HBVdb

Dataset for protein HBe of genotype B

[Download (right click)] [Edit] [Sequences] [Repertoires]

1573 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


EF494382_HBe_P-B      -MQLFHLCLIISCSCPTFQASKLCLGWLWDMDIDTYKEFGASVELLS--F
KU667438_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLS--F
KU667569_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLS--F
KU667540_HBe_P-B      -MQLFHLCLIISCSCPTVQASELCLGWLWGMDIDPYKEFEASVELLS--F
KU667460_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLS--F
KU667469_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLS--F
KU667508_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLS--F
KU667493_HBe_P-B      -MKLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLS--F
KU576691_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLEWLWDMDIDPYKEFGASAELLS--F
GQ924635_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689469_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY689516_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU667936_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ803797_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU919171_HBe_P-B      -LQFFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB900110_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--F
AB900112_HBe_P-B      -TQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--F
AB073850_HBe_P-B      -TQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--F
D00329_HBe_P-B        -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
AB073851_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
AB010289_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
AB073848_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
AB246341_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
AB246342_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
AB246343_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
AB287314_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
AB287315_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
KP659247_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
LC279268_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
LC279269_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
LC279270_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
LC279271_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
LC279272_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
LC279273_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
LT992442_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
AB073846_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--F
KP659234_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
KP659235_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
AB205121_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
KP659237_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
KU668308_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ144564_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ144594_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF157023_HBe_P-B      -MQLFHRCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
AF157024_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF335740_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU939666_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDTYKEFGASVELLS--F
FJ023637_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
FJ386636_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--F
FJ751767_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
GQ475340_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU796066_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
FJ023576_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KX276776_HBe_P-B      -LQLFHLCLIXSCSCPTVQASKLCLGWLXDMDIDTYKEFGASVELLS--F
KU668009_HBe_P-B      -MQLFHLCLIIPCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU667956_HBe_P-B      -MQLFHLCLIISCSCPTVKASKLCLGRLWGMDIDPYKEFGASVELLS--F
KU667840_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU667412_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELFS--F
KU576322_HBe_P-B      -MQLFHLCLIISCSCPTVQASELCLGWLWGMDIDPYKEFGASVELLS--F
KU668216_HBe_P-B      -MQLFHLSLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF480349_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
KU964381_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU964382_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU964383_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU964384_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU964385_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU964388_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU964391_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU964393_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU964395_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU964397_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
MG571368_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964386_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU964387_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU964389_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU964390_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU964392_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU964396_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU576807_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--F
KU576647_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576626_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774368_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
HQ700546_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLS--F
GQ924624_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU576809_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--F
FJ386648_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASLELLS--F
EU939559_HBe_P-B      -MQLFHLCLIISCSCPIVQASKLCLGWLWDMDIDTYKEFGASVELLS--F
AB231909_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB073825_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881906_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--F
KY689488_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKPFGASVELLS--F
KX276805_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668358_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668330_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668076_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU667996_HBe_P-B      -MQLFHLCLIISCPCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU667955_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU667448_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
KU667422_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148582_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341499_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASXELLS--F
HM011487_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATTELVS--F
GQ377644_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ993708_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF479684_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB073822_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
AF335738_HBe_P-B      -MQLFHLCPIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
EU939676_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
FJ386600_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKENGASVELLS--F
GQ377525_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
X98077_HBe_P-B        -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU964091_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGAYVELLS--F
KU668318_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
KU668289_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGTSVELLS--F
KU667784_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGAPVELLS--F
KU667612_HBe_P-B      -MQLFHLCLIISCSRPTVQASKLCLGWLWGMDIDPYKEFGAPVELLS--F
KU577089_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ803787_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX429910_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
JQ040171_HBe_P-B      -MQIFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF335748_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689562_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--F
KY689523_HBe_P-B      -MQLFHLCLIISCSCPTVQASXLXLGWLWGMDIDXYKEFGFSVELLS--F
KX276809_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--F
KU575922_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ803752_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
JQ040173_HBe_P-B      -MQIFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ040157_HBe_P-B      -MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDTYKEFGASVELLS--F
JQ040125_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815764_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLS--F
GU815761_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLS--F
GU815722_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMGIDPYKEFGASVELLS--F
GU815696_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815688_HBe_P-B      -MQPFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815678_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815676_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815668_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815659_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815627_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVDLLS--F
GU815612_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815610_HBe_P-B      -MQPLHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815558_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGVDIDPYKEFGASVELLS--F
GQ924607_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY269110_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
AF480348_HBe_P-B      -MQLLHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--F
AB033554_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU963951_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668307_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668299_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668012_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU667879_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU667859_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU667700_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576320_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGAPVELLS--F
KU576132_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576051_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKAFGASVELLS--F
KP148421_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148392_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVESLS--F
KP148388_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774408_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ040169_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--F
HM011474_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815752_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815605_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ924605_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571323_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674420_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
MF674396_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLS--F
KY881850_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881799_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY689553_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY470961_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY470960_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964155_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964101_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
KU964088_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU964084_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU576325_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148396_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ803781_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ410490_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774419_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
HM011494_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
GU815677_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MK052964_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
MG571331_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674481_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674480_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674421_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674400_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674391_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
LC416037_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881808_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881801_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881800_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881798_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881797_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881796_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDTDPYKEFGASVELLS--F
KY881795_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881794_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881793_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881791_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881790_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881789_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGTDIDTYKEFGASVELLS--F
KY881788_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881787_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881784_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881783_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDKYKEFGASVELLS--F
KY881782_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881781_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881780_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY629635_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU964106_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU964103_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU964099_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU964097_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU964095_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU964094_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU964093_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU964092_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU964090_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU964089_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU964087_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU964085_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU964083_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU964081_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU964079_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU576879_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU576877_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU576875_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU576808_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU576803_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU576046_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KP148435_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP036970_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KJ173419_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KJ173418_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KJ173413_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173382_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173356_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341510_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ040170_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ040128_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYXEFGASVELLS--F
JN827419_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JN406371_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JF899335_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JF775484_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JF775483_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JF775482_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JF775480_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JF412801_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
HQ700549_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
HQ700548_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815780_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815771_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815770_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815769_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815768_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815767_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815766_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815765_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815762_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815760_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815759_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815756_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815755_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815754_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815753_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815751_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815750_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815749_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815746_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815745_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815744_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815743_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815742_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815741_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815740_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815739_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815738_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815737_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815736_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815735_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815734_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815733_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815732_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815731_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815730_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815729_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815728_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815727_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815726_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815725_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815724_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815723_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815721_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815720_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815719_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815718_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815717_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815716_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815715_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815713_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815712_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815711_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815709_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815708_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815705_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815704_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815703_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815702_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815701_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815700_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815698_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815697_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815695_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815693_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815692_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815691_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815689_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815687_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815686_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815685_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815684_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815683_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815681_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815680_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815679_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815675_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815674_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815673_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815672_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815670_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815669_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815667_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815666_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815665_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815664_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815663_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815662_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815661_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815660_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815658_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815657_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815656_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815654_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815653_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815652_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815651_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815650_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815649_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815648_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815647_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815646_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815645_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815644_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815643_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815642_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815640_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLP--F
