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIXLFILL-LCLIFLLVLLD
KF779260_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771946_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476013_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849324_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849312_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIXLFILL-LCLIFLLVLLD
JX849311_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707542_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707540_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707539_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707535_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707533_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707374_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707369_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707368_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRRMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707367_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707366_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707365_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707363_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707361_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707360_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707359_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707358_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707357_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707356_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707355_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707353_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707352_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707351_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707350_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707349_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707348_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707347_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707346_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707344_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707331_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707330_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707328_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707326_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707324_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707323_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707317_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707314_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707310_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707304_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707300_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604317_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRXMCLRRFIIFLFILL-LCLIFLLVLLD
JF439982_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439979_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439965_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439923_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486836_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486747_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486741_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486598_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
GQ486421_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
U87732_SHBs_P-A        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF979149_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF772346_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF150687_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
MF150686_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX827297_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX520682_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372100_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372098_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372053_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KX372050_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847753_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KU847718_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT749849_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT749847_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT749846_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT749839_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT749834_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KT630632_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLXD
KP997814_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP997726_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165837_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRRMCLRRFIIFLFILL-LCLIFLLVLLD
KP165836_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165810_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165805_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165802_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165794_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165793_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165791_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165789_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165788_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165786_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165784_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165782_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165781_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165780_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165778_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165776_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165775_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165773_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165772_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165770_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165768_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165767_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165766_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165765_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165764_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165762_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165761_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165760_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165759_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165757_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165756_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165755_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165754_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165752_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165748_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165747_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165745_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165744_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165740_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165739_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165737_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165736_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165734_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165733_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165731_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165730_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165729_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165728_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165726_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165724_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165722_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165718_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165717_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165716_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165715_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165714_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165711_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165710_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165709_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165708_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165707_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165702_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165699_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165698_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165696_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165695_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165694_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165693_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165691_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165690_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165688_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165684_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165683_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165682_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165681_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165680_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165679_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165678_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165677_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165675_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165674_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165673_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165672_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165669_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165667_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165665_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165664_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165663_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165662_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165661_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165657_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165654_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165650_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165649_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165648_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165645_SHBs_P-A      QNSQSPTSNHSPTSCPPXCPGYRLMCLRRFIIFLFILL-LCLIFLLVLLD
KP165644_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165643_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165642_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165641_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165639_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165637_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165633_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165632_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165631_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165630_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165628_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165627_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165625_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165624_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMXLRRFIIFLFILL-LCLIFLLVLLD
KP165623_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165621_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KP165620_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM983577_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606971_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606954_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606945_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606942_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606938_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606926_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606921_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606920_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606919_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606918_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606917_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606916_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606915_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606914_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606913_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILL-LCLIFLLVLLD
KM606911_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606910_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606909_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606908_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606907_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606906_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606905_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606896_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606893_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606891_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606888_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606887_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606886_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606882_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606881_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606880_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606879_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606878_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606877_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606875_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606874_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606870_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606869_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606866_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606865_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606863_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606858_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606854_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606847_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606846_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606845_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606843_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606841_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606833_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606825_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606822_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606821_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606817_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606816_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606815_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606814_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606813_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606810_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606808_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606807_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606806_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606805_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606804_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606800_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606798_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606786_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606785_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606782_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606779_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRSMCLRRFIIFLFILL-LCLIFLLVLLD
KM606778_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606773_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606769_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606768_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606749_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606746_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606742_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM606713_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KM519454_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854710_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854709_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ854708_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ843218_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ843217_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ843215_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ843214_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ843192_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ843188_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ843186_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ843184_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ843182_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ843173_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ843172_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ843166_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KJ586809_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862516_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862512_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862511_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862510_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862508_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862507_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862506_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF862505_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779385_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779383_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779381_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779379_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779378_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779375_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779374_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779373_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779372_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779371_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779369_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779368_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779367_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779366_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779364_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779363_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779362_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779361_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779360_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779359_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779356_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779355_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779354_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779352_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779351_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779350_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779349_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779348_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779347_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779346_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779345_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779344_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779342_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779339_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779338_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779337_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779335_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779334_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779333_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779331_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779330_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779329_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779328_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779326_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779325_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779319_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779316_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779315_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779314_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779313_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779312_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779311_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779310_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779309_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779308_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779307_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779306_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779305_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779304_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779299_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779297_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779295_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779293_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779283_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779282_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779281_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779280_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779279_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779277_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779276_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779275_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779273_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779271_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779270_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779269_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779268_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779266_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779265_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779262_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779261_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779258_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779256_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779255_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779254_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779253_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779251_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779249_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779248_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779247_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779246_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779245_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779244_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779243_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779240_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779239_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779238_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779234_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779232_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779231_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779227_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779221_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF779210_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771969_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771965_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771955_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771952_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771940_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771922_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771919_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF771918_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476014_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476011_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476010_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476009_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476008_SHBs_P-A      QNSQSPTPNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476007_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476005_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476004_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476003_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476002_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476001_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF476000_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF475999_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF475998_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF475997_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF475996_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIMFLFILL-LCLIFLLVLLD
KF475994_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF475992_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF475990_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF475989_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF475987_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF475986_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF475985_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF475984_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF475983_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KF414678_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC885883_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC885870_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC885841_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC885834_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC885788_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC885689_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC885609_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC885591_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC885582_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC885581_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC885580_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC885570_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC836779_SHBs_P-A      QNSQSPTSNHSPTXCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
KC836778_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849595_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849321_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849320_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849319_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849313_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849299_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849296_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849295_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX849294_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX310732_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX310731_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX310730_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX310725_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX310724_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX310722_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX310721_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX125367_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
JX096953_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JX096952_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ911742_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707681_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707676_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707675_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707674_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707672_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707670_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707669_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707667_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707665_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707664_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707662_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707661_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707659_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707658_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707656_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707655_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707654_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707653_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707652_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707651_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707650_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707649_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707648_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707646_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707645_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707644_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707643_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707642_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707641_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707640_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707639_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707638_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707637_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707636_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707634_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707633_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707632_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707631_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707630_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707629_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707627_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707626_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707625_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707624_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707623_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707622_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707621_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707620_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707619_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707618_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707617_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707616_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707615_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707614_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707613_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707612_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707611_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707610_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707609_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707571_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707569_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707568_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707567_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707566_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707565_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707564_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707561_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707555_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707550_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707546_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707545_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707544_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707543_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707534_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707531_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707420_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707419_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707418_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707417_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707416_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707415_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707414_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707413_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707412_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707411_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707410_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707409_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707408_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707407_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707406_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707405_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707404_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707403_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707402_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707400_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707399_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707397_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRRMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707396_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707395_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707394_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707393_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707392_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707391_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707390_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707389_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707388_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707387_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707386_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707385_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707383_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707382_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707381_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707380_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707379_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707377_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707376_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707375_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707373_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707372_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707371_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707370_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707364_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707362_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707354_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707343_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707342_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707341_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707339_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707338_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707337_SHBs_P-A      QNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707336_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707333_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707332_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707322_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707321_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707320_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707319_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707316_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707315_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILL-LCLIFLLVLLD
JQ707313_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707312_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707311_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707309_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707308_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707307_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707303_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707302_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707301_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ707299_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JQ687529_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604319_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604315_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604307_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604306_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604304_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604303_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604300_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604299_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604297_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604294_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604293_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604292_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604291_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604283_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604282_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604279_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604277_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604276_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604274_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604273_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604270_SHBs_P-A      QNSQSPTSNHSXTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604269_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604268_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604266_SHBs_P-A      QNSRSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604262_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604257_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604255_SHBs_P-A      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604247_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604242_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604240_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604236_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604228_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604216_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604214_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604204_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604200_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604194_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604191_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604185_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604184_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604180_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604179_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604178_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604173_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604167_SHBs_P-A      QNSQSPTSNHSPTSCPPNCPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604164_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604162_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604160_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604159_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN604158_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN226093_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JN107758_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF440020_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF440018_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF440016_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439992_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLALLD
JF439988_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439986_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439985_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439984_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439983_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439980_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439978_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439974_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439971_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439970_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439969_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439968_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439967_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439966_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439963_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439962_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439960_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439959_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLALLD
JF439957_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439956_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLVFLLVLLD
JF439955_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439954_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439953_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439951_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439950_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439949_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439948_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439947_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439946_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439945_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439944_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439931_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLILLD
JF439860_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439859_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439858_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439856_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439854_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439853_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439851_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439848_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439847_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439845_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439844_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439839_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439838_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439837_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439835_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439834_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439833_SHBs_P-A      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLD
JF439831_SHBs_P-A