HBVdb

Dataset for protein LHBs of genotype B

[Download (right click)] [Edit] [Sequences] [Repertoires]

2581 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


JQ429081_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KX276774_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSD-PDWDLNPHKD
JQ801507_LHBs_P-B      -----IKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793079_LHBs_P-B      -----IKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792688_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNTHKD
EF494382_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPRKD
KC792693_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU882003_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB302095_LHBs_P-B      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ717831_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKD
KJ803817_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKD
EU939633_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939634_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073844_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB900107_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB900112_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU487256_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB014366_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073838_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSEYPDWDLNPHKD
AB073856_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB246343_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFQANSENPDWDLNPHKD
AB106884_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB010290_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073854_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU439023_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLEFFPDHQLDPAFKANSENPDWDLNPHKD
DQ993702_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AF121250_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSNNPDWDFNPHKD
AB073858_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ899787_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDPNPHKD
EU522072_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQVDPAFKANSENPDWDLNPHKD
AY206375_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY596104_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNTHKD
AY206390_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
FJ032349_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY220697_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
AB073828_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
DQ993697_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
GU451682_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
D50521_LHBs_P-B        MGGPSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
D50522_LHBs_P-B        MGGPSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815642_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU434372_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSESPDWDLNPHKD
AB900098_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939672_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ899785_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ899786_LHBs_P-B      MGGRSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ899784_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815620_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815621_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815617_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815622_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ562322_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939637_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ993687_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
DQ904357_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLRFFPDHQLDPAFKANSENPDWDLNPHKD
AY596106_LHBs_P-B      MGGWSSKPRKGMVTNLSVRNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU919173_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ518812_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY220698_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU158262_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU919172_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ032352_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ032353_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ032354_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY800389_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY220703_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY220704_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815710_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815625_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377561_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ562259_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU439022_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU439020_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EF473973_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ993700_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB246340_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815627_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815628_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815629_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815630_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815631_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815635_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
GU815636_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815637_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815638_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815641_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815643_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815644_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815645_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ993701_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN827419_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386675_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU332695_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU439018_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939636_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386658_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377566_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377568_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377582_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377610_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU434373_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939666_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939665_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU919175_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU919176_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY163869_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY163870_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939559_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ562240_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY217357_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY217358_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU796066_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939673_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ562296_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815707_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPRKD
GU815706_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377567_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ475340_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ562219_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ562236_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815701_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815702_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY800391_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AY800392_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
HM011487_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSNNPDWDLNPHKD
KJ717840_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPEHQLDPAFKANSDNPDWDLNPHKD
KJ803824_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPEHQLDPAFKANSDNPDWDLNPHKD
GQ924617_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPTFKANSDNPDWDLNPHKD
AB713528_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JN604141_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
HM011496_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
HM011492_LHBs_P-B      MGGXSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KX276962_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
EF473972_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KX276970_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KX276830_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148420_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148391_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
LC349875_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPEHQLDPAFKANSDNPDWNLNPHKD
KX276825_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPEHQLDPAFKANSDNPDWDLNPHKD
JQ341607_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KX765854_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148439_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148432_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148424_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148418_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148398_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148387_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148373_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
HQ700548_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148367_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JQ341590_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
HQ700549_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KJ803787_LHBs_P-B      ----TSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
LC349873_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANTDNPDWDLNPHKD
LC349872_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148403_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148401_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148399_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNSHKD
KP148394_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148386_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148385_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148382_LHBs_P-B      MGGWSSKPRKGMGTNLPVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148378_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148377_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148374_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148368_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KC774418_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148451_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148369_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JQ429082_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148380_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148376_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
M54923_LHBs_P-B        MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148397_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPNWDLNPHKD
KP148396_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148395_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148392_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148390_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148389_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148388_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148384_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148383_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148379_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148375_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148372_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148371_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148370_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JQ027311_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KX276815_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
HM011469_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KX276822_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JN792901_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JN792902_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KJ717843_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KJ803825_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