GU815639_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815638_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815637_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815636_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815635_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815634_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815633_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815632_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815631_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815628_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815626_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815625_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815624_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815623_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815622_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815621_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815620_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815619_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815618_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815617_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815616_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815614_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815613_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815611_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815608_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815607_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815606_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815604_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815603_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815602_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815601_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815600_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815599_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815598_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815597_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815596_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815595_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815593_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815590_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815588_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815587_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYEEFGASVELLS--F
GU815586_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815585_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815581_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815579_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815576_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815575_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815573_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815571_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815570_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815569_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815568_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815567_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815566_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815565_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815564_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815563_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815562_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815561_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815560_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815559_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815557_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815556_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815555_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815554_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815553_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815552_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815551_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815550_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815549_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815548_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU451682_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU434373_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU434372_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU357842_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ924654_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ924653_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ924651_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ924640_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ924634_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ924631_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ924627_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ924621_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ924611_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ924610_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDRYKEFGASVELLS--F
GQ924608_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341459_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341461_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX507213_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
JQ341487_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDXYKEFGASVELLS--F
JQ341460_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
JQ341475_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--F
KY689557_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKXFGASVELLS--F
JQ341468_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--F
JQ341473_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--F
JQ341494_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--F
JQ341467_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--F
MG571374_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ924606_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689413_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341497_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341496_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341491_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASXELLS--F
JQ341490_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341489_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341485_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341482_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341481_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341479_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341477_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341470_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341463_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--F
JQ341462_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFXASVELLS--F
JQ341465_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341483_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--F
JQ341464_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341484_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341486_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--F
JQ341502_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EF473974_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668003_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
AY269128_HBe_P-B      -MQLFHLCLIISCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG826152_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS--F
KU667659_HBe_P-B      -MQLFHLSLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576069_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU576070_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
GQ924638_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
GQ358137_HBe_P-B      -MQLFPLCLNISCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLS--F
EU306699_HBe_P-B      -MQLFHLCLIITCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY596111_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ995805_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
AB713532_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB493827_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF480353_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF480364_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYIEFRASGELLS--F
AF480360_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--F
AF480358_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--F
AF480354_HBe_P-B      -MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASMELLS--F
AF480352_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--F
AF480340_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--F
AF480347_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--F
AF480350_HBe_P-B      -MQLFHLCLIISCSCPTVRASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF480359_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--F
AF480361_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF480346_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--F
KX276774_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLEWLWDMDIDPYKEFGASVELLS--F
KU576692_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--L
JQ027316_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS--F
JF436921_HBe_P-B      -MQLFHLCLIISCSCPTFQASKLCLGWLWGMDIDPYKEFGASVELLS--F
HM011504_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
GQ358145_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVEVLS--F
AF282917_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB713530_HBe_P-B      -MQLLHLSLIISGSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB212625_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDTYKEFGASAELLS--F
AB100695_HBe_P-B      -MQLFEFCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU667640_HBe_P-B      -MQLFHLSLINSCSCPTVQASKQCLGRLWGMDIDPYKEFGASVELLS--F
KU668173_HBe_P-B      -MQLFHLSLIISCSCPTVQASKLCLGWLWGMDIDPYKESGASVELLS--F
EU939633_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
EU939634_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
FJ755833_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576641_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576015_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576018_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ358147_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWIWGMDIDPYKEFGASVEVLS--F
KJ173373_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX661477_HBe_P-B      -MQLFHLCLVISCSCPTVQALQLCLGWLWGMDIDPYKEFGASVELLS--F
JX661479_HBe_P-B      -MQLFHLCLVISCSCPTVQASQLCLGWLWGMDIDPYKEFGASVELLS--F
FJ562311_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
EF494381_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--F
AY269120_HBe_P-B      -MQLFYLCLIISCSCSTIQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY269105_HBe_P-B      -MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASAELLS--F
FJ751769_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF480343_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDLYKEFGASMELLS--F
AF480337_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWPWGMDIDPYKEFGASGELLS--F
AF480342_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF480344_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--F
AF480351_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--F
AF480355_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLRGMDIDPYKEFGASGELLS--F
AF480356_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--F
AF480357_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--F
AF480362_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--F
AY220703_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
AY220704_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
EU939639_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
GU827630_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF480338_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--F
GU815572_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ032358_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--F
FJ032353_HBe_P-B      -MQLFHLFLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU487256_HBe_P-B      -MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB073831_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB355453_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB713531_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY596110_HBe_P-B      -MQLFHLCLIISRSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815748_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815747_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ377519_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ386675_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ032357_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--F
EU439021_HBe_P-B      -MQLFHLXLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ032349_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB908299_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB908303_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023628_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB212626_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
EU882004_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB073833_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
AY167098_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306677_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ562257_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
FJ562296_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASXELLS--F
GU815574_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GU815577_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023633_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881848_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--F
KU667980_HBe_P-B      -MQLFHLCLIISCSCPTVQAYKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668300_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU667858_HBe_P-B      -MKLFHLCLIISYSCPTVQASKLCLGWLWGMDIDPYKESGAPVELLS--F
KU576845_HBe_P-B      -LQLFYLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576843_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576754_HBe_P-B      -LQLFRLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576624_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774362_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGASGELLS--F
KC774374_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KC774380_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KC774386_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KC774392_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
JQ027311_HBe_P-B      -IQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASXXLLS--F
GQ377625_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ358148_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ358144_HBe_P-B      -MQLFPLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023610_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU881998_HBe_P-B      -MQLFYLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU660224_HBe_P-B      -MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU570069_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU439023_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLRLGWLWGMDIDPYKEFGASVELLS--F
EU330997_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLRGMDIDPYKGFGASVELLS--F
EU330996_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306712_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306709_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306707_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023627_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306703_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EF473976_HBe_P-B      -MQLFHLCLNISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EF473973_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
DQ993707_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ993696_HBe_P-B      -MQLFNLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ993697_HBe_P-B      -MQLFNLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ993687_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGSSAELLS--F
DQ904357_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
DQ144560_HBe_P-B      -MQLVHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ144597_HBe_P-B      -MQLVHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY269109_HBe_P-B      -MQLFHLCLIISCSCHTVQASKLCLGWLWGMDIDPYKEFRASVELLS--F
AY269102_HBe_P-B      -MQLFHLCLIISCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY269091_HBe_P-B      -MQLFHLCLIISCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY269100_HBe_P-B      -MQLFHLCLIISCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY269108_HBe_P-B      -MQLFHLCLIISCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY217360_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF480363_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--F
AF480341_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF335746_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF121247_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
AF100308_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB493835_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB493833_HBe_P-B      -MQLFHLCLIISCSCPTGQASNLCLGWLWGMDIDPYKEFGASVELLS--F
AB355455_HBe_P-B      -MQLFHLCLIITCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB241116_HBe_P-B      -MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASTELLS--F
AB219426_HBe_P-B      -MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASMELLS--F
AB219429_HBe_P-B      -MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB241117_HBe_P-B      -MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASTELLS--F
AP011086_HBe_P-B      -MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AP011087_HBe_P-B      -MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB115551_HBe_P-B      -MQLFEFCLVISRSCPTVQASKLCLGWLWAMDIDPYKEFGASVELLS--F
AB073840_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571321_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
MF674407_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668336_HBe_P-B      -MQLFHHSLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576703_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575981_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVVLLS--F
JX661476_HBe_P-B      -MQLFHLCLVISCSCPTVHTRKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ386684_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023617_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023613_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023575_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EF473977_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF100309_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ448626_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB908300_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB908304_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ993711_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB246340_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS--F
DQ361535_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
EU939669_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--F
FJ899779_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--F
GQ377638_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
GU815584_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
MF674476_HBe_P-B      -MQLFHLCLVISRSCPTVQASKLCLGWLWAMDIDPYKEFGASVELLS--F
KU576637_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576300_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576088_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGAFVELLS--F
KP406170_HBe_P-B      -PYYTHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148453_HBe_P-B      -MQLFHLRLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX026879_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFFF
FJ032352_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ448625_HBe_P-B      -MHLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ144561_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ144598_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ144550_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY269095_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY269093_HBe_P-B      -FQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF157020_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB033555_HBe_P-B      -MQLFHLCLIISCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB073826_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB073827_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB073828_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB073829_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB073834_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB195933_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB195934_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB195935_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB205119_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB219428_HBe_C-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB219430_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB246339_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB287328_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB287329_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB300364_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB334299_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB334300_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB334301_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB334302_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB334303_HBe_P-B      -MQLFHLCLIISCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB355454_HBe_P-B      -MQLFHLCLIISCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB471854_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB471855_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB675676_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB713527_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF121243_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF121244_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF121245_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF121246_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF121249_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF233235_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF233237_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF282918_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF335741_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF335754_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF480339_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AF480345_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--F
