HBVdb

Dataset for protein HBc of genotype B

[Download (right click)] [Edit] [Sequences] [Repertoires]

2862 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


JX429911_HBc_P-B      MDIDPYKEFGASVELLS-FFLPSDFFPSIRDLLDTASALYQEALESPEHC
AB300371_HBc_P-B      MDIDPYKEFGASVELLS--FLPPDFFPNIRDLLDTAAALYRDALESPEHC
AB287318_HBc_P-B      MDIDPYKEFGASAELLS--FLPNDFFPSVRDLLDTAAALYREALESPQHC
KP659219_HBc_P-B      MDIDPYKEFGASSDLLS--FLPNDFFPSVRDLLDTAAALYREDLESPQHC
JN792901_HBc_P-B      MDIDPYKEFGATTELLS--FLPSDFYPSVRDLLDTAAALYRDALESPEHC
JN792902_HBc_P-B      MDIDPYKEFGATTELLS--FLPSDFFPSVRDLLDTAAALYRDALESPEHC
AB287317_HBc_P-B      MDIDTYKEFGATVELLS--FLPDDFFPSVRDLLDTAAALYREALECPEHR
AB073847_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTTAALYREALESPEHC
AB931168_HBc_P-B      MDIDPYKEFGATGELLS--FLPRDFFPSAQDLLDTAAALYREALESPEHC
AB931169_HBc_P-B      MDIDPYKEFGATGELLS--FLPRDFFPSAQDLLDTAAALYREALESPEHC
AB302095_HBc_P-B      MDIDPYKEFGATAELLS--FLPPDFFPSARDLLDTTAALYREALESPEHC
AB287316_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
AB287325_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASALYREALESPEHC
AB073853_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAALFRDALESPEHC
KP659223_HBc_P-B      MDIDTYKEFGASVELLS--FLPHDFYPSVRDLLDTATALYREALESPEHC
AB900103_HBc_P-B      MDIDPYKEFGASAELLS--FLPHDFFPSARDLLDTAAALYREALESPEHC
AB287327_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB287323_HBc_P-B      MDIDPYKEFGATVELLS--FLPTDFYPSVRDLLDTASALYREALESSEHC
AB106884_HBc_P-B      MDIDPYKEFGASVELLS--FLPPDFFPSARDLLDTAAALYREALESPEHC
AB073858_HBc_P-B      MDIDPYKEFGATAELLS--FLPADFYPSVRDLLDTATALYREALESPEHC
KP659254_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTASALYREALESPQHC
KP659239_HBc_P-B      MDIDPYKEFGATAELLS--FLPLDFFPSVRDLLDTAAALYRDALESPEHC
KP659234_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
DQ463799_HBc_P-B      MDIDPYKEFGASVNLLS--FLPADFFPSVRDLLDTASALYREALESPEHC
AB900106_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSVRDLLDTATALYREALESPEHC
AB073854_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
AB073852_HBc_P-B      MDIDPYKEFGATVELIS--FLPSDFFPSVRDLLDTATALYRDALESPEHC
DQ463790_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTATALYREALESSEHC
JN792900_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTATALYREALESTEHC
DQ463798_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
JN792899_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
AB828708_HBc_P-B      MDIDPYKEFGATTELLS--FLPIDFFPSVRDLLDTAAALYREALESPEHC
D50521_HBc_P-B        MDIDPYKEFGASVELLS--FLPADFFPSVHDLLDTASALYREALESPEHC
D50522_HBc_P-B        MDIDPYKEFGASVELLS--FLPADFFPSVHDLLDTASALYREALESPEHC
AB900108_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTATALYREALESPEHC
AB287320_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTATALYREALESPEHC
AB073849_HBc_P-B      MDIDPYKEFGASVELLS--FLPQDFFPSIRDLLDTAAALYRXALESPEHC
KP659240_HBc_P-B      MDIDPYKEFGASXELLS--FLPADFFPSVRDLLDTAXALYREALESPEHC
AB362933_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFYPSVRDLLDTAAALYREALESPEHC
AB900097_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTAAALYREALESPEHC
DQ463791_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
AB073857_HBc_P-B      MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAAALYREALESPEHC
AB900105_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTAAALYREALESPEHC
KP659249_HBc_P-B      MDIDPYKEFGASAELLS--FLPTDFFPSVRDLLDTAAALFRDALESPEHC
JN792894_HBc_P-B      MDIDPYKEFGATAELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
D00329_HBc_P-B        MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTVSALYREALKSPEHC
DQ463795_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASALFREALESPEHC
KP659244_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFYPSVRDLLDTASALYREALESPEHC
KP659248_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASALYRDALESPEHC
AB287319_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KP659224_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPDHC
KP659220_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
DQ463800_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASALYRDALESPEHC
JN792897_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASALYRDALESPEHC
JN792898_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASALYRDALESPEHC
DQ463796_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATALFREALESPEHC
DQ463787_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASALYREALESPEHC
AB900112_HBc_P-B      MDIDPYKEFGATVELLS--FLPQDFYPSVRDLLDTASALYREALESPEHC
JN792896_HBc_P-B      MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAAALFRDALESPEHC
DQ463797_HBc_P-B      MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAAALFREALESPEHC
JN792895_HBc_P-B      MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAAALFREALESPEHC
DQ463789_HBc_P-B      MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAAALFREALESPEHC
AB300370_HBc_P-B      MDIDPYKEFGATVELLS--FLPQDFFPSVRDLLDTAAALYREALESPEHC
DQ463802_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASALYREALESPQHC
DQ463792_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
AB642093_HBc_P-B      MDIDHYKEFGASVELLS--FLPXDFFPSVRDLLDTAXALYRDALESPEHC
AB642101_HBc_P-B      MDIDHYKEFGASVELLS--FLPQDFYPSVRDLLDTAAALYREALESPEHC
AB900111_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFYPSVRDLLDTAAALYRDALESPEHC
AB287321_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFYPSVRDLLDTAAALYREALESPEHC
AB246343_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
KP659245_HBc_P-B      MDIDPYKEFGATVELLS--FLPIDFYPSVRDLLDTAAALYREALESPEHC
DQ463794_HBc_P-B      MDIDPYKEFGATAELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
D23679_HBc_P-B        MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB900104_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB287322_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
AB014366_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB010290_HBc_P-B      MDIDPYKEFGASTELIS--FLPADFFPSVRDLLDTAAALYREALESPEHC
AB010291_HBc_P-B      MDIDPYKEFGATTELIS--FLPADFFPSVRDLLDTAAALYREALESPEHC
KP659251_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB073845_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB073843_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB073838_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
DQ463788_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
LT992442_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB010289_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB073846_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB073848_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB205121_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB246341_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB246342_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB287314_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB287315_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
LC279273_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
LC279272_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
LC279271_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
LC279270_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
LC279269_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
LC279268_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
KP659247_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
KP659246_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
KP659235_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
KP659237_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
MH932712_HBc_P-B      MDIDPYKEFGATAELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB900107_HBc_P-B      MDIDPYKEFGATSELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB900098_HBc_P-B      MDIDPYKEFGATXELXS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
D23678_HBc_P-B        MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTAAALYREALESPQHC
AB073856_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB073850_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPVHC
AB073851_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFYPSVRDLLDTAAALYREALESPEHC
AB900095_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB073844_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
AB287326_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
KU964276_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964283_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964272_HBc_P-B      MDIDPYKEFGASVELLF--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964273_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964274_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964275_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964277_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964278_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964279_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964281_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964282_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964284_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964285_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964280_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSMRDLLDTAAALYREALESPEHC
KU964286_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSMRDLLDTASALYREALESPEHC
KY881845_HBc_P-B      MDINTYKEFRASVELLS--FLPSDFFPSIRNLLDTASALYREALESPEHC
KU668369_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU668003_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRNLLDTANALYREALESPEHC
FJ562260_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTANALYRESLESPEHC
AB073841_HBc_P-B      MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
EU939678_HBc_P-B      MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AP011094_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576069_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALEAPEHC
KU576070_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALEAPEHC
KU576501_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KU576496_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDLFPSIRDLLDTASALFREALESPEHC
KU576507_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALFREALESPEHC
HM011467_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
FJ562311_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY800391_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTANAMFREALESPEHC
AY800392_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTANAMFREALESPEHC
KX276791_HBc_P-B      MDIDTYKEFGASVELLS--FLPADFFPSIRDLLDTASALYREALESPEHC
KU667929_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP406186_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406187_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406188_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406189_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406192_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406194_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406195_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406197_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406198_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406199_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406200_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406203_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406208_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406210_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406214_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406216_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406217_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406219_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406190_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406191_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406193_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406196_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406201_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406202_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406204_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406205_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406206_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406207_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406209_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406211_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406212_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406213_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406215_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406218_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276800_HBc_P-B      MDIDTYKEFGASVELXS--FLPXDFFPSIRDLLDTATALYREALESPEHI
KM875418_HBc_P-B      MDIDLYKEFGASVELLS--FLPTDFFPNIRDLLDTATALYREALESPEHW
KU964386_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964387_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964389_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964390_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964392_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964396_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964381_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964382_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964383_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964384_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964385_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964388_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964391_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964393_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964395_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964397_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571354_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
JQ027315_HBc_P-B      MDIDLYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
MG571353_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALHRQALESPEHC
MG571376_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALHRQALESPEHC
MF674440_HBc_P-B      MDIDPYKEFGASVPLLS--FLPADFFPSIRDLLDTATALYREALESPEHV
KY689481_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KX276783_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFXPSVRDLLDTATALYREALESPEHC
KP406277_HBc_P-B      MDIDTYKEFGASVELLA--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP406276_HBc_P-B      MDIDTYKEFGASVELLA--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP406275_HBc_P-B      MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP406264_HBc_P-B      MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATALYREALESPEHC
EU939674_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ899790_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ899791_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ027312_HBc_P-B      MDIDPYKEFGASVELXS--FLPTDFFPXVRDLLDTASALYREALESPEHC
KP406255_HBc_P-B      MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP406263_HBc_P-B      MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP406265_HBc_P-B      MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP406268_HBc_P-B      MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP406270_HBc_P-B      MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP406272_HBc_P-B      MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP406278_HBc_P-B      MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP406279_HBc_P-B      MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP406261_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ801474_HBc_P-B      MDIDPYKEFGASIELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KU964257_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964259_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964260_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964261_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964262_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964263_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964264_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964265_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964266_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964267_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964268_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964269_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964270_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIQDLLDTATALYREALESPEHC
KU964271_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ027325_HBc_P-B      MDIDPYKEFGASXELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU577046_HBc_P-B      MDIDPYKEFGASVELLS--FLPNDFFPNMRDLLDTATALYREALESPEHC
KU577048_HBc_P-B      MDIDPYKEFGASVELLS--FLPNDFFPNMRDLLDTATALYREALESPEHC
KU577047_HBc_P-B      MDIDPYKEFGASVELLS--FLPNDFFPNMRDLLDTATALYREALESPEHC
JQ027311_HBc_P-B      MDIDPYKEFGASXXLLS--FLPADFFPSVHDLLDTATALYREALESPEHC
KX276773_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAXALYREALESPEHC
KU576713_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
AB900110_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KU668309_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRNLLDTANALYREALESPEHC
KU667987_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU576702_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU576707_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU667997_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU668332_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU576718_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
FJ032342_HBc_P-B      MDIDPYKEFGASAELIS--FLPSDFFPNIRDLLDTASALYREALESPEHC
HM011487_HBc_P-B      MDIDPYKEFGATTELVS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ993683_HBc_P-B      MDIDPHQEFGSSVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
X98077_HBc_P-B        MDIDPYKEFGASVELLS--FLPSDFFPAVRDLLDTASALYREALESPEHC
EU522072_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU522073_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASALYREALESPEHC
EU522075_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASALYRKALESPEHC
HM011490_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571352_HBc_P-B      MDIDTYKEFGASVELLS--FLPADFFPSIRDLLDTASALYREALESPEHC
MF674439_HBc_P-B      MDIDPYKEFGASSQLLS--FLPSDFFPSVRDLLDTASALYQEALESPEHC
KY881838_HBc_P-B      VDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KY689444_HBc_P-B      MDIDPYKEFGASVELIS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689406_HBc_P-B      MDIDPYKEFGASTELLS--FLPSDFFPSVRDLLDTATALYREALESPEHC
EU487256_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881831_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881828_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881827_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881826_HBc_P-B      MDIDTYKEFGASVESLS--FLPSDFFPSIRDLLDTASALRREALESPEHC
KY881795_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341490_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JF436921_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF282918_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF568474_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATALYREALESPEHC
KY881861_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881850_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KY689562_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KY689417_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
X97851_HBc_P-B        MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571370_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571327_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
MF674505_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
LC349869_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689423_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASALYREALESPEHC
MK818222_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPXIRDLLDTAXALXREXLESPEHC
MG571373_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571372_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881856_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881851_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDAASALYREALESPEHC
KY881843_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881842_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881841_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881839_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881836_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881835_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881833_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881830_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KY881829_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881824_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881823_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881822_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881821_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881820_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KY881788_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689483_HBc_P-B      MDIDXYKEFGASVELLS--FLPSDFFPSXRDLLDTATALYREALESPEHC
KY689476_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASALYREALESPEHC
KY689419_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY470840_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY470832_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX765854_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276830_HBc_P-B      MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674498_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
LC349875_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
LC349872_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
LC349870_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881912_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689551_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689507_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689506_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689505_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689410_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY470839_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY470838_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY470836_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY470835_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY470833_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY470830_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MK052964_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571374_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571350_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPTIRDLLDTASALYREALESPEHC
MG571338_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTSSALYREALESPEHV
MG571334_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674503_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674487_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674470_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674469_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674420_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674401_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674391_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
LC349877_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881867_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689564_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689556_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYRDALESPEHC
KY689523_HBc_P-B      MDIDXYKEFGFSVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689511_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689496_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689458_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689451_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY629635_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY470841_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY470837_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY470834_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571341_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571324_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674436_HBc_P-B      MDIDPYKEFGASVELIS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KY881914_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881913_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881911_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881910_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881909_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881908_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881907_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881906_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881905_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KY881904_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881903_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KY881902_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KY881901_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881900_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881899_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881898_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881897_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881896_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881895_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881894_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881893_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881868_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881866_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881863_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KY881862_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALCREALESPEHC
KY881860_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881859_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881858_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881857_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881855_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881854_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881852_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881848_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881847_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFYPSIRDLLDTASALYREALESPEHC
KY881846_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881844_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KY689557_HBc_P-B      MDIDPYKXFGASVELLS--FLPSDFFPSIRDLLDTASALXREALESPEHC
KY689484_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYRDALESPEHC
KY689426_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MK818225_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
LC349868_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571363_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KY689560_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689559_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689503_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASALYREALESPEHC
KY689490_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689488_HBc_P-B      MDIDTYKPFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
MG571357_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASALYREALESPEHC
MG571331_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KX276829_HBc_P-B      MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689404_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLXDTASALYREALESPEHC
KP659255_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTAAALYRESLESPEHC
FJ386648_HBc_P-B      MDIDTYKEFGASLELLS--FLPSDFFPSIRDLLDTAAALYREALESPVHC
AB287324_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSARDLLDTASALFREALESPEHC
AY269102_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTASALYREALESPEHC
KP659221_HBc_P-B      MDIDPYKEFGASEELLS--FLPSDFFPSARDLLDTASALFREALESPEHC
GQ924641_HBc_P-B      MDIDPYKEFGASAELLS--FLPTDFYPSVRDLLDTASALYREALESPEHC
KP659250_HBc_P-B      MDIDPYKEFGATAELLS--FLPLDFFPSARDLLDTAAALYREALESPEHC
KJ803824_HBc_P-B      MDIDPYKEFGASTELLS--FLPSDFLPSIRDLLDTASALFREALESPEHC
EU487257_HBc_P-B      MDIDPYKEFGASVPLLS--FLPSDFFPSIRDLLDTATALYGEALESPEHC
AY596111_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KJ803773_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTALALYREALDSPEHC
AJ298864_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
AB073824_HBc_P-B      MDIDPYKEFGASVELIS--FLPADFFPSIRDLLDTASALYREALESPEHC
KU667951_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRNLLDTATALYREALESPKHC
KU667859_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667528_HBc_P-B      MDIDTYKEFGASVELLS--FLPNDFFPSIRDLLDTASALYREALESPEHC
JQ341492_HBc_P-B      MDIDPYKEFGASVELIS--FLPADFFPSIRDLLDTASALYREALESPEHC
KU576131_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHV
KU576125_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHV
KU576126_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHV
KU576130_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHV
KP659253_HBc_P-B      MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASALYREALESPEHC
FJ386688_HBc_P-B      MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ386660_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
EU882002_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KU667539_HBc_P-B      MDIDTYKEFGASLELLS--FLPGDFYPSIRDLLDTASALYREALESPEHC
KU576628_HBc_P-B      MDMDTYKEFGASLELPS--FLPGDFYPSIRDLLDTASALYREALESPEHC
KU576145_HBc_P-B      MDIDTYKEFGASLELLS--FLPGDFYPSIRDLLDTASALYREALESPEHC
KU576736_HBc_P-B      MDIDTYKEFGASLELLS--FLPGDFYPSIRDLLDTASALYREALESPEHC
KU576749_HBc_P-B      MDIDTYKEFGASLELLS--FLPGDFYPSIRDLLDTASALYREALESPEHC
KU667549_HBc_P-B      MDIDTYKEFGASLELLS--FLPGDFYPSIRDLLDTASALYREALESPEHC
KU668293_HBc_P-B      MDIDTYKEFGASLELLS--FLPGDFYPSIRDLLDTASALYREALESPEHC
MG571358_HBc_P-B      MDIDPYKEFGASAELIS--FLPHDFFPSIRDLLDTASALYREALESPEHC
KX276789_HBc_P-B      MDIDPYKEFGASSELLS--FLPSDFFPTIRDLLDTASALYREALESPEHC
KU668081_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KU667517_HBc_P-B      MDIDTYKEFGASLELLS--FLPNDFFPSIRDLLDTASALYREALESPEHC
KU576648_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576148_HBc_P-B      MDIDTYKEFGASLELLS--FLPTDFFSSIRVLLDTASALYREALESPEHC
JX504533_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
JQ341503_HBc_P-B      MDIDPYKEFGGSVELLS--FLPSDFFPTIRDLLDTASALYREALESPEHC
KU668252_HBc_P-B      MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASALYREALESPEHC
KU668241_HBc_P-B      MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASALYREALESPEHC
KU576921_HBc_P-B      MDIDPYKEFGASMELLS--FLPADFSPSIRDLLDTASALYREALESPEHC
KU668222_HBc_P-B      MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASALYREALESPEHC
KU668270_HBc_P-B      MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASALYREALESPEHC
KU668333_HBc_P-B      MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASALYREALESPEHC
KU668342_HBc_P-B      MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASALYREALESPEHC
KU668353_HBc_P-B      MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASALYREALESPEHC
KU668232_HBc_P-B      MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASALYREALESPEHC
KU668277_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU668261_HBc_P-B      MDIDPYKEFRASMELLS--FLPADFFPSIRDLLDTASALYREALESPEHC
KU667420_HBc_P-B      MDIDPYEEFGASVELLS--FLPTDFFPSIRDPLDTASALYREALESPEHC
KU576522_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KU576287_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDVFPSIRDLLDTAAALYREALESPEHC
KU576280_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDVFPSIRDLLDTAAALYREALESPEHC
KU576127_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSTRDLLDTASALYREALESPEHV
KP659252_HBc_P-B      MDIDPYKEFGASAELLS--FLPNDFFPSARDLLDTASALYREALESPEHC
KJ803775_HBc_P-B      MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASALFREALESPEHC
EU939661_HBc_P-B      MDIDPYKEFGASAELLS--FLPTDFFPSIRDLLDTATALYREALESPEHC
EU939559_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY167100_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668357_HBc_P-B      MDIDQYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU668302_HBc_P-B      MDIDTYKEFGASLELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU668278_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDPLDTATALYREALESPEHC
KU668259_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATALYREALESPEHC
KU668238_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATALYREALESPEHC
KU668229_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATALYREALESPEHC
KU668019_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KU668060_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KU667680_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDLFPSVRDLLDTASALYREALESPEHC
KU576383_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576381_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EF134945_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY269108_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSIRELLDTASAQYREALESPEHC
AF282917_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHS
MF674478_HBc_P-B      MDIDPYKEFGASAELVS--FLPNDFFPSVRDLLDTASALYREALESPEHC
KX276809_HBc_P-B      MDIDPYKEFGATVELLS--FLPNDFFPSMRDLLDTASALYREALESPEHC
KU668193_HBc_P-B      MDIDPYKEFGTSVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU668059_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576495_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU576385_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406299_HBc_P-B      MDIDPYKEFGASAELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KM526755_HBc_P-B      MDIDLYKEFGASEELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KJ410500_HBc_P-B      MDIDPYKEFGASVELLS--FLPQDFFPSVRDLLDTASALYREALESPEHC
JQ341469_HBc_P-B      MDIDPYKEFGASIELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB023677_HBc_P-B      MDIDPYKEFGASVELLS--FWPSDFFPSIRDLLDTASALYREALESPEHC
KU576611_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATALYREALESPEHC
KU576613_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATALYREALESPEHC
KU576616_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATALYREALESPEHC
KU576622_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATALYREALESPEHC
KU668202_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATALYREALESPEHC
KU668249_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATALYREALESPEHC
KU668290_HBc_P-B      MDIDPYKEFGASVELLS--LLPSDFFPTIRDLLDTATALYREALESPEHC
MG826152_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTTAALYREALESPEHC
KU668170_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDPLDTASALYREALESPEHC
KU667996_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667955_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667777_HBc_P-B      MDIDPYKEFGASVELLS--FSPSDFFPSIRDLLDTASALYREALESPEHC
KU667739_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576753_HBc_P-B      MDIDTYKEFGASLELLS--FLPGDFYPSIRDLLDTASALYREALESPEHC
KU576380_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYQEALESPEHC
KU576302_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSTRDLLDTASALYREALESPEHC
KP406170_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406169_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406174_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM526756_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173368_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341462_HBc_P-B      MDIDPYKEFXASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EF473971_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ995801_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480343_HBc_P-B      MDIDLYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB241116_HBc_P-B      MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB241117_HBc_P-B      MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674492_HBc_P-B      MDIDPYKEFGASIELVS--FLPGDFFPSIRDLLDTASALYREALESPEHC
KY689453_HBc_P-B      MDIDPYKEFGASTELIS--FLPSDFFPSIRDLLDTAFALYREALESPEHC
KX276793_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276774_HBc_P-B      MDIDPYKEFGASVELLS--FLPXDFFPSIRDLLDTASALYREALESPEHC
KU668287_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALEPPEHC
KU668265_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668173_HBc_P-B      MDIDPYKESGASVELLS--FLSPDFFPSIRDLLDTASALYREALESPEHC
KU667944_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATALYREALESPEHC
KU667555_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576397_HBc_P-B      MDIGSYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406175_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406172_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KP406168_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSTRDLLDTASALYREALESPEHC
KJ803805_HBc_P-B      MDIDPYKEFGASMDLIS--FLPSDFFPNIRDLLDTASALYREALESPEHC
HM011478_HBc_P-B      MDIDPYKEFGASXZLLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EF134946_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY517620_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALNREALESPEHC
AB908303_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESLEHC
AB246340_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276828_HBc_P-B      MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276772_HBc_P-B      MDIDPYKEFGASXELLS--FLPSDFFPSIRDLLDTASALYREALESPEHX
KU964120_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU964115_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU964113_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU964111_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU668336_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668124_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667649_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFLPSIRDLLDTASALHREALESPEHY
KU667422_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU576636_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576391_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576132_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KU576090_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATALCREALESPEHC
KU576088_HBc_P-B      MDIDPYKEFGAFVELLS--FLPSDFFPSIRDLLDTASALYRETLESPEHC
KP406273_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KJ803821_HBc_P-B      MDIDPYKEFGASAELLS--FLPHDFFPSIRDLLDTASALYREALESPEHC
KJ803789_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173362_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
JX504532_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ993707_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALEAPEHC
KY689433_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
KX276808_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAXAXYREALESPEHC
KX276786_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276784_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KX276775_HBc_P-B      MDIDPYKEFGASAELXS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668366_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU668308_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYRKALESTEHC
KU668307_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU668157_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDPLDTASALYREALESPEHC
KU667874_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667860_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667780_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667612_HBc_P-B      MDIDPYKEFGAPVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667457_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667439_HBc_P-B      MDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASALYREALESPEHC
KU667438_HBc_P-B      MDIDPYKEFEASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667412_HBc_P-B      MDIDPYKEFGASVELFS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU576989_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576988_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576691_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPNVRDLLDTASALYREALESPEHC
KU576618_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASALYRDALESPEHC
KU576609_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576606_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576598_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576597_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576322_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576279_HBc_P-B      MDIDPYKEFGASAELVS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576189_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576173_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576041_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575977_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPERC
KU575927_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406266_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KP406254_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406253_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406252_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406251_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406250_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406249_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406248_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406247_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406246_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406245_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406244_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148332_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASALYREALESPEHC
KJ843165_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIQDLLDTASALYREALESPEHC
KJ803819_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ803796_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KJ803752_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KC774406_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774370_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774368_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815778_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815640_HBc_P-B      MDIDPYKEFGASVELLP--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924625_HBc_P-B      MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ358143_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144599_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480348_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF100309_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB713528_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB493835_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDAASALYREALESPEHC
AB073837_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674448_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSIRELLDTASALYREALESPEHC
KX276807_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSIRELLDTASALYREALESPEHX
KX276801_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276799_HBc_P-B      MDIDPYKEFGASAELLS--FLPXDFFPSVRDLLDTASALYREALESPEHC
KX276782_HBc_P-B      MDIDPYKEFGASXELLS--FLPADFFPSVRDLLDTASALYREALESPEHC
KU964104_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668316_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668306_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668250_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668076_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYRKALESPEHC
KU668012_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDIASALYREALESPEHC
KU667936_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALEPPEHC
KU667869_HBc_P-B      MDIDPYKESGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667733_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLPDTASALYREALESPEHC
KU667448_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU576746_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576600_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRELLDTASALYRDALESPEHC
KU576467_HBc_P-B      MDIDPYKEFGASVELPS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576402_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576395_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576386_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLHDTASALYREALESPEHC
KU576018_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPQHC
KU575979_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575966_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KU575959_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406166_HBc_P-B      MDIDPFKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406163_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148364_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRALLDTASALYREALESPEHC
KM875420_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM213035_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ803820_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173348_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALKSPEHC
JX429908_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX429897_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAPALYREALESPEHC
KY353930_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KX276771_HBc_P-B      MDIDPYKEFGASAQLLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964158_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU668289_HBc_P-B      MDIDPYKEFGTSVELLS--FLPSDFFPNIRDLLDTASALYREASESPEHC
KU668099_HBc_P-B      MDIDPYKEFGASVELLP--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667794_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDSFPSIRDLLDTASALYREALESPEHC
KU667787_HBc_P-B      MDIDPYKEFGASVELLS--FLSSNFFPSIRDLPDTASALYREALESPEHC
KU667700_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667676_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667590_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667516_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576970_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRGLLDTASALYREALESPEHC
KU576466_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576411_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576398_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576387_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU576338_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576185_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576165_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576015_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPQHC
KU575983_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575971_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSMRDLLDTASALYREALESPEHC
KP406185_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406184_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406183_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406182_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406181_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406180_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406179_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406178_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406177_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406176_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148579_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDAASALYREALESPEHC
KP148392_HBc_P-B      MDIDPYKEFGASVESLS--FLPSDFFPPIRDLLDTASALYREALESPEHC
KP148382_HBc_P-B      MDIDPYKEFGASVELLP--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173373_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX869998_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX504531_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ801516_HBc_P-B      MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341482_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALXSPEHC
MG571325_HBc_P-B      MDIDPYKEFGAPVELIS--FLPXDFFPSARDLXDTASALYXEALESPEHC
MF674496_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964165_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964164_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964155_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASALYREALESPEHC
KU963989_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963988_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963987_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963986_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963985_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963984_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963983_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963982_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963981_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963980_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963979_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963978_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963977_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963976_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963975_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963974_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963973_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963972_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963971_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963970_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963969_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963968_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963967_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963965_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963964_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963963_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963962_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963960_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963959_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963958_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963957_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963955_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963954_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963953_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963952_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963951_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963950_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963949_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963948_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963947_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963946_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963945_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963855_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963854_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963853_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963852_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963851_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963850_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963849_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963848_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963847_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963846_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963845_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963844_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963843_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963842_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963841_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963840_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963839_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963838_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963837_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963836_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963835_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963834_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963833_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963832_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963831_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963830_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963829_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963828_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963827_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963826_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963825_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963824_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963823_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963822_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963821_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963820_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963819_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963818_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963817_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963816_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963815_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963814_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963813_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963812_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963811_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963810_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963809_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963808_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963807_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963806_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963805_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963804_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963803_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963802_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963801_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963800_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963799_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668345_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668344_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668330_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU668323_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLGTASALYREALESPEHC
KU668300_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU668234_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668149_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668133_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668115_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668102_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668101_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668098_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668097_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668061_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668009_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU668002_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667980_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667956_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYRGALESPEHC
KU667823_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667702_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTSSALYREALESPEHC
KU667695_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667686_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667659_HBc_P-B      MDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASALYREALESPEHC
KU667577_HBc_P-B      MDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASALYREALESPEHC
KU667569_HBc_P-B      MDIDPYKEFEASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667551_HBc_P-B      MDIDPYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KU667540_HBc_P-B      MDIDPYKEFEASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667515_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667484_HBc_P-B      MDIDPYKEFGASVELHS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667469_HBc_P-B      MDIDPYKEFEASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667460_HBc_P-B      MDIDPYKEFEASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667427_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU577121_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU577120_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU577117_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU577115_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU577111_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU577081_HBc_P-B      MDIDPYKEFGASVELLS--FLPSGFFPSIRDLLDTASALYREALESPEHC
KU577004_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFLSIRDLLDTASALYREALESPEHC
KU576985_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576984_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576983_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576982_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576981_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576980_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576978_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576940_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576873_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576872_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576871_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576870_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576869_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576868_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576867_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576866_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576806_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576804_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576794_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576793_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576792_HBc_P-B      MDIDPYKEFGAAVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576788_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576785_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576784_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576783_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576782_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576781_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576780_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576777_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576624_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASALYRDALESPEHC
KU576460_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576420_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576327_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576326_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576325_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576324_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576321_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576320_HBc_P-B      MDIDPYKEFGAPVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576319_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576310_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576309_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRGLLDTASALYREALESPEHC
KU576191_HBc_P-B      MDIDPYKEFGASLELIS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576052_HBc_P-B      MDIDPYKEFGASVELLS--FLPSGFFPSIRDLLDTASALYREALESPEHC
KU576045_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576043_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576039_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576024_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576022_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575984_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575982_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575980_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575978_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575976_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHR
KU575975_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575974_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575973_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575953_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575945_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575942_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575937_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575928_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575922_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU234318_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KR232337_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KR152339_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148583_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148582_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHY
KP148580_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148461_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148457_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148456_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148455_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148453_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148451_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148403_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148402_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148401_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148400_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148398_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148397_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148396_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIQDLLDTASALYREALESPEHC
KP148395_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148394_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148391_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148390_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148389_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148388_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148387_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148386_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148385_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148384_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148383_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148380_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148379_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148378_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148377_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148376_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148375_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148374_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148373_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148372_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148371_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148370_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148369_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148368_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148367_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148365_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148363_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148362_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148360_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148359_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148357_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148356_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148349_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148348_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148347_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148346_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148345_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDIFPSIRDLLDTASALYREALESPEHC
KP148343_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148342_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148341_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148340_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148339_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148338_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148336_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148335_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148334_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148333_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148331_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148330_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148328_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148327_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148324_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148323_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148321_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148320_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148319_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148318_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148314_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM526759_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM526758_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM526754_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM526751_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM526750_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM526748_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM526747_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM392084_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM392083_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM392072_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM359440_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM213032_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ803795_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KJ803787_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASALYREALESPEHC
KJ803783_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KJ803764_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ803763_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ410517_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ410516_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ410507_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ410490_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173425_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173424_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173423_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173422_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173421_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173420_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173417_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173416_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173415_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173414_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173413_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173412_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173411_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173410_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173409_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173408_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173407_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173406_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173405_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173402_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173401_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173400_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173399_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173398_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173397_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173390_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173389_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173388_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173387_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173386_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173383_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KJ173382_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173381_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173380_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KJ173377_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KJ173376_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173375_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173374_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173370_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173369_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173367_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173366_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173365_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173364_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173363_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173361_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173360_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173359_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173357_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173356_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173355_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173354_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173353_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173352_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173351_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173347_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173345_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173343_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173342_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173341_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173340_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173339_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173297_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KF167010_HBc_P-B      MDIDPYKEFGASVELLS--FLPPDFFPSVRDLLDTASALYREALESPEHC
KF165328_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC836874_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC836872_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASALYREALESPEHC
KC836865_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC836864_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC836863_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC836861_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC836857_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC836853_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC836847_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC836843_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC836841_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC836830_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774418_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774417_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774416_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774413_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774412_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774411_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774409_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774408_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KC774407_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774404_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774403_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774402_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774401_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774399_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774398_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774396_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASALYREALESPEHC
KC774393_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774392_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774391_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774390_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774388_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774387_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774386_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774385_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774384_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774382_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774381_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774380_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774379_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774378_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774376_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KC774375_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774374_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774373_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774372_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774369_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774367_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774366_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774363_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510660_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510659_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510658_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510657_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510656_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510655_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510654_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510653_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510652_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510651_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510650_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510649_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510648_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510647_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510646_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510644_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510643_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510642_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC510641_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX978431_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX870001_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX869999_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX661484_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX661483_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX661482_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX661481_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX661480_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX661479_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX661478_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX661477_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX661476_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX661475_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX661474_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX661473_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX661472_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX661471_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX661470_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX507215_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX507210_HBc_P-B      MDIDPYKEFGASVELLS--LLPSDFFPSIRDLLDTASALYREALESPEHC
JX429902_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX429899_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ801514_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ801512_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ801507_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ801479_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ801471_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ688405_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ429081_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341530_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341510_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341501_HBc_P-B      MDIDPYKEFGATVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
JQ341496_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341485_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341484_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341483_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341481_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341477_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341470_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341465_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341464_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341461_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341459_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ040173_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ040171_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ040170_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ040125_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ027316_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674491_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674465_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
MF674392_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964107_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964105_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964102_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964101_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964100_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964098_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964096_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668337_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668318_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPNIRDLLDTDSALYREALESPEHC
KU668297_HBc_P-B      MDIDPYKEFGASVELLS--LLPSDFFPSIRDLLDTASALYREALESPEHC
KU668274_HBc_P-B      MDIDPYKEFEASVELLS--SLPSDFFPSIRDLLDTASALYREALESPEHC
KU668256_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668105_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASALYRDALESPEHC
KU667520_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576499_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576493_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576470_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576419_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576412_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576408_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576406_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576401_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576400_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576399_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575981_HBc_P-B      MDIDPYKEFGASVVLLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KJ803786_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341467_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALXREALESPEHC
X97850_HBc_P-B        MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674461_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689445_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674409_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
JQ429080_HBc_P-B      MDIDPYKEFGASVELLS--FLPXDFFPSIRDLLDTASALYREALESPEHC
JQ341515_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ429079_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KX276785_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ027313_HBc_P-B      MDIDPYKEFGASXELLS--FLPXDFFPSXRDLXDTASALYREALESPEHC
KX276794_HBc_P-B      MDIDPYKEFGASXELLS--FLPXDFFPSIRDLLDTASALYREALESPEHC
EU564822_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASALYREALESPEHC
EU564823_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASALYREALESPEHC
EU564824_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASALYREALESPEHC
DQ993684_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASALYREALESPEHC
EU547563_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
HM011496_HBc_P-B      MDIDTYKEFGASAELLS--FLPSDFFPNIRDLLDTANALYREALESPEHC
FJ562312_HBc_P-B      MDIDVYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
EU570075_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALFREALESPEHC
FJ032344_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALFREALESPEHC
FJ386656_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASAMFREALESPEHC
GQ924638_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALFREALESPEHC
GQ924635_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASALYREALESPEHC
EU579441_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALFREALESPEHC
FJ386608_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALFREALESPEHC
AY167098_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASALYREALESPEHC
GU815578_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU660230_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU660231_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU660232_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU660233_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306681_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306679_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306680_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF461360_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY800389_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306677_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306678_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815574_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815577_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB073825_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
HM011476_HBc_P-B      MDIDPYKEFGASIELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ904357_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY269105_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU939675_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
EU939635_HBc_P-B      MDIDPYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
AB219427_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668014_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALKSPEHC
KU576303_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576299_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576308_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ386658_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU158263_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB023667_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
AB212626_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ562257_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576300_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341476_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ751766_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
AB365445_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB023682_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTISALYREALESPEHC
KU667473_HBc_P-B      MDIDPYKESGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
HM011480_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
EU919175_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASALYREALESPEHC
EU919176_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASALYREALESPEHC
AY220697_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
FJ787475_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964258_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
EU939663_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
EU939669_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
FJ899779_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
AY517488_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
HM011492_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406330_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406332_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406333_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406334_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF157021_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF157022_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341466_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASAMYREALESPEHC
DQ361535_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY269109_HBc_P-B      MDIDPYKEFRASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU882003_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY220703_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY220704_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU939639_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF335751_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESREHC
FJ386681_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU660224_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB642094_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU881997_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU881998_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU882004_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ032349_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ386675_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ562289_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377519_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF324082_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668305_HBc_P-B      VDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTATALYREALESPEHC
FJ562231_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406335_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY596112_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB031267_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHI
FJ562253_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667968_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667481_HBc_P-B      MDIDPYKESGASVELLS--FLPSDFLPSIRDLLDTASALYREALESPEHC
FJ751769_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667740_HBc_P-B      MDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASALYREALESPEHC
MF568475_HBc_P-B      MDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASALYREALESPEHC
KX276792_HBc_P-B      MDIDVYKEFGASVELLS--FLPSDFFPSIRDLLDTXSALHREALESPEHC
KU668304_HBc_P-B      TDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASALYREALESPEHC
KU576924_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406164_HBc_P-B      MDIDPFKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM526757_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALFREALESPEHC
KC774397_HBc_P-B      MDIDPYKEFGASIELLS--FLPSDFFPSIRDLLDTASALFREALESPEHC
KP148581_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU827630_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EF494381_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY269128_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY206375_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276818_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTVSALYREALESPEHC
KU667993_HBc_P-B      MDIDPYKESGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667647_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667640_HBc_P-B      MDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASALYREALESPEHC
KU576307_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576301_HBc_P-B      MDIDPYKEFGAFVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406240_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP406238_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP406234_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JX429901_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ040147_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667957_HBc_P-B      MDIDPYKEFGASVGLLS--FLPSDFFPSIRDLLDTTSALYREALEPPEHC
KU668008_HBc_P-B      MDIDPYKEFGASVELPS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341508_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668165_HBc_P-B      MDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASALYREALESPDHC
KU667768_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667701_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667506_HBc_P-B      MDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASALYREALESPEHC
KU667455_HBc_P-B      MDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASALYREALESPEHC
KU667447_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576638_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576297_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575940_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575938_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASALYREALESPEHC
KP406243_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406242_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406241_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406237_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406236_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406235_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406233_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406232_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406231_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406230_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406229_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406228_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406227_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406225_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406224_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406223_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406222_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406221_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406220_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM875417_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM875416_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341480_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276815_HBc_P-B      MDIDPYKEFGASVELIS--FLPSDFFPSIRDLLDTASALYREALESPEHC
HM011469_HBc_P-B      MDIDPYKEFGASVELIS--FLPSDFFPSIRDLLDTASALYREALESPEHX
KX276822_HBc_P-B      MDIDPYKEFGASVELIS--FLPSDFFPSIRDLLDTASALYREALESPEHX
KU667788_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667774_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667752_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667763_HBc_P-B      MDIDPYKGFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667836_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667827_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667729_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667800_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
EU939636_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFYPSIRDLLDTASALYREALESPEHC
GQ924630_HBc_P-B      MDIDTYKEFGASVELLS--FLPVDFYPSIRDLLDTASALYREALESPEHC
HM011471_HBc_P-B      MDIDPYKEFGASIELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KJ803768_HBc_P-B      MDIDVYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU939671_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KY689469_HBc_P-B      MDIDTYKEFGASVELLS--FLPNDFFPNIRDLLDTAAALHREALESQEHC
KY689516_HBc_P-B      MDIDTYKEFGASVELLS--FLPNDFFPNIRDLLDTAAALHREALESQEHC
GQ924645_HBc_P-B      MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924632_HBc_P-B      MDIDPYKEFGASVQLLS--FLPSDFFPSIRDLLDTASALYREALESPEHV
KU576087_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
AB205122_HBc_P-B      MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668258_HBc_P-B      MDTDPYKEFGAPVELLP--FLSSDFFPSIRDILDTASALYREALESPEHC
KU668027_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148459_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KC774419_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIQDLLDTASALYREALESPEHC
EF473973_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDSFPSIRDLLDTASALYREALESPEHC
KU576654_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576306_HBc_P-B      MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924628_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASALYREALESPEHC
FJ562234_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576146_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM875427_HBc_P-B      MDIDTYKEFGASVELLS--FLPADFFPSIRDLLDTASALYREALESPEHC
JQ801506_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ562236_HBc_P-B      MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB073823_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU577107_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406165_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406167_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815587_HBc_P-B      MDIDPYEEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377610_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ562259_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB212625_HBc_P-B      MDIDTYKEFGASAELLS--FLPSDFFPTIRDLLDTATALYREALESPEHC
KU667840_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667508_HBc_P-B      MDIDPYKEFEASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667445_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576655_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576304_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX504538_HBc_P-B      MDTDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341475_HBc_P-B      MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESQEHC
GQ924639_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023633_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667879_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU576653_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576639_HBc_P-B      MDMDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576295_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576288_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPPIRDLLDTASALYREALESPEHC
KU576051_HBc_P-B      MDIDTYKAFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406171_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341493_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHV
GU815573_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924610_HBc_P-B      MDIDRYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377561_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ386654_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ386642_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU939670_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964168_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU577003_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KF165906_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KF164967_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KC492739_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ707739_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707738_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707737_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707735_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707734_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
FJ386636_HBc_P-B      MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY167097_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF233234_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB908299_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB031268_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571333_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KU668299_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU668100_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406173_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ027330_HBc_P-B      MDIDXYKEFGASVELLS--FLPSDFFPSXRDLLDTASALYREALESPEHV
JQ027331_HBc_P-B      MDIDXYKEFGASVELLS--FLPSDFFPSXRDLLDTASALYREALESPEHV
GU815572_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ592177_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276777_HBc_P-B      MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964108_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668358_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU668103_HBc_P-B      MDVDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU667619_HBc_P-B      MDVDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU576331_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHI
KU576155_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576100_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTTSALYREALESPEHC
KU576042_HBc_P-B      MDIDPYREFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576026_HBc_P-B      MDIDPYEEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406162_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148452_HBc_P-B      MDTDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM526752_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM213036_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774410_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774400_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964167_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964166_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964163_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964162_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964161_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964160_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964159_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964157_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964156_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964154_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASALYREALESPEHC
KU964153_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576969_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576968_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576255_HBc_P-B      MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576254_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576251_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576154_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576151_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576150_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576149_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576020_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPQHC
KU575941_HBc_P-B      MDIDVYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM213034_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ803825_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173298_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU939665_HBc_P-B      MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ040169_HBc_P-B      MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
JQ341473_HBc_P-B      MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668324_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667605_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU575921_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406329_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406328_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406327_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406326_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406325_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406324_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406322_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406321_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406320_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406319_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406318_HBc_P-B      MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341494_HBc_P-B      MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341468_HBc_P-B      MDIDXYKEFGASVELLS--FLPSDFFPSXRDLLDTASALYREALESPEHC
JQ341487_HBc_P-B      MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ707740_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707742_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707743_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707744_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707745_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707746_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707747_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707749_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707750_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707753_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707755_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707758_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707759_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707762_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707763_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707764_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707765_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707766_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ707767_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP148458_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP148460_HBc_P-B      MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
EU939677_HBc_P-B      MDIDTYKEFGASLELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU668171_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTAAALFREALESPEHC
KU668150_HBc_P-B      MDIDPYKEFGASVGLLS--FLPTDFFPSVRDLLDTAAALFREALESPEHC
KU668195_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTAAALFREALESPEHC
KU576750_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHL
KU576886_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHL
KU576887_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHL
KU576888_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHL
KU576890_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHL
KU576891_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHL
KU576892_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHL
KU576894_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHL
KU576895_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHL
KU576897_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHL
KU576898_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHL
KU576896_HBc_P-B      MDIDTYKEFGASVVLLS--FLPSDFFPSIRDLLDTASALYREALESPEHL
GQ924646_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
GQ924637_HBc_P-B      MDIDIYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
EF494382_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTANALYREALESPEHC
KU667834_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576876_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667668_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667773_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667835_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667825_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023617_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023618_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023629_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023620_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023608_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023606_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023573_HBc_P-B      MDIDPYKEFGASVELLS--LLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023605_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023607_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023609_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023610_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023611_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023612_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023613_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023614_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023627_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023628_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ667207_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JF775482_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JF775483_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023630_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU564825_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
GQ924647_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASALYREALESPEHC
AB713530_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB231909_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASALYREALESPEHC
AB908300_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY596110_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
HM011470_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
AF480351_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ358145_HBc_P-B      MDIDPYKEFGASVEVLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ358146_HBc_P-B      MDIDPYKEFGASVEVLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ358147_HBc_P-B      MDIDPYKEFGASVEVLS--FLPSDSFPSIRDLLDTASALYREALESPEHC
AY167101_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF324066_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
FJ562303_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
GQ855526_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
AF480364_HBc_P-B      MDIDPYIEFRASGELLS--FLPSDFFPSIRDLLDTASALYREALQSPEHC
AF157020_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB713532_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB073836_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHV
KU576848_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576856_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576854_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576765_HBc_P-B      MDIDTYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576754_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576637_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDAASALYREALESPEHC
KU576630_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576626_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDPLDTASALYREALESPEHC
KU576623_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYGEALESPEHC
KU576240_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576619_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576620_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576629_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576633_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576640_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576645_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576647_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLNTASALYREALESPEHC
KU576656_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576681_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576692_HBc_P-B      MDIDPYKEFGASVELLS--LLPTDFFPSIRDLLDTASALYREALESPEHC
KU576698_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576703_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576704_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576714_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576738_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576748_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576751_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576766_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576843_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576845_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576874_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
KU576641_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYRGALESPEHC
KU576693_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASALYREALESPEHC
AY596103_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
FJ562237_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
FJ787477_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB302942_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB302943_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB302944_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB302945_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815712_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYRETLESPEHC
FJ032353_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU939633_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU939634_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU439020_HBc_P-B      MDIDPYKEFGASVEVLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144561_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144598_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AM888201_HBc_P-B      MDIDPYKEFGPSVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB073835_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASALYREALESPEHC
EU330996_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EF473974_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLHTASALNREALESPEHC
DQ993686_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AJ627225_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF121251_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU158262_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF121247_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF121248_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AP011084_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ993694_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU139543_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU796067_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023634_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ032352_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFLPSIRDLLDTASALYREALESPEHC
FJ032354_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480337_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
AF480344_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
AF480356_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
GU815699_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815701_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815706_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815707_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815710_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815639_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
FJ562219_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
AY596104_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASDLYREALESPEHC
AF335754_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY167094_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLXDTASALYREALESPEHC
FJ023575_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB100695_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRELLDTASALYREALESPEHC
FJ562262_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
GU815747_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASALYREALESPEHC
GU815748_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASALYREALESPEHC
GQ924605_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU919173_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ032357_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ032358_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306696_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU570070_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EF494380_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY269110_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
AF480361_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480353_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480347_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480342_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
AF480341_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDFIDTASALYREALESSEHC
AF480340_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480352_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480354_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480358_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF335748_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASALYREALESPEHC
AF324101_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY269065_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF323470_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB713531_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASALYREALESPEHC
FJ023636_HBc_P-B      MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASALYREALESPEHC
AB334299_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB334300_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB334301_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB334302_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB334303_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB355454_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB493833_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF324106_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY269078_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB219429_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AP011088_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB219426_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480349_HBc_P-B      MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815657_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815552_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815564_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815669_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480346_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480359_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480360_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480363_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB073833_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB117759_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF324073_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924644_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480362_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480357_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480355_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480345_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB073821_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF480338_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815780_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815775_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815764_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815761_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815754_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815700_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815695_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815635_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815619_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815554_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377587_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ358144_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ562322_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306703_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144550_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFSPSIRDLLDTASALYREALESPEHC
AF480350_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB073831_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASALYREALESPEHC
GU815777_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASALYREALESPEHC
AF324085_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
HQ700546_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
GU815722_HBc_P-B      MGIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815662_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ448628_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB493827_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRXLLNPVLVLYRGALESPEHC
AB355453_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
D00330_HBc_P-B        MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
AB031261_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB031263_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB033555_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB048705_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB073826_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB073827_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB073828_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB073829_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB073834_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB073840_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALDREALESPEHC
AB115551_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB195933_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB195934_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB195935_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB205119_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB219428_HBc_C-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB219430_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB246339_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB287328_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB287329_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB300364_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB355455_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB471854_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB471855_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB675676_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB713527_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB908304_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF100308_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYRGALESPEHC
AF121243_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF121244_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF121245_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF121246_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF121249_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF157024_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF233237_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF324069_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF324078_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF324086_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF335740_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF335741_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF335746_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815751_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRGLLDTASALYREALESPEHC
GU815558_HBc_P-B      VDIDPYKEFGASVELLS--FLPSDFFPPIRDLLDTASALYREALESPEHC
FJ755833_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JN827419_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JN406371_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JF899335_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JF775484_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JF775480_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JF412801_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
HQ700549_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
HQ700548_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815783_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815782_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815781_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815779_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815776_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815774_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815773_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815772_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815771_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815770_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815769_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815768_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815767_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815766_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815765_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815762_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815760_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815759_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815757_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815756_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815755_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815753_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815752_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815750_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815749_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815746_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815745_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815744_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815743_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815742_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815741_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815740_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815739_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815738_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815737_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815736_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815735_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815734_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815733_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815732_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815731_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815730_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815729_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815728_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815727_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815726_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815725_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815724_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815723_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815721_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815720_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815719_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815718_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815717_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815716_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815715_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815713_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815711_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815709_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815708_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815705_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815704_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815703_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815702_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815698_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815697_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815696_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815694_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815693_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815692_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815691_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815689_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815688_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815687_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815686_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815685_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815684_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815683_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815681_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815680_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815679_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815678_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815677_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815676_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815675_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815674_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815673_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815672_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815670_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815668_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815667_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815666_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815665_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815664_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815663_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815661_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815660_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815659_HBc_P-B      MDIDPYKEFGASVELLS--FLPSGFFPSIRDLLDTASALYREALESPEHC
GU815658_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815656_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815654_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815653_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815652_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815651_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815650_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815649_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815648_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815647_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815646_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815645_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815644_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815643_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815642_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815641_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815638_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815637_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815636_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815634_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815633_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815632_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815631_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815630_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815629_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815628_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815627_HBc_P-B      MDIDPYKEFGASVDLLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815626_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815625_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815624_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815623_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815622_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815621_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815620_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815618_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815617_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815616_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815614_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815613_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815612_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDPLDTASALYREALESPEHC
GU815611_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815610_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815609_HBc_P-B      MDIGPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815608_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815607_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815606_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815605_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815604_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815603_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815602_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815601_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815600_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815599_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815598_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815597_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815596_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815595_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815594_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815593_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815591_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815590_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815588_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815586_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815585_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815584_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815583_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815581_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815579_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815576_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815575_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815571_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815570_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815569_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815568_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815567_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815566_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815565_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815563_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815562_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815561_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815560_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815559_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815557_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815556_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815555_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815553_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815551_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815550_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815549_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU815548_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU451682_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU434373_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU434372_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GU357842_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924654_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924653_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924651_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924640_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924634_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924631_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924627_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924624_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
GQ924621_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924611_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924608_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924607_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924606_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASXLYREALESPEHC
GQ924603_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ855532_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ855522_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377643_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377641_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377639_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377638_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377629_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377625_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377612_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377588_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377569_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377568_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377566_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377558_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377547_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377542_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377537_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ358152_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ358151_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ358150_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ358149_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ358148_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ358142_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ358141_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ358138_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ358137_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ358136_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ787444_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ518812_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ386684_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ386683_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ386668_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ386666_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ386655_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ386584_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ386583_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ386582_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ349236_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023638_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023635_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023632_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023569_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU796068_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU595031_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU570071_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU570069_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU439023_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU439022_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU439021_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU439018_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU350409_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU331001_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU331000_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU330999_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU330998_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU330997_HBc_P-B      MDIDPYKGFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU330994_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU330992_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU330990_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU330989_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306712_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTTSALYREALESPEHC
EU306710_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306709_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306708_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306707_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306706_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306705_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306704_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306702_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306701_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306700_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306699_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDFLDTASALYREALESPEHC
EU306698_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306697_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU306695_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU305548_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU305547_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EF473977_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EF473976_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EF473975_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EF473972_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ993711_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ993709_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ993708_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIPDLLDTASALYREALESPEHC
DQ993706_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ993703_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ993702_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ993701_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ993700_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ993699_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ993697_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ993696_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ975271_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ448627_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ448626_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ448625_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ448624_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ448623_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ448622_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ448621_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ448620_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ448619_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144597_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIQDLLDTASALYREALESPEHC
DQ144594_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144564_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144560_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIQDLLDTASALYREALESPEHC
D00331_HBc_C-B        MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY766463_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY596102_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY582137_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY518556_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY293309_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY269135_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY269131_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY269120_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY269115_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY269100_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY269097_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY269095_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFSPSIRDLLDTASALYREALESPEHC
AY269093_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY269091_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY220698_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY217360_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY217359_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY167089_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY033073_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY033072_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AP011096_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AP011095_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AP011093_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AP011092_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AP011091_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AP011090_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AP011089_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AP011087_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AP011086_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AP011085_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF479684_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASVLYREALESPEHC
AF480339_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ475340_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
FJ386610_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSXRDLLDTASALYREALESPEHC
FJ386634_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ995802_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHY
KU964138_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU964139_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU964140_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU964141_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU964142_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU964143_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU964144_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU964145_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU964146_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU964147_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU964148_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU964149_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU964150_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU964151_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU964152_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
FJ386600_HBc_P-B      MDIDTYKENGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
EU919172_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144596_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYRETLESPEHC
DQ144559_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144589_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU939679_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
FJ562246_HBc_P-B      MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
FJ386680_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
GQ377582_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
DQ144606_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
DQ144602_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144600_HBc_P-B      MDIGTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
DQ144592_HBc_P-B      MDIDTYKEFEASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
DQ144587_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPELC
DQ144576_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144570_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB031264_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHG
DQ144543_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144544_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144545_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144546_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144548_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144551_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144552_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144554_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144555_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144556_HBc_P-B      MDIDTYKEFEASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144557_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144558_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144565_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144567_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144574_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144575_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144578_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144579_HBc_P-B      MDIDTYKEFGASVELLS--FLPSGFFPSIRDLLDTASALYREALESPEHC
DQ144581_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144582_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144583_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144584_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144586_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144590_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144593_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144595_HBc_P-B      MDIDTYKEFEASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377606_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
AF121250_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
EU522066_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ562254_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ924660_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
GQ377622_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ023637_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB031266_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB033554_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB073822_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
AF157023_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF157025_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF335738_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
AY217357_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY217358_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AY596106_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ144569_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU522074_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
EU796066_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU939666_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU939676_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
FJ023576_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ751767_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ358140_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
GQ377525_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
EU939637_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ899786_HBc_P-B      MDIDTYKEFGASVELLP--FLPSDFFPSVRDLLDTASALYREALESPEHC
EU939672_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
FJ899784_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
FJ899785_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
FJ899787_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KX276813_HBc_P-B      MDIDTYKEFGASLELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
AY167102_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNVRDLLDTASALYREALESPEHL
KP406311_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KP406296_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KP406300_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KP406302_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KP406297_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KP406305_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KP406306_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KP406307_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KP406308_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KP406309_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KP406310_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KP406312_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KP406313_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KP406314_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KP406315_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KP406316_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KU667801_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
FJ386615_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
AB368295_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
AB073839_HBc_P-B      MDIDTYKEFGASVDLLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
HM011466_HBc_P-B      MDIDTYKEFGASAELLS--FLPSDFYPSIRDLLDTATALYREALESPEHC
KJ803816_HBc_P-B      MDIDTYKEFGASAELLS--FLPSDFYPSIRDLLDTATALYREALESPEHC
KU667730_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KP406256_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP406259_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KX276776_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KJ410502_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
EU939638_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
AB205120_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
EU939673_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
EU939667_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
JQ027334_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
FJ562321_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYRDALESPEHC
FJ386669_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
AF324067_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668243_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KU667828_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KU667811_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLIDTASALYREALESPEHC
KU576614_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KP406258_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KY881853_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASAQYREALESPEHC
KX276797_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAXALYREALESPEHC
KX276770_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964132_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667531_HBc_P-B      MDIDTYKEFVASVELLS--FLPSDFYPNVRDLLDTASALYREALESREHC
MF674422_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
KU668335_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAPALYREALESPEHC
KU576773_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU576621_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
EU939660_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964248_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KU667789_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576617_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KU576612_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KT749851_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAFALYREALESPEHC
KP406317_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406298_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406293_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406289_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406288_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406287_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406286_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406285_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406284_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173419_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KJ173418_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
JX504543_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
JX026886_HBc_P-B      MDIDTYKEFGASVELIS--FLPSDFFPSIRDLLDTASALYREALESPEHC
HM011503_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JQ341509_HBc_P-B      MDIDXYXXFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
MF674464_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KU964135_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964133_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964130_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964126_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964125_HBc_P-B      MDIDTYKEFGASVELLS--FLPSNFFPSIRDLLDTASALYREALESPEHC
KU964082_HBc_P-B      MDIDTHKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964080_HBc_P-B      MDIDTHKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU667637_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALHREALESPEHY
KU576879_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576877_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALYREALESPEHC
KU576809_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASALHREALESPEHC
KU576807_HBc_P-B      MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTVSALHREALESPEHC
KU576283_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KU576277_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576064_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576046_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KT749820_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFYPSIRDLLDTATALYREALESPEHF
KJ790200_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KC774405_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
JX507213_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALXREALESPEHC
JQ341474_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ562240_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALHREALESPEHC
DQ144585_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KU679959_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KJ803758_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KJ803755_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
JQ040138_HBc_P-B      MDIDLYKEFGASVELLS--FLPSDFFPSIRDLLDTAXALYREALESPEHC
KY881825_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KU964394_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KU964256_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KU964255_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KU964245_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KU964137_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964136_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964134_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964131_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964129_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964128_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964127_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964124_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576808_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576803_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP036970_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KM875426_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
JX429910_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
JQ040128_HBc_P-B      MDIDTYXEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674450_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
LC416037_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964302_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU964301_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU964300_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU964299_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU964298_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU964297_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU964296_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU964295_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU964294_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU964293_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU964292_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU964291_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU964290_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU964289_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU964288_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU964287_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANALYREALESPEHC
KU964254_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KU964253_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KU964251_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KU964249_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KU964247_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KU964246_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KU964244_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KU964123_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KU964106_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964103_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964099_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964097_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964095_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964094_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964093_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667591_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHR
KU576939_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576875_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576054_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576053_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774395_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774389_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774383_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774377_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774371_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774365_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ429082_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341471_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341460_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964092_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964091_HBc_P-B      MDIDTYKEFGAYVELLS--FLPSDFFPSIRDLLETATALYREALESPEHC
KU964090_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964089_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964088_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964087_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964086_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964085_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964084_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964083_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964081_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KU964079_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
HM011494_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSXRDLLDTAXALYREALESPEHC
JQ040157_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTXXALYREALEXPEHC
DQ995804_HBc_P-B      MDIDPYKEFGASAELIS--FLPADFFPSVRDLLDTASALYREALESPEHC
AY206383_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
AF324088_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
AY167093_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
KU576414_HBc_P-B      MDIDPYKEFGASVELIS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
KU576415_HBc_P-B      MDIDPYKEFGASVELIS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
KU576416_HBc_P-B      MDIDPYKEFGASVELIS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
KU576417_HBc_P-B      MDIDPYKEFGASVELIS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
KU576418_HBc_P-B      MDIDPYKEFGASVELIS--FLPSDFFPSVRDLLDTAAALYRKALESPEHC
GQ924626_HBc_P-B      MDIDPYKEFGASVELLS--FLPDDFFPSVRDLLDTASALYREALESPEHC
GQ924656_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
DQ995803_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDSFPSIRDLLDTASALYREALESPEHC
AF323467_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRELIDTASALYREALESPEHC
AY206391_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AF324070_HBc_P-B      MDIDPYKEFGACVELLS--FLPYDFFPSIRELIDTASAMYREALESPEHC
HM011474_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
GQ924648_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHI
KF166001_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576106_HBc_P-B      MDIDPYNEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALQSPEHC
JQ341479_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KM526749_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667905_HBc_P-B      MDIDPYKEFGASVELLS--FSPSDFFPSTQDLLDTAPALYREALESPEHC
AY217361_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
AB976562_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPAVRDLLDTASALYREALESPEHC
AB555498_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB073832_HBc_P-B      MDIDPYKEFGASVELLS--FLPTDFFPXVRDLLDTASALYREALESPEHC
KU576108_HBc_P-B      MDIDPYKQFGASVELLS--FLPADFFPSIRDLLDTASALYREALESPEHV
KU576109_HBc_P-B      MDIDPYKQFGASVELLS--FLPADFFPSIRDLLDTASALYREALESPEHV
KU576112_HBc_P-B      MDIDPYKQFGASVELLS--FLPADFFPSIRDLLDTASALFREALESPEHV
JQ801494_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTISALHREALESPEHC
DQ993687_HBc_P-B      MDIDPYKEFGSSAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JX026879_HBc_P-B      MDIDPYKEFGASVELLSFFFLPSDFFPSIRDLLDTASALYQEALESPEHC
EU919171_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPDHV
MG571351_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571336_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276825_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276802_HBc_P-B      MDIDLYKEFGASVELLS--FLPTDFFPSVRDLLDTAXALYREALESPEHC
KU667546_HBc_P-B      MDIDPHKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576950_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYQETLECPEHC
KU576114_HBc_P-B      MDIDPYKQFGASVDLLS--FLPSDFFPSIRDLLDTASALYREALESPEHV
KU576113_HBc_P-B      MDIDPYKQFEASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHV
JQ341499_HBc_P-B      MDIDPYKEFGASXELLS--FLPSDFYPSIRDLLDTASALYREALESPEHX
FJ562224_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
FJ386676_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
FJ023631_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
DQ995805_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDPLDTASALYREALESPEHC
KU667778_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFLPSVRDLLDTASALYREALESPEHC
KP406301_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406304_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576107_HBc_P-B      MNIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406303_HBc_P-B      MDIDTYKEFGASVELLS--FXPSDFFPSVRDLLDTASALYREALESPEHC
GQ377644_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
EU796071_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
AB023663_HBc_P-B      MDIDPYKEFGASVELLS--YLTSDFFPSIRDLLDTASALYREALESPEHC
MG571326_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
MG571329_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KY881799_HBc_P-B      MDIDTYKEFGASVELLS--FFPSDFFPSIRDLLDTASALYREALESPEHC
KX276812_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAXALYREALESPEHC
KX276806_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KU668216_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIQDLLDTASALYREALESPEHC
KU668093_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSFRDLLDTASALYREALESPEHC
KU667597_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSTQDLLDTASALYREALESPEHC
KP406257_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KJ803756_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
HM011504_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHV
HM011477_HBc_P-B      MDIDTYKEFGASVXLLS--FLPSDFFPSXXDLLDTASALYREALESPEHY
FJ562296_HBc_P-B      MDIDPYKEFGASXELLS--FLPSDFFPSXRDLLDTASALYREALESPEHC
MG571375_HBc_P-B      MDIGPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881869_HBc_P-B      MGIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276781_HBc_P-B      MDIDPYKEFGASVELLS--FLPHDFFPSIRDLLDTASALQREALESPEHC
KU668116_HBc_P-B      MDIGPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALVSPEHC
KU668108_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALVSPEHC
KU668058_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALVSPEHC
KU667952_HBc_P-B      VDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASALYREALESPEHC
KU667858_HBc_P-B      MDIDPYKESGAPVELLS--FLPSDFSPSIRDLLDTASALYREALESPEHC
KU667519_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSTQDLLDTASALYRGALESPEHC
KU576292_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KU576291_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KU576111_HBc_P-B      MDIDPYKQFGASVDLLS--FLPSDFFPSIRDLLDTASALYREALESPEHV
KU576084_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTTSALYREALESPEHC
KP406280_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KP406271_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KP406269_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KP406260_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
JQ341495_HBc_P-B      MDIDPYKEFGASXELLS--FLPSDFFPTIRDLLDTASALYREALESPEHC
HM011484_HBc_P-B      MDIDTYKEFGASVELLS--FLPADFFPSVRDLLDTAXALYREALESPEHC
AF233235_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881957_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
KY881865_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881849_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881783_HBc_P-B      MDIDKYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276810_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276795_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHX
KU576979_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576394_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576390_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KU576105_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576101_HBc_P-B      MDIDPYKQFGASVELLS--FLPADFFPSIRDLLDTASALYREALESPEHV
KP406267_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KP148433_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148418_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148407_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ803808_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774415_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341486_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDSASALYREALESPEHC
GQ924617_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG372436_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
MF674415_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALFREALESPEHC
MF568491_HBc_P-B      MDIDPYKEFGASVELLS--FLPPDFFPNIRDLLDTASALYREALESPEHC
KY881954_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAALYREALESPEHC
KY689534_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATAMYREALESPEHC
KY689502_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALFREALESPEHC
KY689501_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALFREALESPEHC
KY689448_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATAMYREALESPEHC
KY353928_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276821_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFXPSIRDLLDTASALXREALESPEHC
KX276804_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276796_HBc_P-B      MDIDPYKEFGASXXLLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667972_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSTQDLLDTASALYREALESPEHC
KU667784_HBc_P-B      MDIDPYKEFGAPVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667672_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KU667671_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KU667578_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSTQDLLDTASALYREALESPEHC
KU667570_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSTQDLLDTASALYREALESPEHC
KU577088_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KU576393_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSTQDLLGTASALYREALESPEHC
KU576392_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSTQDLLDTASALYREALESPEHC
KU576290_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KU576289_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KP406294_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KP406292_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KP406281_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP406262_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KP148415_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KP148410_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774362_HBc_P-B      MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571368_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571361_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYQEALESPEHC
MF674499_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674466_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674446_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674396_HBc_P-B      MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF568461_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
LC349879_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASAMFREALESPEHC
KY881950_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KY881947_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KY881946_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KY881945_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLFDTASALHREALESPEHC
KY689479_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276817_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276805_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTXSALYREALESPEHC
KX276803_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276788_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963966_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668069_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668046_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU668037_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU577089_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALCRDALESPEHC
KU576153_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576096_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576086_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPGHC
KU576085_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576038_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ803817_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571360_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571339_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674406_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
MF621878_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
KY881948_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAALYREALESPEHC
KY881808_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881801_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881800_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881798_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881797_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KY881796_HBc_P-B      MDTDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881794_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881793_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881791_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881790_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881787_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881786_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881784_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881782_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881781_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881780_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689468_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689402_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALFREALESPEHC
KX276811_HBc_P-B      MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964122_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964121_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964119_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964118_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964116_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964114_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964112_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964110_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964109_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU667493_HBc_P-B      MDIDPYKEFEASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KU576778_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576389_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KU576328_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148437_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148416_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148413_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148405_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KP148366_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KJ803797_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALCRDALESPEHV
KJ803784_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173379_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRELLDTASALYREALESPEHC
MF674506_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674414_HBc_P-B      MDIDPYKEFGASVELLS--FXPSDFFPSIRDLLDTASALYREALESPEHC
KY881953_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTVSALHREALESPEHC
KY881952_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTVSALHREALESPEHC
KY881789_HBc_P-B      TDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689555_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276814_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU964117_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963961_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU963956_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KU576975_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148440_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148439_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148438_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148435_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148432_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148430_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148429_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148427_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148425_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148424_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148423_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148421_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLGTASALYREALESPEHC
KP148420_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148419_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148414_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148411_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148409_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148406_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148361_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148344_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148326_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148325_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148322_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KP148317_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ803781_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALYREALESPEHC
KJ173404_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KJ173403_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KC774394_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ801524_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571367_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASALYREALESPEHC
MG571348_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571321_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674507_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674479_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674476_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674473_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674462_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674455_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674434_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674433_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674423_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674419_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674389_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATALYREALESPEHC
MF674383_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF568485_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASALYREALESPEHC
KY881958_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KY881956_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KY881955_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KY881951_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KY881949_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