AM888201_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGPSVELLS--F
AP011084_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AP011085_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AP011088_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AP011089_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AP011090_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AP011091_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AP011092_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AP011095_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AP011096_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY033072_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY033073_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY167089_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY217359_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY220698_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY269097_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY269115_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY269131_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY269135_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY293309_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY518556_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY596102_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AY766463_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
D00330_HBe_P-B        -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
D00331_HBe_C-B        -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ144599_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ448619_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ448620_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ448621_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ448622_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ448623_HBe_P-B      -MQLFHLCLIISCSCPTVQACKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ448627_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ448628_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ975271_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ993694_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ993700_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ993701_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ993703_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ993706_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ993709_HBe_P-B      -MQLFHLCLIISRSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
DQ995801_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EF134945_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
EF134946_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EF473972_HBe_P-B      -MQLFHLCLIISCSCPSVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EF473975_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EF494380_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU139543_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU305547_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU305548_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306695_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306696_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306697_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306698_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306700_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306701_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306702_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306704_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306705_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306706_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306708_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU306710_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU330989_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU330990_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU330992_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU330994_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU330998_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU330999_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU331000_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU331001_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU350409_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU439018_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU439020_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVEVLS--F
EU439022_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU570070_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU570071_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU796067_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU796068_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
EU796071_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023569_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023605_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023606_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023607_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023608_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023609_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023611_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023612_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023614_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023618_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023620_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023629_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023630_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023634_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023635_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023636_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023638_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ032354_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ349236_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ386582_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ386583_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ386584_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ386610_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ386642_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ386654_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ386655_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ386660_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ386666_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ386668_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ386676_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ386688_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASTELLS--F
FJ518812_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ562224_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
FJ562253_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
FJ562322_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ667207_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ787444_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ358136_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ358138_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ358141_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ358142_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ358143_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ358149_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ358150_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ358151_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ358152_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ377537_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ377542_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ377558_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ377561_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ377566_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ377568_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ377569_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ377587_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ377588_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ377612_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ377629_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ377639_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ377641_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ377643_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ855522_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ855526_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ855532_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
GQ924603_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571360_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571351_HBe_P-B      -TQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689444_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELIS--F
KY689419_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KX276806_HBe_P-B      -LXLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KX276777_HBe_P-B      -XQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDXYKEFGASVELLS--F
KU576630_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576629_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576623_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576620_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576619_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576307_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576304_HBe_P-B      -MQLFPLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576299_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576288_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576240_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575976_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575921_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--F
KJ843165_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--F
KJ803783_HBe_P-B      -MQHFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ562289_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
FJ023573_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--L
DQ448624_HBe_P-B      -MQLFHLCLIIPCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB713528_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
AB073821_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--F
KY689414_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLXXMDIDPYKEFGASVELLS--F
KX276821_HBe_P-B      -TQLFHLCLIISCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLS--F
MF674385_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689534_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLXXMDIDPYKEFGASVELLS--F
KY689477_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLS--F
KY689426_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLS--F
KX276817_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLXXMDIDPYKEFGASVELLS--F
KX276824_HBe_P-B      -RQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571349_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674487_HBe_P-B      -MQLFHLCLVISRSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674443_HBe_P-B      -MQLFRLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
M54923_HBe_P-B        -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689564_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689563_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689520_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KY470841_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY470837_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY470834_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964165_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963824_HBe_P-B      -MQLFFLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668116_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIGPYKEFGASVELLS--F
KU668108_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU667647_HBe_P-B      -MQLFHLSLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU667484_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELHS--F
KU667457_HBe_P-B      -MQLFHLCLIIPCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU577081_HBe_P-B      -MQLFHLCLIISCSCPAVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576940_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576848_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576806_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576794_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576777_HBe_P-B      -MQPFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576600_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--F
KU576331_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576324_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576309_HBe_P-B      -MQLFHLCLIISCSCPTAQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576052_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576043_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575982_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148414_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148411_HBe_P-B      -MQLFHLYLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148394_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148391_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148371_HBe_P-B      -MQLFHLCLIISCSCPTAQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148366_HBe_P-B      -MQLFHLCLIISCSCPTAQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148345_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KM392083_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KM392072_HBe_P-B      -MQLFDLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ803795_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ803784_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KJ803764_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173379_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173348_HBe_P-B      -MQLFHLCLIISCSCPTGQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774406_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KC774401_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KC774396_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KC774390_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KC774384_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KC774378_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KC774372_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KC774366_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KC510646_HBe_P-B      -PWIFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX661484_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX661483_HBe_P-B      -MQLFHVSLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX661482_HBe_P-B      -MQLFHVSLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX661481_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX661480_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--F
JX661478_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX661475_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX661474_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX661473_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX661472_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX661471_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX661470_HBe_P-B      -MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX507210_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--L
JQ707744_HBe_P-B      -MQLFHLCLIISCSCPTVQASTLCLGWLWGMDIDHYKEFGASVELLS--F
JQ429081_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASGELLS--F
MG571366_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
MF674493_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674437_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689448_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964154_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668369_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--F
KU668332_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU668309_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU668093_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668061_HBe_P-B      -MQLLHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU667997_HBe_P-B      -MQLFHLCLIISCSCPAVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU667987_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU577107_HBe_P-B      -STLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
KU576968_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576804_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576718_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU576713_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU576707_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU576702_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--F
KU576297_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576022_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575959_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575927_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148420_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148335_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCPGWLWGMDIDPYKEFGASVELLS--F
KP148334_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148323_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KM213034_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KF165906_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510642_HBe_P-B      -PRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX429899_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
AB048705_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571334_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881861_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLLGMDIDTYKEFGASVELLS--F
KX276830_HBe_P-B      -IQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASTELLS--F
KU668149_HBe_P-B      -VQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576778_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576746_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576308_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576306_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS--F
KU576303_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576302_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576295_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575984_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575983_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575980_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575979_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575978_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575974_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575973_HBe_P-B      -MQLFHLCLIISCSCPTVQAPKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575945_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575928_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148440_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148438_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148433_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148429_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148424_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148418_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148410_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148407_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148341_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510660_HBe_P-B      -MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510659_HBe_P-B      -MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510658_HBe_P-B      -MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510657_HBe_P-B      -MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510656_HBe_P-B      -MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510655_HBe_P-B      -MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510654_HBe_P-B      -MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510653_HBe_P-B      -MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510652_HBe_P-B      -MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510651_HBe_P-B      -MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510650_HBe_P-B      -MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510649_HBe_P-B      -MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510648_HBe_P-B      -MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510647_HBe_P-B      -MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510643_HBe_P-B      -MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC510641_HBe_P-B      -MRLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
X97851_HBe_P-B        -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MK075117_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MK052965_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MK052962_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MH663473_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MH061283_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG826153_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571371_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571369_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571365_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571364_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571361_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--F
MG571356_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571355_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571348_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571347_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571346_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571344_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571342_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571341_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571340_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571328_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MG571327_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
MG571322_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674515_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674513_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674512_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674510_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674509_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674507_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--F
MF674506_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
MF674500_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674497_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674495_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674490_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674488_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674485_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674483_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674482_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674479_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674477_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674469_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
MF674462_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--F
MF674460_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674456_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674455_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674453_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674452_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674451_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674449_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674438_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674432_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674431_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674427_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674426_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674424_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674423_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--F
MF674419_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--F
MF674416_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674414_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674413_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674410_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674409_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674405_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674404_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674401_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674397_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674395_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674394_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674393_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674392_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
MF674389_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674387_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674384_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674383_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF674382_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
MF621878_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
LC349878_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
LC349877_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
LC349873_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
LC349872_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881786_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KY881779_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881778_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881761_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881760_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881759_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881757_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881756_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881753_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881752_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881747_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881746_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881745_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881741_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881740_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881735_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881734_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881733_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881732_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881731_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881730_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881729_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881728_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881727_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881726_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881725_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881724_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881723_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881722_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY881721_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689546_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689538_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689517_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689507_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689506_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689505_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689480_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689472_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689443_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689433_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689410_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY689408_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--F
KY629636_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY470962_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY470956_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY470954_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY470953_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY470840_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY470838_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY470835_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY470833_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY470832_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KY470830_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KX765856_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964168_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964167_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964166_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964164_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964163_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964162_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964161_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964160_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964159_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964158_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964157_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964156_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964153_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU964107_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
KU964105_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
KU964104_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
KU964102_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
KU964100_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
KU964098_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
KU964096_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
KU963989_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963988_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963987_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963986_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963985_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963984_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963983_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963982_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963981_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963980_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963979_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963978_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963977_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963976_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963975_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963974_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963973_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963972_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963971_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963970_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963969_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963968_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963967_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963966_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963965_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963964_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963963_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963962_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963961_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963960_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963959_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963958_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963957_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963956_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963955_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963954_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963953_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963952_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963950_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963949_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963948_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963947_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963946_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963945_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963855_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963854_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963853_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963852_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963851_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963850_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963849_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963848_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963847_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963846_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963845_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963844_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963843_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963842_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963841_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963840_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963839_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963838_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963837_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963836_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963835_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963834_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963833_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963832_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963831_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963830_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963829_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963828_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963827_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963826_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963825_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963823_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963822_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963821_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963820_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963819_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963818_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963817_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963816_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963815_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963814_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963813_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963812_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963811_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963810_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963809_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963808_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963807_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963806_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963805_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963804_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963803_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963802_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963801_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963800_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU963799_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU679959_HBe_P-B      -MQLFHLCLIISCSCPTVQASKQCLGWLWGMDIDPYKEFGASVELLS--F
KU668133_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668124_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668115_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668069_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668058_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668046_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668037_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU668027_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU667590_HBe_P-B      -MQLFHLCLIISCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU667515_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU577004_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU577003_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576970_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576969_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576873_HBe_P-B      -MQLFHLCLIISCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576872_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576871_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576870_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576869_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576868_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576867_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576866_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576793_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576788_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576785_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576784_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576783_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576782_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576781_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576780_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576460_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--F
KU576328_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576327_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576326_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576321_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576319_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576310_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576189_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576054_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU576053_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KU576045_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576042_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYREFGASVELLS--F
KU576041_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576039_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576038_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576026_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYEEFGASVELLS--F
KU576024_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575977_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU575966_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU234318_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KR232337_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KR152339_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148583_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148581_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148580_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148579_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148461_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148457_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148456_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148455_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148452_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDTDPYKEFGASVELLS--F
KP148451_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148439_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148430_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148427_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148425_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148423_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148419_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148413_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148409_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148406_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148405_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148403_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148402_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148401_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148400_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148398_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148397_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148395_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148390_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148389_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148387_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148386_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148385_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148384_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148383_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148382_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLP--F
KP148380_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148379_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148378_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148377_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148376_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148375_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148374_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148373_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148372_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148370_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148369_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148368_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148365_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148364_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148363_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148362_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148361_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148360_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148359_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148357_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148356_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148349_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148346_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148344_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148342_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148340_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148333_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148332_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148331_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148330_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148328_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148327_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148326_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148325_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148324_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148322_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148321_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148320_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148319_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148318_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148317_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KM359440_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ803817_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ803796_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ803763_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ410517_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ410516_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ410507_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173425_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173424_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173423_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173422_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173421_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173420_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173417_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173416_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173415_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173414_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173412_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173411_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173410_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173409_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173408_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173407_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173406_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173405_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173404_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173403_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173402_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173401_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173400_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173399_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173398_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173397_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173390_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173389_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173388_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173387_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173386_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--F