KY881779_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881778_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881761_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881760_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881759_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881757_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881756_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881753_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881752_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881747_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881746_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881745_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881741_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881740_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881735_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881734_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881733_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881732_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881731_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881730_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881729_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881728_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881727_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881726_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881725_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881724_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881723_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881722_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY881721_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689500_HBc_P-B      MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY470961_HBc_P-B      MDIDPYKEFGASVELLS--FLPPDFFPSIRDLLDTASTLYREALESPEHC
KY470960_HBc_P-B      MDIDPYKEFGASVELLS--FLPPDFFPSIRDLLDTASTLYREALESPEHC
KY470954_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRGLLDTASALYREALESPEHC
KY417926_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276820_HBc_P-B      MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASALXREALESPEHC
JQ341491_HBc_P-B      MDIDPYKEFGASXELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341489_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
HM011473_HBc_P-B      MDIDPYKEFGASVELLS--FLPXDFXPSVRDLLDTASALYREALESPEHC
MF674407_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674385_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYQEALESPEHC
KX276816_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276790_HBc_P-B      MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341504_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341502_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341500_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASALXREALESPEHC
JQ341463_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSXXDLLDTASALYREALESPEHC
JQ341488_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSXRDLLDTASALYREALESPEHC
MG571349_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571323_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674508_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674445_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276778_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341497_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MK075117_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MK052965_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MK052962_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MH663473_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MH061283_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG826153_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571371_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571369_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571366_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571365_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571364_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571362_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571356_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571355_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571347_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571346_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571344_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571342_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571340_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571328_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MG571322_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674515_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674513_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674512_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674511_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674510_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674509_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674500_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674497_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674495_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674493_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674490_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674488_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674485_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674483_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674482_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674481_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674480_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALHREALESPEHC
MF674477_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674460_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674456_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674453_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674452_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674451_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674449_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674443_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674438_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674437_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674432_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674431_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674427_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674426_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674424_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674421_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674416_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674413_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674410_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674405_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674404_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674400_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674397_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674395_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674394_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674393_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674387_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674384_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
MF674382_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
M54923_HBc_P-B        MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
LC349878_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
LC349873_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
LC349871_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689563_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689553_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASALYREALESPEHC
KY689546_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689538_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689517_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689514_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689513_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689480_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689477_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689472_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689443_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689413_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689408_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY629636_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY470962_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY470956_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY470953_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX765856_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX765841_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
JQ341472_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KY689414_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276824_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASALYREALESPEHC
KX276823_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAXALYREALESPEHC
KY689520_HBc_P-B      MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAXALYREALESPEHC
                       . . .               . .                          

JX429911_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
AB300371_HBc_P-B      SPHHTALRQAILCWGDVMNLATWVGTNLQDSGSRDLVVNYVNTNMGLKMR
AB287318_HBc_P-B      SPHHTAIRQAVLCWGELMTLASWVNNNLQDPASRDLVVNYVNTHMALKIR
KP659219_HBc_P-B      SPHHTAIRQAVLCWGELSTLASWVNNNLQDPASRDQVVNYVNTNMGLKIR
JN792901_HBc_P-B      SPHHTALRQAALCWGELMTLATWVGNNLNDPASRDLVVNYVNTNMGLKIR
JN792902_HBc_P-B      SPHHTALRQAALCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIR
AB287317_HBc_P-B      SPHHTAIRQAIVCWGELMTLASWVGNNLQDPASRDLVVNYVNTHMGLKIR
AB073847_HBc_P-B      SAHHTAIRQAILCWGELMTLATWVGSNLQDQASRDLVVNYVNINMGLKFR
AB931168_HBc_P-B      SYHHTALRQAILCWGELTNLGTWVGNNLQDQPSRDLVVNYVNTNMGLKIR
AB931169_HBc_P-B      SYHHTALRQAILCWGELTNLGTWVGNNLQDQPSRDLVVNYVNTNMGLKIR
AB302095_HBc_P-B      SSHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB287316_HBc_P-B      TSHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB287325_HBc_P-B      SPHHTALRQAILCWGELTTLGTWVGNNLQDPASRDQVVNYVNTNMGLKIR
AB073853_HBc_P-B      SPHHTAIRQAIVCWGEVMTLASWVGNNLQDPASRDLVVDYVNTHMGLKIR
KP659223_HBc_P-B      TPHHTALRQAIVCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
AB900103_HBc_P-B      SPHHTALRQAILCWGELTTLGTWVGNNLQDQASRDLVVNYVDTNMGLKIR
AB287327_HBc_P-B      SPHHTALRQAVLCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB287323_HBc_P-B      TPHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB106884_HBc_P-B      SPHHTALRQAXLCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB073858_HBc_P-B      TAHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
KP659254_HBc_P-B      SPHHTAIRQAILCWGELTTLATWVGSNLDDQPSRDLVVNYVNTNMGLKIR
KP659239_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
KP659234_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLKDPASRDLVVNYVNTNMGLKIR
DQ463799_HBc_P-B      SPHHTAIRQAILCWGQLMTLASWVGNNLQDPASRDLVVDYVNNNMGLMIR
AB900106_HBc_P-B      TSHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB073854_HBc_P-B      SPHHTAIRQAILCWVELMTLASWVGQNLQDQASRDLVVNYVNTNMGLKIR
AB073852_HBc_P-B      TPHHTALRQAVLCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
DQ463790_HBc_P-B      SYHHTALRQAILCWGELMTLASWVGNNLDDPASRDLVVNYVNTNMGLKIR
JN792900_HBc_P-B      SYHHTALRQAILCWGELMTLASWVGNNLDDPASRDLVVNYVNTNMGLKIR
DQ463798_HBc_P-B      SAHHTAIRQAILCWGELMTLASWVGSNLNDPASRDLVVNYVNINMGLKIR
JN792899_HBc_P-B      SAHHTAIRQAILCWGELMTLASWVGSNLNDPASRDLVVNYVNINMGLKIR
AB828708_HBc_P-B      SAHHTALRQAVLCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIR
D50521_HBc_P-B        SPHHTAIRQAILCWGELMTLASWVGNNLQDPASRELVVNYVNTHMGLKIR
D50522_HBc_P-B        SPHHTAIRQAILCWGELMTLASWVGNNLQDPASRELVVNYVNTHMGLKIR
AB900108_HBc_P-B      SPHHTAIRQAFLCWGELMTLATWVGDNLDDPASRNLVVNYVNTNMGLKIR
AB287320_HBc_P-B      SAHHTALRQAIVCWGELTTLGTWVGNNLQDPASRDQVVNYVNTNMGLKIR
AB073849_HBc_P-B      TPHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKLR
KP659240_HBc_P-B      SPHHTAIRQAILCWGELMTLATWVGXNLQDPASRDQVVXYVNTNMGLKIR
AB362933_HBc_P-B      SPHHTAIRQAVLCWGELMTLASWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB900097_HBc_P-B      SPHHTAIRQAVLCWLELMTLANWVGNNLQDPASRDMVVNYVNTNMGLKIR
DQ463791_HBc_P-B      SPHHTAIRQAILCWGELMTLASWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB073857_HBc_P-B      SPHHTAIRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB900105_HBc_P-B      SAHHTAIRQAILCWGELMTLASWVGNNLQDPASRDLVVNYVNTNMGLKIR
KP659249_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
JN792894_HBc_P-B      SYHHTALRQAILCWGELMTLASWVGNNLQDPASRDLVVNYVNTNMGLKIR
D00329_HBc_P-B        SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
DQ463795_HBc_P-B      SPHHTAIRQAVLCWGELMTLASWVGNNLDDPASRDLVVNYVNTNMGLKIR
KP659244_HBc_P-B      SPHHTAIRQAVLCWGELMTLATWVGNNLDDPASRDLVVNYVNTHMGLKIR
KP659248_HBc_P-B      SAHHTAIRQAVLCWGELMTLATWVGNNLDDPASRDLVVNYVNTHMGLKIR
AB287319_HBc_P-B      SPHHTAIRQAILCWGELMTLATWVGSNLDDPASRDLVVNYVNINMGLKIR
KP659224_HBc_P-B      SPHHTAIRQAILCWGELMTLATWVGSNLDDPASRDLVVNYVNINMGLKIR
KP659220_HBc_P-B      SAHHTALRQAILCWGELTTLGTWVGNNLQDPASRDQVVNYVNTNMGLKIR
DQ463800_HBc_P-B      SAHHTAIRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTHMGLKIR
JN792897_HBc_P-B      SPHHTAIRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTHMGLKIR
JN792898_HBc_P-B      SAHHTAIRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTHMGLKIR
DQ463796_HBc_P-B      SPHHTAIRQAILCWGELMTLASWVGNNLDDPASRDLVVNYVNTNMGLKIR
DQ463787_HBc_P-B      SHHHTAIRQAVLCWGELMTLASWVGSNLDDPASRDLVVNYVNINMGLKIR
AB900112_HBc_P-B      SPHHTAIRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIR
JN792896_HBc_P-B      SPHHTAIRQAILCWGELMTLATWVGNNLEDQASRDLVVNYVNTHMGLKIR
DQ463797_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDQASRDLVVNYVNTNMGLKIR
JN792895_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDQASRDLVVNYVNTNMGLKIR
DQ463789_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDQASRDLVVNYVNTNMGLKIR
AB300370_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
DQ463802_HBc_P-B      SPHHTAIRQAILCWGELMTLASWVGNNLDDPASRDLVVNYVNTNMGLKIR
DQ463792_HBc_P-B      SAHHTALRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIR
AB642093_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTXMGLKIR
AB642101_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB900111_HBc_P-B      SAHHTALRQAVLCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIR
AB287321_HBc_P-B      SPHHTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
AB246343_HBc_P-B      SPHHTALRQAILCWVELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
KP659245_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
DQ463794_HBc_P-B      SHHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
D23679_HBc_P-B        SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
AB900104_HBc_P-B      TPHHTALRQAILCWVELMTLASWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB287322_HBc_P-B      SAHHTALRQAILCWGELMTLASWVGNNLNDPASRDLVVNYVNTNMGLKIR
AB014366_HBc_P-B      SPHHTAIRQAILCWGELMTLASWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB010290_HBc_P-B      SHHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB010291_HBc_P-B      SHHHTALRQATLCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
KP659251_HBc_P-B      SXHHTALRQAILCWGELTTLGTWVGNNLQDPASRDQVVNYVNTNMGLKIR
AB073845_HBc_P-B      SPHHTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
AB073843_HBc_P-B      SHHHTALRQAILCWGELTTLGTWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB073838_HBc_P-B      SAHHTALRQAXLCWGELTTLXTWVGNNLEDPASRDLVVNYVNTNMGLKIR
DQ463788_HBc_P-B      SSHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
LT992442_HBc_P-B      SPHHXALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNXNMGLKIR
AB010289_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
AB073846_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
AB073848_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
AB205121_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
AB246341_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
AB246342_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
AB287314_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
AB287315_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
LC279273_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
LC279272_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
LC279271_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
LC279270_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
LC279269_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
LC279268_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
KP659247_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
KP659246_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
KP659235_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
KP659237_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
MH932712_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIR
AB900107_HBc_P-B      SAHHTALRQAVLCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB900098_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
D23678_HBc_P-B        SPHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB073856_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIR
AB073850_HBc_P-B      SPHHTALRQAILCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIR
AB073851_HBc_P-B      SPHHTALRQAVLCWGELMTLATWVGNNLDDPASRDLVVNYVNTNMGLKIR
AB900095_HBc_P-B      SSHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB073844_HBc_P-B      SPHHTALRQAILCWVELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
AB287326_HBc_P-B      SPHHTALRQAILCWVELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
KU964276_HBc_P-B      SPHHTAIRQAILCWGDLMNLATWVGSNVDDPASRDLIVNYVNMNMGLKFR
KU964283_HBc_P-B      SPHHTAIRQAILCWGDLMNLATWVGSNVDDPASRDLIVNYVNMNMGLKFR
KU964272_HBc_P-B      SPHHTAIRQAILCWGDLMNLATWVGSNVDDPASRDLIVGYVNMNMGLKFR
KU964273_HBc_P-B      SPHHTAIRQAILCWGDLMNLATWVGSNVDDPASRDLIVGYVNMNMGLKFR
KU964274_HBc_P-B      SPHHTAIRQAILCWGDLMNLATWVGSNVDDPASRDSIVGYVNMNMGLKFR
KU964275_HBc_P-B      SPHHTAIRQAILCWGDLMNLATWVGSNVDDPASRDLIVGYVNMNMGLKFR
KU964277_HBc_P-B      SPHHTAIRQAILCWGDLMNLATWVGSNVDDPASRDAIVGYVNMNMGLKFR
KU964278_HBc_P-B      SPHHTAIRQAILCWGDLMNLATWVGSNVDDPASRDLIVGYVNMNMGLKFR
KU964279_HBc_P-B      SPHHTAIRQAILCWGDLMNLATWVGSNVDDPASRDLIVGYVNMNMGLKFR
KU964281_HBc_P-B      SPHHTAIRQAILCWGDLMNLATWVGSNVDDPASRDLIVGYVNMNMGLKFR
KU964282_HBc_P-B      SPHHTAIRQAILCWGDLMNLATWVGSNVDDPASRDSIVGYVNMNMGLKFR
KU964284_HBc_P-B      SPHHTAIRQAILCWGDLMNLATWVGSNVDDPASRDAIVGYVNMNMGLKFR
KU964285_HBc_P-B      SPHHTAIRQAILCWGDLMNLATWVGSNVDDPASRDAIVGYVNMNMGLKFR
KU964280_HBc_P-B      SPHHTAIRQAILCWGDLMNLATWVGSNVDDPAARELIVGYVNMNMGLKFR
KU964286_HBc_P-B      SPHHTAIRQAILCWGDLMNLATWVGSNVDDPAARELIVGYVNMNMGLKFR
KY881845_HBc_P-B      SPHHTALRQAIVCWGELINLATWVGSNLKDPASRELVVSYVNINIGLKIR
KU668369_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLKDPASRELVVGYVNVNMGIKPR
KU668003_HBc_P-B      SPHHTTIRQAILCWGELMNLATWVKNNLKDPTSRELVVGYVNVNMDIKLR
FJ562260_HBc_P-B      SDHHTAIRHAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
AB073841_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
EU939678_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLQDQASRDLVVNYVNVNMGIKLR
AP011094_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KU576069_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFR
KU576070_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFR
KU576501_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSSLPDPASREAVVGYVNVNMGLKTR
KU576496_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLPDPASREAVVGYVNVNMGLKTR
KU576507_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLPDPASREAVVGYVNVNMGLKTR
HM011467_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
FJ562311_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDQGSRDLVVGYVNVNMGIKLR
AY800391_HBc_P-B      SHHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
AY800392_HBc_P-B      SHHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
KX276791_HBc_P-B      TPHHTALRXAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KU667929_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSREAVVGYVNVNMGLKIR
KP406186_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406187_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406188_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406189_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406192_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406194_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406195_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406197_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406198_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406199_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406200_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406203_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406208_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406210_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406214_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406216_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406217_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406219_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406190_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406191_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406193_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406196_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406201_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406202_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406204_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406205_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406206_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406207_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406209_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406211_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406212_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406213_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406215_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KP406218_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGLKLR
KX276800_HBc_P-B      SXHHTALRXAILCWGELMNLATWVGXNLEDQXSRDLVVGYVNVNMGLKLR
KM875418_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
KU964386_HBc_P-B      TPHHTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYVNVNMGLKVR
KU964387_HBc_P-B      TPHHTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYVNVNMGLKVR
KU964389_HBc_P-B      TPHHTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYVNVNMGLKVR
KU964390_HBc_P-B      TPHHTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYVNVNMGLKVR
KU964392_HBc_P-B      TPHHTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYVNVNMGLKVR
KU964396_HBc_P-B      TPHHTALRQAILCWGDLMNLATWVGSNLPDPASREAVVNYVNVNMGLKVR
KU964381_HBc_P-B      TPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVR
KU964382_HBc_P-B      TPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVR
KU964383_HBc_P-B      TPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVR
KU964384_HBc_P-B      TPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVR
KU964385_HBc_P-B      TPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVR
KU964388_HBc_P-B      TPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVR
KU964391_HBc_P-B      TPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVR
KU964393_HBc_P-B      TPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVR
KU964395_HBc_P-B      TPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVR
KU964397_HBc_P-B      TPHHTALRQAILCWGDLMNLATWVGSNLQDPASREAVVNYVNVNMGLKVR
MG571354_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKFR
JQ027315_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGGNLEDQASRELVVGYVNVNMGIKIR
MG571353_HBc_P-B      SYHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
MG571376_HBc_P-B      SYHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
MF674440_HBc_P-B      SAHHTALRQAIVCWGELMNLATWVGGNLDDPASREVVVNYVNVNMGLKIR
KY689481_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFR
KX276783_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGXNLEDPASRXAVVSYVNVNMGIKIR
KP406277_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYVNVNMGLKLR
KP406276_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYVNVNMGLKLR
KP406275_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYVNVNMGLKLR
KP406264_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYVNVNLGLKLR
EU939674_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDQASRDLVVGYVNVNMGLKLR
FJ899790_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDQASRDLVVGYVNVNMGLKLR
FJ899791_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDQASRDLVVGYVNVNMGLKLR
JQ027312_HBc_P-B      TPHHTALRQVILCWGELMNLATWVGSNLDDXTSREAVVNYVNVNMGLKTR
KP406255_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYVNVNMGLKLR
KP406263_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYVNVNMGLKLR
KP406265_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYVNVNMGLKLR
KP406268_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYVNVNMGLKLR
KP406270_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYVNVNMGLKLR
KP406272_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYVNVNMGLKLR
KP406278_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYVNVNMGLKLR
KP406279_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYVNVNMGLKLR
KP406261_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLDDQASRELVVGYVNVNMGLKLR
JQ801474_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKFR
KU964257_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KU964259_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KU964260_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KU964261_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KU964262_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KU964263_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KU964264_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KU964265_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KU964266_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KU964267_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KU964268_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KU964269_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KU964270_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KU964271_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
JQ027325_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDQASRDLVVGYVNVNMGLKLR
KU577046_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
KU577048_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
KU577047_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLVDPASRELVVGYVNVNMGLKLR
JQ027311_HBc_P-B      SPHHTAXRQAILCWGELMNLATWVGGNLXDPXSRELVVGYVNVNMGLKXR
KX276773_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU576713_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYANVNMGIKLR
AB900110_HBc_P-B      SPHHTAIRQAIICWGELMNLATWVGSNLEDPSSREAVVGYVNVNMGIKLR
KU668309_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
KU667987_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
KU576702_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
KU576707_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
KU667997_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
KU668332_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
KU576718_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
FJ032342_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASRDLVVNYVNVNMGLKLR
HM011487_HBc_P-B      SPHHTALRQAXLCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGIKLR
DQ993683_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPGSRELVVSYVNVNMGLKIR
X98077_HBc_P-B        SPHHTAIRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKFR
EU522072_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
EU522073_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
EU522075_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
HM011490_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGIKLR
MG571352_HBc_P-B      TAHHTALRQAIVCWGELMNLATWVGSNLEDPGSRELVVTYVNVNMGIKIR
MF674439_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLDDQASRELVVSYVNVNMGLKFR
KY881838_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY689444_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIR
KY689406_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGGNLEDQASRDLVVSYVNVNMGLKIR
EU487256_HBc_P-B      SPHHTALRQAMLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KY881831_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881828_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881827_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881826_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881795_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ341490_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JF436921_HBc_P-B      SHHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
AF282918_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLQDPASRELVVSYVNANMGLKIR
MF568474_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGIKIR
KY881861_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881850_HBc_P-B      SPHHTALRQVIVCWGELMNLATWVGSNLKDPASRELVVSYVNVNMGLKIR
KY689562_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY689417_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLQDQGSRDQVVNYVNVNMGLKLR
X97851_HBc_P-B        SPHHTALRQAILCWGELMNLATWVGSNLQDPASRELVVSYVNANMGLKIR
MG571370_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
MG571327_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLR
MF674505_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
LC349869_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KY689423_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKFR
MK818222_HBc_P-B      TPHHTAIRHAILCWGELMNLATWVGXNLEDXASREQVVGYVNVNMGLKLR
MG571373_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLQDPASREAVVSYVNVNMGIKIR
MG571372_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KY881856_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881851_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881843_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881842_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881841_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881839_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881836_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881835_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881833_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNSEDPASRELVVSYVNVNMGLKIR
KY881830_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881829_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDQASRELVVSYVNVNMGLKIR
KY881824_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881823_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVASYVNVNMGLKIR
KY881822_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881821_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881820_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881788_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY689483_HBc_P-B      SPHHTALRQAIXCWGELMNLATWVGSNLDDPASREAVVSYVNVNMGLKIR
KY689476_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGIKLR
KY689419_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KY470840_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLR
KY470832_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLR
KX765854_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KX276830_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
MF674498_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
LC349875_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLQDQASRELVVSYVNVNMGIKIR
LC349872_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLR
LC349870_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KY881912_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY689551_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KY689507_HBc_P-B      SPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KY689506_HBc_P-B      SPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KY689505_HBc_P-B      SPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KY689410_HBc_P-B      SPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KY470839_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLR
KY470838_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLR
KY470836_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLR
KY470835_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLR
KY470833_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLR
KY470830_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLR
MK052964_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
MG571374_HBc_P-B      SPHHTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
MG571350_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
MG571338_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIR
MG571334_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
MF674503_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
MF674487_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
MF674470_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
MF674469_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
MF674420_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
MF674401_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIR
MF674391_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
LC349877_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KY881867_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY689564_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIR
KY689556_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY689523_HBc_P-B      SPHHTALTQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY689511_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY689496_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KY689458_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KY689451_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KY629635_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY470841_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRESVVGYVNVNMGLKLR
KY470837_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRESVVGYVNVNMGLKLR
KY470834_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRESVVGYVNVNMGLKLR
MG571341_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
MG571324_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
MF674436_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVNYVNVNMGLKIR
KY881914_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881913_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881911_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881910_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881909_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881908_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881907_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881906_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881905_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881904_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881903_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881902_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881901_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881900_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881899_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881898_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881897_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881896_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881895_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881894_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881893_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881868_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881866_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881863_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881862_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881860_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881859_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881858_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881857_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881855_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881854_HBc_P-B      TPHHTALKQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881852_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881848_HBc_P-B      TPHHTALRQAIGCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881847_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881846_HBc_P-B      TPHHTALRRAIVCWGELTNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY881844_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY689557_HBc_P-B      SPHHTALRQAXXCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KY689484_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY689426_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
MK818225_HBc_P-B      SXHHTALRQAIVCWGELMXLATWVGSNLEDPASRELVVXYVNVNMGLKIR
LC349868_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGGNLEDQASRELVVSYVNVNMGLKLR
MG571363_HBc_P-B      SPHHTALRQAXVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY689560_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVNYVNVNMGIKLR
KY689559_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVNYVNVNMGIKLR
KY689503_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLDDPASRELIVSYVNVNMGLKXR
KY689490_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVNYVNVNMGIKLR
KY689488_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELXVXYVNVNMGLKLR
MG571357_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVNYVNVNMGLKLR
MG571331_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KX276829_HBc_P-B      TPHHTALRXAILCWGELMNLATWVGSNLEDXASRXLVVXYVNVNMGLKXR
KY689404_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLXDPASRELIVSYVNVNMGLKXR
KP659255_HBc_P-B      SPHHTALRHVVLCWGDVTTLGTWVGNNLXDQESRDLVVNYVNNNMGLKIR
FJ386648_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIR
AB287324_HBc_P-B      SSHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
AY269102_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVDYVNVNMGLKFR
KP659221_HBc_P-B      SAHHTALRQAILCWGEVTTLGTWVGTNLQDQASRDLVVNYVNTNMGLKIR
GQ924641_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDQASRESVVRYVNVNMGLKIR
KP659250_HBc_P-B      SHHHTAIRQAVLCWGELMTLASWVGNNLDDPASRDLVVDYVNNNMGLKIR
KJ803824_HBc_P-B      TPHHTALRQAILCWGGLMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
EU487257_HBc_P-B      SPHHTALRQAVVCWGELMNLATWVGSNLDDPASREVVVNYVNVNMGLKIR
AY596111_HBc_P-B      SSHHTALRQAIVCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKFR
KJ803773_HBc_P-B      SPHHTAIRQAIVCWGEVMNLATWVGSNLEDPGSRELVVNYVNVNMGLKMR
AJ298864_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGTNLEDPASRDLVVSYVNTNVGLKFR
AB073824_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGIKIR
KU667951_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVRSNLEDPASRELVVSYVNGNMGIKIR
KU667859_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667528_HBc_P-B      SPHHTAIRQAIVCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGIKIR
JQ341492_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLDDPXSRELVVSYVNVNMGIKIR
KU576131_HBc_P-B      SSHHTALRQAILCWGELMNLASWVGGNLDDPASREAVVNYVNVNMGLKLR
KU576125_HBc_P-B      SSHHTALRQAILCWGELMNLASWVGGNLDDPASREAVVNYVNVNMGLKLR
KU576126_HBc_P-B      SSHHTALRQAILCWGELMNLASWVGGNLDDPASREAVVNYVNVNMGLKLR
KU576130_HBc_P-B      SSHHTALRRAILCWGELMNLASWVGGNLDDPASREAVVNYVNVNMGLKLR
KP659253_HBc_P-B      SPHHTAIRQAILCWGELMTLANWVGNNLQDPASRDLVVNYVNNNMGLKIR
FJ386688_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
FJ386660_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGIKIR
EU882002_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGIKIR
KU667539_HBc_P-B      SPHHTAIRQAVVCWGELMNLATWVGINLEDPASWELVVGYVNANMGIKIR
KU576628_HBc_P-B      SPHHTAIRQAVVCWGELMNLTTWVGINLEDPASRELVVGYVNANMGIKIR
KU576145_HBc_P-B      SPHHTAIRQAVVCWGELMNLTTWVGINLEDPASRELVVGYVNANMGIKIR
KU576736_HBc_P-B      SPHHTAIRQAVVCWGELMNLTTWVGINLEDPASRELVVGYVNANMGIKIR
KU576749_HBc_P-B      SPHHTAIRQAVVCWGELMNLTTWVGINLEDPASRELVVGYVNANMGIKIR
KU667549_HBc_P-B      SPHHTAIRQAVVCWGELMNLTTWVGINLEDPASRELVVGYVNVNMGIKIR
KU668293_HBc_P-B      SPHHTAIRQAVVCWGELMNLTTWVGINLEDPASRELVVGYVNVNMGIKIR
MG571358_HBc_P-B      SPHHTAVRQAILCWGELMNLATWVGGNLEDPASREAVVSYVNVNMGLKIR
KX276789_HBc_P-B      XXHHTALRQAILCWGELMDLATWVGGNLQDQASRELVVGYVNVNMGLKIR
KU668081_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFR
KU667517_HBc_P-B      SPHHTAIRQAIVCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGIKIR
KU576648_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIR
KU576148_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFR
JX504533_HBc_P-B      SPHHTALRQAVLCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGIKIR
JQ341503_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGGNLDDPASRELVVGYVNVNMGLKLR
KU668252_HBc_P-B      TPHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
KU668241_HBc_P-B      TPHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
KU576921_HBc_P-B      TPHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVGYVNVDMGLKIR
KU668222_HBc_P-B      TPHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
KU668270_HBc_P-B      TPHHTALRQEILCWGELMNLAPWVGSNLEDPASRELVVGYVNVNMGLKIR
KU668333_HBc_P-B      TPHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
KU668342_HBc_P-B      TPHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
KU668353_HBc_P-B      TPHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
KU668232_HBc_P-B      TPHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
KU668277_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLKDPASRELVVRYVNVNMGLKLR
KU668261_HBc_P-B      TPHHTALRQEILCWGELMDLATWVGSNLEDPASRELVVGYVNVNMGLKIR
KU667420_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKLR
KU576522_HBc_P-B      SPHHTALRQAVLCWGELMNLATWVGSNLDHPASRELVVSYVNVNMGLKFR
KU576287_HBc_P-B      SPHHTALRQAILRWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576280_HBc_P-B      SPHHTALRQAILRWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576127_HBc_P-B      SSHHTALRQAILCWGELMNLASWVGGNLDDPAFREAVVNYVNVNMGLKLR
KP659252_HBc_P-B      SAHHTALRQAILCWGELTTLATWVGNNLQDPASRDLVVNYVNTNMGLKIR
KJ803775_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
EU939661_HBc_P-B      SYHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIR
EU939559_HBc_P-B      SAHHTALRQAIVCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIR
AY167100_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIR
KU668357_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRGLVVRYVNVNMGLKLR
KU668302_HBc_P-B      SPHHTAIRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKIR
KU668278_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGIKIR
KU668259_HBc_P-B      TSHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGIKIR
KU668238_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGIKIR
KU668229_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGIKIR
KU668019_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFR
KU668060_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFR
KU667680_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFR
KU576383_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
KU576381_HBc_P-B      PPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
EF134945_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIR
AY269108_HBc_P-B      SPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
AF282917_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGQNFR
MF674478_HBc_P-B      SPHHTAIRQAILCWVELMNLATWVGGNLDDPASRELVVSYVNVNMGLKIR
KX276809_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKMR
KU668193_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKLR
KU668059_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELLVSYVNVNMGLKIG
KU576495_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDPASRDAVVGYVNVNMGLKLR
KU576385_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
KP406299_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KM526755_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGTNLEDPASRELVVSYVNVNMGLKIR
KJ410500_HBc_P-B      TPHHTAIRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNSNMGLKFR
JQ341469_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIR
AB023677_HBc_P-B      SPHHTALRQAFLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576611_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGIKIR
KU576613_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGIKIR
KU576616_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGIKIR
KU576622_HBc_P-B      TPHHTALRQAIVCWGELINLATWVGSNLEDPASRELVVSYVNGNMGIKIR
KU668202_HBc_P-B      TSHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGIKIR
KU668249_HBc_P-B      TAHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGIKIR
KU668290_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGIKIR
MG826152_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGGNLQDQASREAVVNYVNVNMGLKIR
KU668170_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKLR
KU667996_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667955_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSSLEDPASRELVVSCVNVNMGLKIR
KU667777_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRKLVVSYVNVNMGLKIR
KU667739_HBc_P-B      PPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576753_HBc_P-B      SPHHTALRQAVLCWGELMNLATWEGSNLEDPASRELVVSYVNVNMGLKIR
KU576380_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
KU576302_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406170_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNDNTGLKIR
KP406169_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNDNTGLKIR
KP406174_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNDNTGLKIR
KM526756_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGGNLEDPASRDLIVGYVNVNMGLKIR
KJ173368_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
JQ341462_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIR
EF473971_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKIR
DQ995801_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
AF480343_HBc_P-B      SPHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
AB241116_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
AB241117_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
MF674492_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGIKIR
KY689453_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLQDPASRELVVGYVNVNMGLKIR
KX276793_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDQSSRDLVVGYVNVNMGLKLR
KX276774_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLXDPASRELVVSYVNVNMGXKIR
KU668287_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668265_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668173_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDLASRELVVSYVNVNMGLKIR
KU667944_HBc_P-B      TPHHTALRQAIVCWGELMNLASWVGSNLEDPASRELVVSYVNGNMGIKIR
KU667555_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576397_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP406175_HBc_P-B      SPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNDNTGLKIR
KP406172_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNDNTALKIR
KP406168_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNDNTGLKIR
KJ803805_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLDDQASRDLVVSYVNVNMGLKIR
HM011478_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPSSREAVVSYVNVNMGLKLR
EF134946_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIR
AY517620_HBc_P-B      SPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
AB908303_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
AB246340_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KX276828_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KX276772_HBc_P-B      SXHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVXYVNVNMGLKIR
KU964120_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KU964115_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KU964113_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KU964111_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KU668336_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDLASRELVVSYVNVNMGLKIR
KU668124_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667649_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667422_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASREFVVSYVNVNMGLKIR
KU576636_HBc_P-B      SPRHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIR
KU576391_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KU576132_HBc_P-B      SPHHTALRQASLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KU576090_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576088_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIR
KP406273_HBc_P-B      SPHHTAIRQAILCWVELMNLATWVGSNLDDPASRELVVSYVNVNMGLKLR
KJ803821_HBc_P-B      TPHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
KJ803789_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVGYVNVNMGIKLR
KJ173362_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGIKIR
JX504532_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
DQ993707_HBc_P-B      SPHHTALRQALLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY689433_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKTR
KX276808_HBc_P-B      SHHHTALRQAILCWGELMNLATWVGSNLDDPXSRELVVGYVNVNMGLKIR
KX276786_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIR
KX276784_HBc_P-B      SPHHTALRQAILCWVELMNLATWVGGNLEDPASRELVVSYVNDNMGLKTR
KX276775_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKLR
KU668366_HBc_P-B      SAHHTALRQAILCGGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKLR
KU668308_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668307_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668157_HBc_P-B      SAHHTALGQAILCWGELMNLATWVGGNLEDPASRELVVRYVNVNMGLKLR
KU667874_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU667860_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667780_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRKLVVSYVNVNMGLKIR
KU667612_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIR
KU667457_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667439_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDLASRELVVSYVNANMGLKIR
KU667438_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667412_HBc_P-B      SPHHTALWQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576989_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKLR
KU576988_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKLR
KU576691_HBc_P-B      SPHYTALRQAILCWGDLMNLATWVGSNLEDQASRDLVVSYVNVNMGLKIR
KU576618_HBc_P-B      SPHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576609_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKLR
KU576606_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKLR
KU576598_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKLR
KU576597_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKLR
KU576322_HBc_P-B      SPHRTALRQAILCWGGLMNLATWVGSNLEDPASRELVVSYVNVNVGLKIR
KU576279_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRESVVSYVNVNMGLKIR
KU576189_HBc_P-B      SPHHTALRQAILCWGELMNLVTWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576173_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIR
KU576041_HBc_P-B      PPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU575977_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU575927_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIR
KP406266_HBc_P-B      SPHHTAIRQAILCWVELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIR
KP406254_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406253_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406252_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406251_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406250_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406249_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406248_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406247_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406246_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406245_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406244_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP148332_HBc_P-B      SPHHAALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ843165_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIK
KJ803819_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGGNLEDPGSRELVVGYVNVNMGLKFR
KJ803796_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGLKIR
KJ803752_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774406_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIR
KC774370_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774368_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
GU815778_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIR
GU815640_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
GQ924625_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
GQ358143_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
DQ144599_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
AF480348_HBc_P-B      SPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
AF100309_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIR
AB713528_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
AB493835_HBc_P-B      SPHHTALRQAILCWGELRNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
AB073837_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
MF674448_HBc_P-B      SPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KX276807_HBc_P-B      XXHHTALRQAILCWVELMNLATWVGSNLXDPASREXVVSYVNVNMGLKIR
KX276801_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVGYVNVNMGLKLR
KX276799_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGIKIR
KX276782_HBc_P-B      SXHHTAIRQAILCWVELMNLATWVGSNLDDPASRELVVNYVNVNMGLKIR
KU964104_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668316_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668306_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668250_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDLASRELVVSYVNVNMGLKIR
KU668076_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668012_HBc_P-B      SPHHTALRQAILCWGGSMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU667936_HBc_P-B      SPHHTALRQAILCWGELMKLATWVGSNLEDPASRELVVSYVNVSMGLKIR
KU667869_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667733_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDLASRELVVGYVNVNMGLKIR
KU667448_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576746_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKIR
KU576600_HBc_P-B      SPHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576467_HBc_P-B      SPHHTALRRAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576402_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576395_HBc_P-B      SPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576386_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576018_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLR
KU575979_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIR
KU575966_HBc_P-B      SPHHTALRQAILRWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
KU575959_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIR
KP406166_HBc_P-B      SPHHTALRQAILCWDELMNLATWVGSNLEDPASKELVVGYVNVNMGLKLR
KP406163_HBc_P-B      SPHHTALRQAILCWDELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
KP148364_HBc_P-B      SPHHTALRQAILCWGELMDLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KM875420_HBc_P-B      SHHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVGYVNVNMGLKLR
KM213035_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KJ803820_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173348_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX429908_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX429897_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY353930_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFR
KX276771_HBc_P-B      SSHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLR
KU964158_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KU668289_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668099_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667794_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU667787_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU667700_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667676_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667590_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
KU667516_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIR
KU576970_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KU576466_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576411_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576398_HBc_P-B      SPHHTALRQAILCWGGLMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576387_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576338_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIR
KU576185_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIR
KU576165_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIR
KU576015_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLR
KU575983_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIR
KU575971_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
KP406185_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVGYVNVNMGLKLR
KP406184_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVGYVNVNMGLXLR
KP406183_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVGYVNVNMGLKLR
KP406182_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVGYVNVNMGLKLR
KP406181_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVGYVNVNMGLKLR
KP406180_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVGYVNVNMGLKLR
KP406179_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVGYVNVNMGLKLR
KP406178_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVGYVNVNMGLKLR
KP406177_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVGYVNVNMGLKLR
KP406176_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVGYVNVNMGLKLR
KP148579_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148392_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148382_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173373_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTALTTR
JX869998_HBc_P-B      SPHHTALRQAILCWGEFMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX504531_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
JQ801516_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVGYVNVNMGLKLR
JQ341482_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
MG571325_HBc_P-B      SHHHTALRQAILCWGXLMNLATWVGSNLDDPASRELVVNYVNXNMGLKIR
MF674496_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KU964165_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU964164_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU964155_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963989_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963988_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963987_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963986_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963985_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963984_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963983_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963982_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963981_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963980_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963979_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963978_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963977_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963976_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963975_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963974_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963973_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963972_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963971_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963970_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963969_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963968_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963967_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963965_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963964_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963963_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963962_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963960_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963959_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963958_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963957_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963955_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963954_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963953_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963952_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963951_HBc_P-B      SPHHTALMQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963950_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963949_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963948_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963947_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963946_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963945_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963855_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963854_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963853_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963852_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963851_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963850_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963849_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963848_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963847_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963846_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963845_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963844_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963843_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963842_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963841_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963840_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963839_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963838_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963837_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963836_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963835_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963834_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963833_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963832_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963831_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963830_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963829_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963828_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963827_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963826_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963825_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963824_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963823_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963822_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963821_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963820_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963819_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963818_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963817_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963816_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963815_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963814_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963813_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963812_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963811_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963810_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963809_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963808_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963807_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963806_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963805_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963804_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963803_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963802_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963801_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963800_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU963799_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668345_HBc_P-B      SPHHTALRQAILCWGELVNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668344_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668330_HBc_P-B      SPHHTALRQAILCWGELVNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668323_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668300_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668234_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668149_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668133_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668115_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668102_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668101_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668098_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668097_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668061_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668009_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVDMGLKIR
KU668002_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667980_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667956_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667823_HBc_P-B      SPHHTALRQAILCWGELMNLAAWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667702_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667695_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667686_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667659_HBc_P-B      SPHHTALRQAILCWGKLMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
KU667577_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
KU667569_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667551_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667540_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667515_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667484_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667469_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667460_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667427_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU577121_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU577120_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU577117_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU577115_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU577111_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU577081_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU577004_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576985_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576984_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576983_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576982_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576981_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576980_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576978_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576940_HBc_P-B      SPHHTALRQAILCWGELMNLATWAGSNLEDPASRELVVSYVNVNMGLKIR
KU576873_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576872_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576871_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576870_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576869_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576868_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576867_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576866_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576806_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIR
KU576804_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIR
KU576794_HBc_P-B      SPHHTALRQAILCWGELMNLATWAGSNLEDPASRELVVSYVNVNMGLKIR
KU576793_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576792_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576788_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576785_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576784_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576783_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576782_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576781_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576780_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576777_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576624_HBc_P-B      SPHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576460_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU576420_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVDMGLKIR
KU576327_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576326_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576325_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576324_HBc_P-B      SPHHTALRQAILCWGELVNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576321_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576320_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576319_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576310_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576309_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576191_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576052_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576045_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576043_HBc_P-B      SLHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576039_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576024_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576022_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU575984_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIR
KU575982_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIR
KU575980_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIR
KU575978_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIR
KU575976_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIR
KU575975_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIR
KU575974_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIR
KU575973_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIR
KU575953_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU575945_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIR
KU575942_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU575937_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU575928_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIR
KU575922_HBc_P-B      SPHHTALRQAILCRGELMNLATWVGSNLEDPSSRELVVSYVNVNMGIKIR
KU234318_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KR232337_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KR152339_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148583_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148582_HBc_P-B      SPHHTALGQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIR
KP148580_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148461_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148457_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148456_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148455_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148453_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148451_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148403_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148402_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148401_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148400_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148398_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148397_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148396_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148395_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148394_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148391_HBc_P-B      SPHHTALRQAILCWGELMNLATWGGSNLEDPASRELVVSYVNVNMGQKIR
KP148390_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148389_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148388_HBc_P-B      SPHHTALRQAILCWGALMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148387_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148386_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148385_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148384_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148383_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148380_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148379_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148378_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148377_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148376_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148375_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148374_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148373_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148372_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148371_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148370_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148369_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148368_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148367_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148365_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148363_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148362_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148360_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148359_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148357_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148356_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148349_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148348_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148347_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148346_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148345_HBc_P-B      SPHHTALRQAILCWGELMNLAAWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148343_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148342_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148341_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148340_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148339_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148338_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148336_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148335_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148334_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148333_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148331_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148330_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148328_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148327_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148324_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148323_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148321_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148320_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148319_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148318_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148314_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KM526759_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KM526758_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KM526754_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KM526751_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KM526750_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KM526748_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KM526747_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KM392084_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KM392083_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KM392072_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KM359440_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KM213032_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KJ803795_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGLKIR
KJ803787_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ803783_HBc_P-B      SPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ803764_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ803763_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ410517_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ410516_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ410507_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ410490_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173425_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173424_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173423_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173422_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173421_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173420_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173417_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173416_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173415_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173414_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173413_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173412_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173411_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173410_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173409_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173408_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173407_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173406_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173405_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173402_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173401_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173400_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173399_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173398_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173397_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173390_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173389_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173388_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173387_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173386_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173383_HBc_P-B      SAHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173382_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173381_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173380_HBc_P-B      SPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173377_HBc_P-B      SPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173376_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173375_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173374_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173370_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173369_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173367_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173366_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173365_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173364_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173363_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173361_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173360_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173359_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173357_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173356_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173355_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173354_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173353_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173352_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173351_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173347_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173345_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173343_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173342_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173341_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173340_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173339_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KJ173297_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KF167010_HBc_P-B      SPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KF165328_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC836874_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC836872_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC836865_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC836864_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC836863_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC836861_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC836857_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC836853_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC836847_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC836843_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC836841_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC836830_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774418_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774417_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774416_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774413_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774412_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774411_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774409_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774408_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774407_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774404_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774403_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774402_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774401_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774399_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774398_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774396_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774393_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774392_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774391_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774390_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774388_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774387_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774386_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774385_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774384_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774382_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774381_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774380_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774379_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774378_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774376_HBc_P-B      SPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774375_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774374_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774373_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774372_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774369_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774367_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774366_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC774363_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510660_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510659_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510658_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510657_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510656_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510655_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510654_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510653_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510652_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510651_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510650_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510649_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510648_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510647_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510646_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510644_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510643_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510642_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KC510641_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX978431_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX870001_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQGSRELVVSYVNVNMGLKIR
JX869999_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX661484_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX661483_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX661482_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX661481_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX661480_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX661479_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX661478_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX661477_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX661476_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX661475_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX661474_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX661473_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX661472_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX661471_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX661470_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX507215_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX507210_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX429902_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JX429899_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPVSRELVVSYVNVNMGLKIR
JQ801514_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ801512_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ801507_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ801479_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ801471_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ688405_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ429081_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ341530_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ341510_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ341501_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ341496_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ341485_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ341484_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ341483_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ341481_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ341477_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ341470_HBc_P-B      SPHHTALRQAXLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ341465_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ341464_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ341461_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ341459_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ040173_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ040171_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ040170_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ040125_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ027316_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
MF674491_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
MF674465_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKIR
MF674392_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU964107_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU964105_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU964102_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU964101_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU964100_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU964098_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU964096_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668337_HBc_P-B      SPHHTALRQAILCWGGLMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668318_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668297_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668274_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668256_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668105_HBc_P-B      SPHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667520_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576499_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576493_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576470_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576419_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576412_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576408_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576406_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576401_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576400_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576399_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU575981_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPSSGELVVNYVNVNMGIKIR
KJ803786_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPGSRELVVNYVNVNMGLKMR
JQ341467_HBc_P-B      SPHHTALRQAIXCWGEXMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
X97850_HBc_P-B        SPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKLR
MF674461_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KY689445_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
MF674409_HBc_P-B      SPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ429080_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
JQ341515_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEXPASRELXVSYVNVNMGLKXR
JQ429079_HBc_P-B      SPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSXVNVNMGLKXR
KX276785_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVNVNMGLKXR
JQ027313_HBc_P-B      SHHHTALRQAILCWVELMNLATWVGGNLEDPASRELVVNHVNXNMGXKIR
KX276794_HBc_P-B      SHHHTALRQAILCWVELMNLATWVGGNLZDXASRXLVVNXVNVNMGIKIR
EU564822_HBc_P-B      SPHHTALRQAIQCWGEVMNLATWVGSNLEDPASRESVVSYVNINMGLKMR
EU564823_HBc_P-B      SPHHTALRQAIQCWGEVMNLATWVGSNLEDPASRESVVSYVNINMGLKMR
EU564824_HBc_P-B      SPHHTALRQAIQCWGEVMNLATWVGSNLEDPASRESVVSYVNINMGLKMR
DQ993684_HBc_P-B      SPHHTALRQAILCWGELMNLPTWVGSNLEDPASWKLLATCRNVKMGPKIS
EU547563_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
HM011496_HBc_P-B      TPHHTALRQAIVCWGELMNLATWVGSNLEDQSSRDLVVGYVNVNMGLKLR
FJ562312_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
EU570075_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
FJ032344_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
FJ386656_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
GQ924638_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRESVVSYVNVNMGLKLR
GQ924635_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
EU579441_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
FJ386608_HBc_P-B      SPHHTALRQAILCWGELMSLATWVGGNLEDPASRELVVGYVNVNMGLKIR
AY167098_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNAGLKIR
GU815578_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNVGLKIR
EU660230_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
EU660231_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
EU660232_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
EU660233_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
EU306681_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLGDPASRELVVSYVNVNMGLKIR
EU306679_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
EU306680_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
AF461360_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
AY800389_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
EU306677_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
EU306678_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
GU815574_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
GU815577_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
AB073825_HBc_P-B      TAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
HM011476_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLDDPASRELVVGYVNVNMGIKLR
DQ904357_HBc_P-B      SPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
AY269105_HBc_P-B      SPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
EU939675_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
EU939635_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGGNLEDAASRELVVGYVNVNMGLKLI
AB219427_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU668014_HBc_P-B      SPRHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU576303_HBc_P-B      TPHHAALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU576299_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU576308_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
FJ386658_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
EU158263_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLR
AB023667_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
AB212626_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
FJ562257_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU576300_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVSVNMGLKLR
JQ341476_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFR
FJ751766_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
AB365445_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDQGSRELVVGYVNVNMGLKLR
AB023682_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
KU667473_HBc_P-B      SPPHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
HM011480_HBc_P-B      SAHHTALRQAILCWGELTNLATWVGGNLEDQASRELVVGYVNDNMGLKLR
EU919175_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
EU919176_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
AY220697_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
FJ787475_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KU964258_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
EU939663_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
EU939669_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
FJ899779_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
AY517488_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
HM011492_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KP406330_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KP406332_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KP406333_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
KP406334_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
AF157021_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
AF157022_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
JQ341466_HBc_P-B      SXHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
DQ361535_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
AY269109_HBc_P-B      SPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
EU882003_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
AY220703_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
AY220704_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
EU939639_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
AF335751_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
FJ386681_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
EU660224_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
AB642094_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
EU881997_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
EU881998_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
EU882004_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
FJ032349_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
FJ386675_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
FJ562289_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
GQ377519_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
AF324082_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU668305_HBc_P-B      SPHHTALRQAILCWGELINLATWVGSNLEDPASRELVVGYVNVNMGLKLR
FJ562231_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLR
KP406335_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLR
AY596112_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
AB031267_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
FJ562253_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU667968_HBc_P-B      SPHHTALRQAILCWGGSMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU667481_HBc_P-B      SPPHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
FJ751769_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU667740_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
MF568475_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KX276792_HBc_P-B      TXHHTAXRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU668304_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU576924_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406164_HBc_P-B      SPHHTALRQAILCWDELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
KM526757_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLR
KC774397_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP148581_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
GU827630_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLR
EF494381_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
AY269128_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPSSRELVVGYVNVNMGLKLR
AY206375_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVGYVNVNMGLKLR
KX276818_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU667993_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU667647_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU667640_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLGDPASRELVVGYVNVNMGLKLR
KU576307_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU576301_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406240_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406238_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406234_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
JX429901_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLR
JQ040147_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU667957_HBc_P-B      SPHHTALRQAILCWGGSMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU668008_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
JQ341508_HBc_P-B      SPHHTALRQAVLCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
KU668165_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU667768_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU667701_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU667506_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU667455_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGNNLEDPASRELVVGYVNVNMGLKLR
KU667447_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU576638_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPSSRELVVGYVNVNMGLKLR
KU576297_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLR
KU575940_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU575938_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406243_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406242_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406241_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406237_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406236_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406235_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406233_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406232_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406231_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406230_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406229_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406228_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406227_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406225_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406224_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406223_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406222_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406221_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KP406220_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KM875417_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KM875416_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
JQ341480_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVGYVNVNMGLKLR
KX276815_HBc_P-B      SHHHTALRQAILCWGELMNLATWVGGNLEDPTSREAVVGYVNVNMGLKLR
HM011469_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPXSREAVVGYVNVNMGLKLR
KX276822_HBc_P-B      SXHHTALRQAILCWGELMNLATWVGGNLEDPXSREAVVGYVNVNMGLKLR
KU667788_HBc_P-B      SPHHTAIRQAVLCWGELMSLATWVGSNLDDQASRDLVVSYVNVNMGLKFR
KU667774_HBc_P-B      SPHYTAIRQAVLCWGELMSLATWVGSNLDDQVSRDLVVSYVNVNMGLKFR
KU667752_HBc_P-B      SPHHTAIRQAVLCWGELMSLATWVGSNLDDQASRDLVVSYVNVNMGLKFR
KU667763_HBc_P-B      SPHHTAIRQAVLCWGELMSLATWVGSNLDDQASRDLLVSYVNVNMGLKFR
KU667836_HBc_P-B      SPHHTAIRQAVLRWGELMSLATWVGSNLDDQASRDLVVSYVNVNMGLKFR
KU667827_HBc_P-B      SPHHTAIRQAVLCWGELMSLATWVGSNLDDQASRDLVVSYVNVNMGLKFR
KU667729_HBc_P-B      SPHHTAIRQAVLCWGELMSLATWVGSNLDDQASRDLVVSYVNVNMGLKFR
KU667800_HBc_P-B      SPHHTAIRQAVLCWGELMSLATWVGSNLDDQASRDLVVSYVNVNMGLKFR
EU939636_HBc_P-B      TAHHTALRQAIVCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKIR
GQ924630_HBc_P-B      SPHHTALRQAIVCWGELVNLATWVGGNLEDQASRELVVGYVNGNMGLKIR
HM011471_HBc_P-B      SPHHTALRQAILCWGXLMNLATWVGSNLEDPASRESVVSYVNVNMGIKIR
KJ803768_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLR
EU939671_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGGNLEDQASRDLVVGYVNVNMGLKLR
KY689469_HBc_P-B      SAHHTALRQAIVCWGELMNLATWVGSNLEDPGSRELVVSYVNVNMGLKIR
KY689516_HBc_P-B      SAHHTALRQAIVCWGELMNLATWVGSNLEDPGSRELVVSYVNVNMGLKIR
GQ924645_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
GQ924632_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKLR
KU576087_HBc_P-B      SPHHTALRQASLCWGELMNLVTWVGSNLEDPASRELVVSYVNVNMGLKLR
AB205122_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KU668258_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU668027_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KP148459_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
KC774419_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIR
EF473973_HBc_P-B      SPHHTALRQAILGWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KU576654_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIR
KU576306_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRGLVVGYVNVNMGLKLR
GQ924628_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKLR
FJ562234_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNGHMGLKLR
KU576146_HBc_P-B      SPHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFR
KM875427_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
JQ801506_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKFR
FJ562236_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
AB073823_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU577107_HBc_P-B      SPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
KP406165_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKLR
KP406167_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKLR
GU815587_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSKLEDPASRELVVSYVNVNMGLKIR
GQ377610_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIR
FJ562259_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGGNLEDPQSREAVVGYVNVNMGLKLR
AB212625_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU667840_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667508_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU667445_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPTSRELVVSYVNVNMGLKIR
KU576655_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIR
KU576304_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
JX504538_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFR
JQ341475_HBc_P-B      SPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELXVSYVNVNMGLKIR
GQ924639_HBc_P-B      SAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
FJ023633_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLR
KU667879_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
KU576653_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU576639_HBc_P-B      TPHHTALRQAILCWGELMNLATWVGGNLEDPSSRELVVGYVNVNMGLKLR
KU576295_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU576288_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLR
KU576051_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVSYVNVNMGLKIR
KP406171_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKLR
JQ341493_HBc_P-B      SPHHTAXRQAILCWGELMNLAXWVGXNLEDPASRELVVGYVNVNMGLKLR
GU815573_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
GQ924610_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
GQ377561_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
FJ386654_HBc_P-B      SPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIR
FJ386642_HBc_P-B