KJ173381_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173376_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173375_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173374_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173370_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173369_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173367_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173366_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173365_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173364_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173363_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173361_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173360_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173359_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173357_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173355_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173354_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173353_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173352_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173351_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173347_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173345_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173343_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173342_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173341_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173340_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173339_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KJ173298_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KJ173297_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KF165328_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KF164967_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
KC836874_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC836872_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC836865_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC836864_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC836863_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC836861_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC836857_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC836853_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC836843_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC836841_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC836830_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774418_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774416_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774413_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774411_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774409_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774404_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774403_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774399_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774398_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774394_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774393_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774388_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774387_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774382_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774381_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774376_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774375_HBe_P-B      -MQLFHLCLIISCSCPTVQAPKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774370_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774369_HBe_P-B      -MQLFHLCLIISCSCPTVQAPKLCLGWLWGMDIDPYKEFGASVELLS--F
KC774363_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX978431_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX869999_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX869998_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX507215_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX504538_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDTDPYKEFGASVELLS--F
JX429908_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX429902_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX429897_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ801514_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ801512_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ801507_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ801479_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ801471_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ707767_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
JQ707765_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
JQ707764_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
JQ707763_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
JQ707759_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
JQ707758_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
JQ707755_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
JQ707750_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
JQ707749_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
JQ707747_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
JQ707743_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
JQ707742_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
JQ707739_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
JQ707738_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
JQ707737_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
JQ707734_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--F
JQ688405_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341493_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--F
JQ341504_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--F
MG571362_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148348_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148347_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148343_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148339_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148338_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KP148336_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341515_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JQ341530_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576633_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576640_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576645_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576656_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576681_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576693_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576698_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576704_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576714_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576738_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576748_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576751_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576766_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576854_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576856_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KU576874_HBe_P-B      -LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
JX429911_HBe_P-B      -MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FF
KM875426_HBe_P-B      MQLFLHLCLSISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--F
GU815694_HBe_P-B      ----FHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
KM392084_HBe_P-B      --QIFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--F
                                 . .    .:      .    . . *          .  :

EF494382_HBe_P-B      LPSDFFPNIRDLLDTANALYREALESPEHCSAHHTALRQAIVCWGELMNL
KU667438_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667569_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667540_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667460_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667469_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667508_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667493_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNL
KU576691_HBe_P-B      LPSDFFPNVRDLLDTASALYREALESPEHCSPHYTALRQAILCWGDLMNL
GQ924635_HBe_P-B      LPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY689469_HBe_P-B      LPNDFFPNIRDLLDTAAALHREALESQEHCSAHHTALRQAIVCWGELMNL
KY689516_HBe_P-B      LPNDFFPNIRDLLDTAAALHREALESQEHCSAHHTALRQAIVCWGELMNL
KU667936_HBe_P-B      LPSDFFPNIRDLLDTASALYREALEPPEHCSPHHTALRQAILCWGELMKL
KJ803797_HBe_P-B      LPSDFFPSIRDLLDTASALCRDALESPEHVSAHHTALRQAILCWGELMNL
EU919171_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPDHVSAHHTALRQAIVCWGELMNL
AB900110_HBe_P-B      LPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTAIRQAIICWGELMNL
AB900112_HBe_P-B      LPQDFYPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTL
AB073850_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPVHCSPHHTALRQAILCWGELMTL
D00329_HBe_P-B        LPSDFFPSVRDLLDTVSALYREALKSPEHCSPHHTALRQAILCWGELMTL
AB073851_HBe_P-B      LPSDFYPSVRDLLDTAAALYREALESPEHCSPHHTALRQAVLCWGELMTL
AB010289_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
AB073848_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
AB246341_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
AB246342_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
AB246343_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMTL
AB287314_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
AB287315_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
KP659247_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
LC279268_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
LC279269_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
LC279270_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
LC279271_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
LC279272_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
LC279273_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
LT992442_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHXALRQAILCWGELMTL
AB073846_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
KP659234_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
KP659235_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
AB205121_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
KP659237_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTL
KU668308_HBe_P-B      LPSDFFPNIRDLLDTASALYRKALESTEHCSPHHTALRQAILCWGELMNL
DQ144564_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
DQ144594_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
AF157023_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
AF157024_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
AF335740_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
EU939666_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
FJ023637_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
FJ386636_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
FJ751767_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
GQ475340_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
EU796066_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
FJ023576_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KX276776_HBe_P-B      LPSDFFPSIRDLLDTASALHREALESPEHCXXHHTALRHAIVCWGELMNL
KU668009_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667956_HBe_P-B      LPSDFFPSIRDLLDTASALYRGALESPEHCSPHHTALRQAILCWGELMNL
KU667840_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667412_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALWQAILCWGELMNL
KU576322_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHRTALRQAILCWGGLMNL
KU668216_HBe_P-B      LPSDFFPSIQDLLDTASALYREALESPEHCSPYHTALRQAILCWGELMNL
AF480349_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964381_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNL
KU964382_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNL
KU964383_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNL
KU964384_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNL
KU964385_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNL
KU964388_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNL
KU964391_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNL
KU964393_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNL
KU964395_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNL
KU964397_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNL
MG571368_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964386_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNL
KU964387_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNL
KU964389_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNL
KU964390_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNL
KU964392_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNL
KU964396_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMNL
KU576807_HBe_P-B      LPPDFFPSIRDLLDTVSALHREALESPEHCSPHHTALRQAIVCWGELMNL
KU576647_HBe_P-B      LPTDFFPSIRDLLNTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
KU576626_HBe_P-B      LPTDFFPSIRDPLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
KC774368_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
HQ700546_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ924624_HBe_P-B      LPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNL
KU576809_HBe_P-B      LPPDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNL
FJ386648_HBe_P-B      LPSDFFPSIRDLLDTAAALYREALESPVHCTPHHTALRQAIVCWGELMNL
EU939559_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAIVCWGELMNL
AB231909_HBe_P-B      LPSDFFPAIRDLLDTASALYREALESPEHCSPHHTAPRQAILCWGELMNL
AB073825_HBe_P-B      LPSDFFPSIRDLLDTASALHREALESPEHCTAHHTALRQAILCWGELMNL
KY881906_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAIVCWGELMNL
KY689488_HBe_P-B      LPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNL
KX276805_HBe_P-B      LPSDFFPSIRDLLDTXSALYREALESPEHCSHHHTALRQAVLCWGELMNL
KU668358_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAIMCWGELMNL
KU668330_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELVNL
KU668076_HBe_P-B      LPSDFFPNIRDLLDTASALYRKALESPEHCSPHHTALRQAILCWGELMNL
KU667996_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667955_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667448_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667422_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KP148582_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHYSPHHTALGQAILCWGELMNL
JQ341499_HBe_P-B      LPSDFYPSIRDLLDTASALYREALESPEHXTPHHTALRQAILCWGELMNL
HM011487_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELMNL
GQ377644_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQCILCWGELMNL
DQ993708_HBe_P-B      LPSDFFPSIPDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF479684_HBe_P-B      LPSDFFPSIRDLLDTASVLYREALESPEHCSPHHTALRQAILCWGELMNL
AB073822_HBe_P-B      LPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNL
AF335738_HBe_P-B      LPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNL
EU939676_HBe_P-B      LPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNL
FJ386600_HBe_P-B      LPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNL
GQ377525_HBe_P-B      LPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNL
X98077_HBe_P-B        LPSDFFPAVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNL
KU964091_HBe_P-B      LPSDFFPSIRDLLETATALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU668318_HBe_P-B      LPSDFFPNIRDLLDTDSALYREALESPEHCSPHHTALRQAILCWGELMNL
KU668289_HBe_P-B      LPSDFFPNIRDLLDTASALYREASESPEHCSPHHTALRQAILCWGELMNL
KU667784_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGGLMNL
KU667612_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU577089_HBe_P-B      LPSDFFPSVRDLLDTASALCRDALESPEHCSPHHTALRQAILCWVELMNL
KJ803787_HBe_P-B      LPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX429910_HBe_P-B      LPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNL
JQ040171_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF335748_HBe_P-B      LPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIQCWGEVMNL
KY689562_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY689523_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALTQAILCWGELMNL
KX276809_HBe_P-B      LPNDFFPSMRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNL
KU575922_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCRGELMNL
KJ803752_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
JQ040173_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ040157_HBe_P-B      LPSDFFPSIRDLLDTXXALYREALEXPEHCSPHHTALRQAIVCWGELMNL
JQ040125_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815764_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815761_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815722_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815696_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHPTALRQAILCWGELMNL
GU815688_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815678_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815676_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815668_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815659_HBe_P-B      LPSGFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815627_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815612_HBe_P-B      LPSDFFPSIRDPLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815610_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815558_HBe_P-B      LPSDFFPPIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ924607_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY269110_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF480348_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNL
AB033554_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU963951_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALMQAILCWGELMNL
KU668307_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU668299_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU668012_HBe_P-B      LPSDFFPSIRDLLDIASALYREALESPEHCSPHHTALRQAILCWGGSMNL
KU667879_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667859_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667700_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576320_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576132_HBe_P-B      LPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQASLCWGELMNL
KU576051_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KP148421_HBe_P-B      LPSDFFPSIRDLLGTASALYREALESPEHCSPHHTALRQAILCWDELMNL
KP148392_HBe_P-B      LPSDFFPPIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KP148388_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGALMNL
KC774408_HBe_P-B      LPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNL
JQ040169_HBe_P-B      LPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNL
HM011474_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNL
GU815752_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815605_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ924605_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571323_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNL
MF674420_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
MF674396_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNL
KY881850_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQVIVCWGELMNL
KY881799_HBe_P-B      FPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY689553_HBe_P-B      LPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY470961_HBe_P-B      LPPDFFPSIRDLLDTASTLYREALESPEHCSPHHTALRQAILCWGELMNL
KY470960_HBe_P-B      LPPDFFPSIRDLLDTASTLYREALESPEHCSPHHTALRQAILCWGELMNL
KU964155_HBe_P-B      LPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964101_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964088_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964084_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU576325_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KP148396_HBe_P-B      LPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KJ803781_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KJ410490_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KC774419_HBe_P-B      LPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
HM011494_HBe_P-B      LPSDFFPSXRDLLDTAXALYREALESPEHCSPHHTALRQAIVCWGELMNL
GU815677_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQVILCWGELMNL
MK052964_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
MG571331_HBe_P-B      LPSDFFPSIRDLLDTASALHREALESPEHCTPHHTALRQAILCWGELMNL
MF674481_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
MF674480_HBe_P-B      LPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNL
MF674421_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
MF674400_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
MF674391_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
LC416037_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881808_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881801_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881800_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881798_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881797_HBe_P-B      LPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNL
KY881796_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881795_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881794_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881793_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881791_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881790_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881789_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881788_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881787_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881784_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881783_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881782_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881781_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY881780_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KY629635_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964106_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964103_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964099_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964097_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964095_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964094_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964093_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964092_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964090_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964089_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964087_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964085_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964083_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964081_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU964079_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU576879_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU576877_HBe_P-B      LPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU576875_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU576808_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU576803_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KU576046_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KP148435_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIPCWDELMNL
KP036970_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNL
KJ173419_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KJ173418_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KJ173413_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KJ173382_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
KJ173356_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
JQ341510_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ040170_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ040128_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
JN827419_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JN406371_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JF899335_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JF775484_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JF775483_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
JF775482_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
JF775480_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JF412801_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
HQ700549_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
HQ700548_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815780_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815771_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815770_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815769_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815768_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815767_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815766_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815765_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815762_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815760_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815759_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815756_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815755_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815754_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815753_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815751_HBe_P-B      LPSDFFPSIRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815750_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815749_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815746_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815745_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815744_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815743_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815742_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815741_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815740_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815739_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815738_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815737_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815736_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815735_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815734_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815733_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815732_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815731_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815730_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815729_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815728_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815727_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815726_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815725_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815724_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815723_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815721_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815720_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815719_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815718_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815717_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815716_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815715_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815713_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815712_HBe_P-B      LPSDFFPSIRDLLDTASALYRETLESPEHCSPHHTALRQAILCWGELMNL
GU815711_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815709_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815708_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815705_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815704_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815703_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815702_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815701_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWVELMNL
GU815700_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPRHTALRQAILCWGELMNL
GU815698_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815697_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815695_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815693_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815692_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815691_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815689_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815687_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815686_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815685_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815684_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815683_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815681_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815680_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815679_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815675_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815674_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815673_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815672_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815670_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815669_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSL
GU815667_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815666_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815665_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815664_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815663_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815662_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815661_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815660_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815658_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815657_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815656_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815654_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815653_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815652_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815651_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815650_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815649_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815648_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815647_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815646_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815645_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815644_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815643_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815642_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815640_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815639_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNL
GU815638_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815637_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815636_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815635_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILRWGELMNL
GU815634_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815633_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815632_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815631_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815628_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815626_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815625_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815624_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815623_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815622_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815621_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815620_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815619_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815618_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815617_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815616_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815614_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815613_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815611_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815608_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815607_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815606_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815604_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815603_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815602_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815601_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815600_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815599_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815598_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815597_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815596_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815595_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815593_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815590_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815588_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815587_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815586_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815585_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815581_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815579_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815576_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815575_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815573_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815571_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815570_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815569_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815568_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815567_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815566_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815565_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815564_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSL
GU815563_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815562_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815561_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815560_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815559_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815557_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815556_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815555_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815554_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815553_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815552_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSL
GU815551_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815550_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815549_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815548_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU451682_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU434373_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU434372_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU357842_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ924654_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ924653_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ924651_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ924640_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ924634_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ924631_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ924627_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ924621_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ924611_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNL
GQ924610_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ924608_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ341459_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ341461_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX507213_HBe_P-B      LPSDFFPSIRDLLDTASALXREALESPEHCSPHHTAHRQAIVCWGELMNL
JQ341487_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ341460_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNL
JQ341475_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESQEHCSPHHTALRQAIVCWGELMNL
KY689557_HBe_P-B      LPSDFFPSIRDLLDTASALXREALESPEHCSPHHTALRQAXXCWGELMNL
JQ341468_HBe_P-B      LPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNL
JQ341473_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNL
JQ341494_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNL
JQ341467_HBe_P-B      LPSDFFPSIRDLLDTASALXREALESPEHCSPHHTALRQAIXCWGEXMNL
MG571374_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNL
GQ924606_HBe_P-B      LPSDFFPSIRDLLDTASXLYREALESPEHCSPHHTALRQAIXCWGELMNL
KY689413_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNL
JQ341497_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ341496_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ341491_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ341490_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNL
JQ341489_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ341485_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ341482_HBe_P-B      LPSDFFPSIRDLLDTASALYREALXSPEHCSPHHTALRQAILCWGELMNL
JQ341481_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ341479_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNL
JQ341477_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ341470_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELMNL
JQ341463_HBe_P-B      LPSDFFPSXXDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNL
JQ341462_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ341465_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ341483_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ341464_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ341484_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ341486_HBe_P-B      LPSDFFPSIRDLLDSASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ341502_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNL
EF473974_HBe_P-B      LPSDFFPSIRDLLHTASALNREALESPEHCSPHHTALRQAILGWGELMNL
KU668003_HBe_P-B      LPSDFFPSIRNLLDTANALYREALESPEHCSPHHTTIRQAILCWGELMNL
AY269128_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG826152_HBe_P-B      LPSDFFPSIRDLLDTTAALYREALESPEHCSAHHTALRQAILCWGELMNL
KU667659_HBe_P-B      LSSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMNL
KU576069_HBe_P-B      LPSDFFPNIRDLLDTASALYREALEAPEHCSPHHTAIRQAILCWGELMNL
KU576070_HBe_P-B      LPSDFFPNIRDLLDTASALYREALEAPEHCSPHHTAIRQAILCWGELMNL
GQ924638_HBe_P-B      LPSDFFPSIRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMNL
GQ358137_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306699_HBe_P-B      LPSDFFPSIRDFLDTASALYREALESPEHCSPHHTALRQAILCWGVLMNL
AY596111_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSSHHTALRQAIVCWGELMNL
DQ995805_HBe_P-B      LPSDFFPSIRDPLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB713532_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB493827_HBe_P-B      LPSDFFPSVRXLLNPVLVLYRGALESPEHCSPHHTALRQAILCWGELMNL
AF480353_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQNILCWGELMNL
AF480364_HBe_P-B      LPSDFFPSIRDLLDTASALYREALQSPEHCSPHHTALRQDILCWGELMNL
AF480360_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNL
AF480358_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNL
AF480354_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNL
AF480352_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNL
AF480340_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNL
AF480347_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNL
AF480350_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNL
AF480359_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNL
AF480361_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWCELMNL
AF480346_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNL
KX276774_HBe_P-B      LPXDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNL
KU576692_HBe_P-B      LPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
JQ027316_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JF436921_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSHHHTAIRQAILCWGELMNL
HM011504_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHVSPHHTALRQAILCWGELMNL
GQ358145_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF282917_HBe_P-B      LPTDFFPSIRDLLDTASALYREALESPEHSSPHHTALRQAILCWGELMNL
AB713530_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALKQAILCWGELMNL
AB212625_HBe_P-B      LPSDFFPTIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNL
AB100695_HBe_P-B      LPSDFFPSVRELLDTASALYREALESPEHCSPHHTALRQAILCWVELMNL
KU667640_HBe_P-B      LSSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU668173_HBe_P-B      LSPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU939633_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU939634_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ755833_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576641_HBe_P-B      LPTDFFPSIRDLLDTASALYRGALESPEHCSPHHTALRQAVLCWGELMNL
KU576015_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPQHCSPHHTALRQAILCWGELMNL
KU576018_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPQHCSPHHTALRQAILCWGELMNL
GQ358147_HBe_P-B      LPSDSFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KJ173373_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX661477_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX661479_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ562311_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNL
EF494381_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNL
AY269120_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY269105_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
FJ751769_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF480343_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNL
AF480337_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQASLCWGELMNL
AF480342_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF480344_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF480351_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF480355_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF480356_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF480357_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF480362_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY220703_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY220704_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU939639_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU827630_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF480338_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815572_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ032358_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
FJ032353_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU487256_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAMLCWGELMNL
AB073831_HBe_P-B      LPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB355453_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB713531_HBe_P-B      LPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY596110_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815748_HBe_P-B      LPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815747_HBe_P-B      LPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ377519_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ386675_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ032357_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
EU439021_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ032349_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB908299_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB908303_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESLEHCSPHHTALRQAILCWGELMNL
FJ023628_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
AB212626_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU882004_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB073833_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY167098_HBe_P-B      LPSDFFPSIRELLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306677_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ562257_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ562296_HBe_P-B      LPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815574_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815577_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ023633_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881848_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAIGCWGELMNL
KU667980_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU668300_HBe_P-B      LPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667858_HBe_P-B      LPSDFSPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576845_HBe_P-B      LPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
KU576843_HBe_P-B      LPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELINL
KU576754_HBe_P-B      LPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMSL
KU576624_HBe_P-B      LPSDFFPSIRELLDTASALYRDALESPEHCSPHHTALRQAILCWVELMSL
KC774362_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC774374_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC774380_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC774386_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC774392_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ027311_HBe_P-B      LPADFFPSVHDLLDTATALYREALESPEHCSPHHTAXRQAILCWGELMNL
GQ377625_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ358148_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ358144_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRKAILCWGELMNL
FJ023610_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
EU881998_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU660224_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU570069_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU439023_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU330997_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU330996_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306712_HBe_P-B      LPSDFFPSIRDLLDTTSALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306709_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306707_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ023627_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
EU306703_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EF473976_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EF473973_HBe_P-B      LPSDSFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILGWGELMNL
DQ993707_HBe_P-B      LPSDFFPSIRDLLDTASALYREALEAPEHCSPHHTALRQALLCWGELMNL
DQ993696_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ993697_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ993687_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ904357_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
DQ144560_HBe_P-B      LPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ144597_HBe_P-B      LPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY269109_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
AY269102_HBe_P-B      LPSDFFPSARDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNL
AY269091_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY269100_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY269108_HBe_P-B      LPADFFPSIRELLDTASAQYREALESPEHCSPHHTALRQAILCWVELMNL
AY217360_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF480363_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF480341_HBe_P-B      LPSDFFPSIRDFIDTASALYREALESSEHCSPHHTALRQAILCWGELMNL
AF335746_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF121247_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF100308_HBe_P-B      LPSDFFPSIRDLLDTASALYRGALESPEHCSPHHTALRQAILCWGELMNL
AB493835_HBe_P-B      LPSDFFPSIRDLLDAASALYREALESPEHCSPHHTALRQAILCWGELRNL
AB493833_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
AB355455_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB241116_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB219426_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB219429_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB241117_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AP011086_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AP011087_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB115551_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB073840_HBe_P-B      LPSDFFPSIRDLLDTASALDREALESPEHCSPHHTALRQAILCWGELMNL
MG571321_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNL
MF674407_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSYHHTALRQAILCWGELMNL
KU668336_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576703_HBe_P-B      LPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
KU575981_HBe_P-B      LPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX661476_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ386684_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMNL
FJ023617_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
FJ023613_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
FJ023575_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNL
EF473977_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF100309_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ448626_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB908300_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB908304_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ993711_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB246340_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ361535_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNL
EU939669_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ899779_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ377638_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GU815584_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674476_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576637_HBe_P-B      LPTDFFPSIRDLLDAASALYREALESPEHCSPHHTALRQAVLCWGELMNL
KU576300_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNL
KU576088_HBe_P-B      LPSDFFPSIRDLLDTASALYRETLESPEHCSPHHTALRQAILCWGELMNL
KP406170_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KP148453_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX026879_HBe_P-B      LPSDFFPSIRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELMNL
FJ032352_HBe_P-B      LPSDFLPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ448625_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ144561_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ144598_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ144550_HBe_P-B      LPSDFSPSIRDLLDTASALYREALESPEHCSPHHTALRRAILCWGELMNL
AY269095_HBe_P-B      LPSDFSPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY269093_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF157020_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB033555_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB073826_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB073827_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB073828_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB073829_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB073834_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB195933_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB195934_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB195935_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB205119_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB219428_HBe_C-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB219430_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB246339_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB287328_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB287329_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB300364_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB334299_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
AB334300_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
AB334301_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
AB334302_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
AB334303_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
AB355454_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
AB471854_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB471855_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB675676_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB713527_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF121243_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF121244_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF121245_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF121246_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF121249_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF233235_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF233237_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF282918_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF335741_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF335754_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNL
AF480339_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AF480345_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AM888201_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AP011084_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AP011085_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AP011088_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AP011089_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AP011090_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AP011091_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AP011092_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AP011095_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AP011096_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY033072_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY033073_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY167089_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY217359_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY220698_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY269097_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY269115_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY269131_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY269135_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY293309_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY518556_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY596102_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AY766463_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
D00330_HBe_P-B        LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
D00331_HBe_C-B        LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ144599_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ448619_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ448620_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ448621_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ448622_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ448623_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ448627_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ448628_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ975271_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ993694_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ993700_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ993701_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ993703_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ993706_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ993709_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
DQ995801_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EF134945_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EF134946_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EF473972_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EF473975_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EF494380_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSL
EU139543_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU305547_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU305548_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306695_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306696_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306697_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306698_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306700_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306701_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306702_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306704_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306705_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306706_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306708_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU306710_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU330989_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU330990_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU330992_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU330994_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU330998_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU330999_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU331000_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU331001_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU350409_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU439018_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU439020_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU439022_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU570070_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU570071_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU796067_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU796068_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
EU796071_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ023569_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ023605_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
FJ023606_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
FJ023607_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
FJ023608_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
FJ023609_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
FJ023611_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
FJ023612_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
FJ023614_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
FJ023618_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
FJ023620_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
FJ023629_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
FJ023630_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
FJ023634_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ023635_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ023636_HBe_P-B      LPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ023638_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ032354_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ349236_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ386582_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ386583_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ386584_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ386610_HBe_P-B      LPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ386642_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ386654_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ386655_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ386660_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ386666_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ386668_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ386676_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNL
FJ386688_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ518812_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ562224_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ562253_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ562322_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ667207_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
FJ787444_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ358136_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ358138_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ358141_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ358142_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ358143_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ358149_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ358150_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ358151_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ358152_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ377537_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ377542_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ377558_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ377561_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ377566_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ377568_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ377569_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ377587_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ377588_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ377612_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ377629_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ377639_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ377641_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ377643_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ855522_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ855526_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWVELMNL
GQ855532_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
GQ924603_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571360_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571351_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNL
KY689444_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNL
KY689419_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KX276806_HBe_P-B      LPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAVLCWGELMNL
KX276777_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576630_HBe_P-B      LPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
KU576629_HBe_P-B      LPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
KU576623_HBe_P-B      LPTDFFPSIRDLLDTASALYGEALESPEHCSPHHTALRQAVLCWGELMNL
KU576620_HBe_P-B      LPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
KU576619_HBe_P-B      LPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
KU576307_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576304_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576299_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNL
KU576288_HBe_P-B      LPSDFFPPIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576240_HBe_P-B      LPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
KU575976_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHRSPHHTALRQAILCWGELMNL
KU575921_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KJ843165_HBe_P-B      LPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KJ803783_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNL
FJ562289_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
FJ023573_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTL
DQ448624_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB713528_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB073821_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY689414_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KX276821_HBe_P-B      LPSDFXPSIRDLLDTASALXREALESPEHCSPHHTALRQAXLCWGELMXL
MF674385_HBe_P-B      LPSDFFPSIRDLLDTASALYQEALESPEHCSAHHTALRQAILCWGELMNL
KY689534_HBe_P-B      LPSDFFPSIRDLLDTATAMYREALESPEHCSPHHTALRQAILCWGELMNL
KY689477_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY689426_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KX276817_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSHHHTAIRQAILCWGELMNL
KX276824_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSXHHTALRQAILCWGELMNL
MG571349_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674487_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674443_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
M54923_HBe_P-B        LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY689564_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY689563_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY689520_HBe_P-B      LPSDFFPSIRDLLDTAXALYREALESPEHCSPHHTALRQAILCWGELMNL
KY470841_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY470837_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY470834_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964165_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963824_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU668116_HBe_P-B      LPSDFFPSIRDLLDTASALYREALVSPEHCSPHHTALRQAILCWGELMNL
KU668108_HBe_P-B      LPSDFFPSIRDLLDTASALYREALVSPEHCSPHRTALRQAILCWGELMNL
KU667647_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667484_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667457_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU577081_HBe_P-B      LPSGFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576940_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576848_HBe_P-B      LPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
KU576806_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576794_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576777_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576600_HBe_P-B      LPSDFFPSIRELLDTASALYRDALESPEHCSPHHTALRQAILCWVELMSL
KU576331_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHISPHHTALRQAILCWGELMNL
KU576324_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELVNL
KU576309_HBe_P-B      LPSDFFPSIRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576052_HBe_P-B      LPSGFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576043_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSLHHTALRQAILCWGELMNL
KU575982_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KP148414_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNL
KP148411_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNL
KP148394_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KP148391_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KP148371_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KP148366_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPYHTALRQAILCWGELMNL
KP148345_HBe_P-B      LPSDIFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KM392083_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KM392072_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KJ803795_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KJ803784_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KJ803764_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KJ173379_HBe_P-B      LPSDFFPSVRELLDTASALYREALESPEHCSPHHTALRQAILCWVELMNL
KJ173348_HBe_P-B      LPSDFFPSIRDLLDTASALYREALKSPEHCSPHHTALRQAILCWGELMNL
KC774406_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC774401_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC774396_HBe_P-B      LPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC774390_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC774384_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC774378_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC774372_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC774366_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510646_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX661484_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX661483_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX661482_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX661481_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX661480_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX661478_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX661475_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX661474_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX661473_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX661472_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX661471_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX661470_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX507210_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ707744_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNL
JQ429081_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571366_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674493_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674437_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY689448_HBe_P-B      LPSDFFPSIRDLLDTATAMYREALESPEHCSPHHTALRQAILCWGELMNL
KU964154_HBe_P-B      LPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU668369_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTAIRQAILCWGELMNL
KU668332_HBe_P-B      LPSDFFPSIRDLLDTANALYREALESPEHCSPHHTAIRQAILCWGELMNL
KU668309_HBe_P-B      LPSDFFPSIRNLLDTANALYREALESPEHCSPHHTAIRQAILCWGELMNL
KU668093_HBe_P-B      LPSDFFPSFRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU668061_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU667997_HBe_P-B      LPSDFFPSIRDLLDTANALYREALESPEHCSPHHTAIRQAILCWGELMNL
KU667987_HBe_P-B      LPSDFFPSIRDLLDTANALYREALESPEHCSPHHTAIRQAILCWGELMNL
KU577107_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
KU576968_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576804_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576718_HBe_P-B      LPSDFFPSIRDLLDTANALYREALESPEHCSPHHTAIRQAILCWGELMNL
KU576713_HBe_P-B      LPSDFFPSIRDLLDTANALYREALESPEHCSPHHTAIRQAILCWGELMNL
KU576707_HBe_P-B      LPSDFFPSIRDLLDTANALYREALESPEHCSPHHTAIRQAILCWGELMNL
KU576702_HBe_P-B      LPSDFFPSIRDLLDTANALYREALESPEHCSPHHTAIRQAILCWGELMNL
KU576297_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576022_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU575959_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU575927_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KP148420_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNL
KP148335_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KP148334_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KP148323_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KM213034_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KF165906_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510642_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
JX429899_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
AB048705_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571334_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881861_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KX276830_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNL
KU668149_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576778_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576746_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576308_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNL
KU576306_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576303_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCTPHHAALRQAILCWGELMNL
KU576302_HBe_P-B      LPSDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU576295_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU575984_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU575983_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU575980_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU575979_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU575978_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU575974_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU575973_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU575945_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU575928_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KP148440_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNL
KP148438_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNL
KP148433_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCPPHHTALRQAILCWDELMNL
KP148429_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNL
KP148424_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNL
KP148418_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNL
KP148410_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNL
KP148407_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCPPHHTALRQAILCWDELMNL
KP148341_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510660_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510659_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510658_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510657_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510656_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510655_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510654_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510653_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510652_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510651_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510650_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510649_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510648_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510647_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510643_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KC510641_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
X97851_HBe_P-B        LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MK075117_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MK052965_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MK052962_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MH663473_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MH061283_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG826153_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571371_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571369_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571365_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571364_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571361_HBe_P-B      LPSDFFPSIRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELMNL
MG571356_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571355_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571348_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571347_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571346_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571344_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571342_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571341_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571340_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571328_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571327_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNL
MG571322_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674515_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674513_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674512_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674510_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674509_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674507_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674506_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674500_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674497_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674495_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674490_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674488_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674485_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674483_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674482_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674479_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674477_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674469_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674462_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674460_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674456_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674455_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674453_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674452_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674451_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674449_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674438_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674432_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674431_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674427_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674426_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674424_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674423_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674419_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674416_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674414_HBe_P-B      XPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674413_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674410_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674409_HBe_P-B      LPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNL
MF674405_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674404_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674401_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674397_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674395_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674394_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674393_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674392_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674389_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674387_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674384_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674383_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF674382_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
MF621878_HBe_P-B      LPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNL
LC349878_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
LC349877_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
LC349873_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
LC349872_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881786_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881779_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881778_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881761_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881760_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881759_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881757_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881756_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881753_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881752_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881747_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881746_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881745_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881741_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881740_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881735_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881734_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881733_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881732_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881731_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881730_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881729_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881728_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881727_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881726_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881725_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881724_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881723_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881722_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY881721_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY689546_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY689538_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY689517_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY689507_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
KY689506_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
KY689505_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
KY689480_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY689472_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY689443_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY689433_HBe_P-B      LPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNL
KY689410_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNL
KY689408_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY629636_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY470962_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY470956_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY470954_HBe_P-B      LPSDFFPSIRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY470953_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY470840_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY470838_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY470835_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY470833_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY470832_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KY470830_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KX765856_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964168_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964167_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964166_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964164_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964163_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964162_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964161_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964160_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964159_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964158_HBe_P-B      LPTDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964157_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964156_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964153_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964107_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964105_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964104_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964102_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964100_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964098_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU964096_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963989_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963988_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963987_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963986_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963985_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963984_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963983_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963982_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963981_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963980_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963979_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963978_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963977_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963976_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963975_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963974_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963973_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963972_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963971_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963970_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963969_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963968_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963967_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963966_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963965_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963964_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963963_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963962_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963961_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963960_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963959_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963958_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963957_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963956_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963955_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963954_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963953_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963952_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963950_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963949_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963948_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963947_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963946_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963945_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963855_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963854_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963853_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963852_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963851_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963850_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963849_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963848_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963847_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963846_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963845_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963844_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963843_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963842_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963841_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963840_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963839_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963838_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963837_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963836_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963835_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963834_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963833_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963832_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963831_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963830_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963829_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963828_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963827_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963826_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963825_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963823_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963822_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963821_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963820_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963819_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963818_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNL
KU963817_HBe_P-B      LPSDFFPSIRDLLDTASALYREALESPEHCSPHHT