GQ358144_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148458_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPHKD
KP148455_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPHKD
KP148456_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPHKD
KP148459_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPHKD
KP148461_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPHKD
KP148452_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPHKD
AB493833_LHBs_P-B      MGGWSSKPRHGMGTNLSVPNPLGFFPEHQLDPAFKANSDNPDWDLNPHKD
AB287325_LHBs_P-B      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB287320_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB287316_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSNNPDWDLNPHKD
GQ924638_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ924639_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KF053191_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFKANSDNPDWDLNPHKD
KJ803786_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFKANSDNPDWDLNPHKD
GQ924621_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFKANSDNPDWDLNPHKD
EF473976_LHBs_P-B      MGGWSSKPRPGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
DQ463801_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JN792893_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
DQ463793_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JN792894_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
EU330994_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKD
AP011095_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB241117_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB219426_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB287314_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSNNPDWDLNPHKD
AB287315_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSNNPDWDLNPHKD
GQ924637_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
DQ463789_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB287319_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
DQ463797_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JN792895_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
DQ463791_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
DQ463798_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHND
JN792899_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHND
JN792896_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
DQ463802_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
DQ463796_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB287317_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB287322_LHBs_P-B      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
DQ463788_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JN792900_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JN792898_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JN792897_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
DQ463800_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
DQ463799_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
DQ463790_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
DQ463792_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AP011096_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ358148_LHBs_P-B      MGGWSSKPRKGMGINLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPYKD
GQ358149_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ358152_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ358150_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ358151_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ358147_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB713529_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB493827_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB033554_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
D00331_LHBs_C-B        MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
EU330989_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKD
EU330990_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKD
FJ023637_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPHKD
EU330998_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKD
EU330999_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKD
FJ023638_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPHKD
EU331000_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKD
EU331001_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKD
EU330995_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKD
EU330996_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKD
EU330997_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPYKD
GQ924624_LHBs_P-B      MGGPSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ358146_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
EF473977_LHBs_P-B      MGGWTSKPRPGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB713527_LHBs_P-B      MGGWSAKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB033555_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ358143_LHBs_P-B      MGGWTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ358140_LHBs_P-B      MGGRTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ358142_LHBs_P-B      MGGWTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDHPDWDLNPHKD
AP011088_LHBs_P-B      MGGWTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNLHKD
GQ358145_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AP011086_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB219428_LHBs_C-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AP011087_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ924651_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPYKD
GQ924654_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPYKD
AB976562_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB219427_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB219429_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ924625_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AP011089_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB219430_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPEHQLDPAFKANSDNPDWDLNPHKD
GQ924628_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ358137_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB493835_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AP011085_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AP011090_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AP011091_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AP011092_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
EF473971_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ924640_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ358141_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ358136_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GQ358138_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB642101_LHBs_P-B      MGGSYSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ717806_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNTNKD
KJ803795_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNTNKD
FJ032342_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDRNPHKD
JQ707734_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707735_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707737_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707738_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707742_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707743_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707744_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707745_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707746_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707747_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707749_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707750_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707753_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707758_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707759_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707763_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707764_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707765_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707766_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707767_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
AB555499_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPASKANSENPDWDLNPHKD
DQ463787_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
DQ463795_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JN604130_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKSPDWDLNPHKD
EU939670_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ993696_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ924645_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
EU939635_LHBs_P-B      MGGRSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
DQ995804_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
AP011094_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB073851_LHBs_P-B      MGGWSSKPRKGMGTNLSVLNPLGFFPDHQLDPAFKANSENPDWNLNLHKD
JF436921_LHBs_P-B      MGGWSSKPRKGIGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ995802_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNTHKD
AY206373_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB300371_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939674_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ899790_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ899791_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN604123_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
DQ993684_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY206383_LHBs_P-B      MGGWTSQPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
AB073823_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792671_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFRANSENPDWDLNQHKD
GQ924656_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDFNPHKD
GQ924641_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDSPDWDLNPHKD
GQ377644_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377622_LHBs_P-B      MEGWSSEPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386600_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU570075_LHBs_P-B      MGGWSSKPREGMGTNLSVPNPLGFFPYHQLDPAFKANSENPDWDLNPHKD
EF494381_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPRKD
AB900096_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB287318_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB073847_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
HM011476_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSEXPDWDLNPHKD
GQ377606_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
FJ787477_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY167100_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNTHKD
AB287323_LHBs_P-B      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB073853_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB117759_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ993686_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
AY217355_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY217356_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU579441_LHBs_P-B      MGGWSSKPREGMGTNLSVPNPLGFFPYHQLDPAFKANSENPDWDLNPHKD
EU589335_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPYHQLDPAFKANSENPDWDLNPHKD
FJ386656_LHBs_P-B      MGGWSSKPRXGMGTNLSVPNPLGFFPYHQLDPAFKANSENPDWDLNPHKD
KP148457_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSDNPDWDLNPHKD
GU357842_LHBs_P-B      MGGWSSKPRKGMRTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386608_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ032344_LHBs_P-B      MGGWSSKPREGMGTNLSVPNPLGFFPYHQLDPAFKANSENPDWDLNPHKD
AP011093_LHBs_P-B      MGGWSSKTRKGMGKNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB900106_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB713531_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB287327_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX026886_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JQ341587_LHBs_P-B      MGGVSSKPRKGMGTNLXVPNPLGFFPDHQLDPLFKANSENPDWDLNPHKD
HM011470_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815779_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386683_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ023631_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU796067_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306704_LHBs_P-B      MGGWSSKPRKGMGTSLSVPNPLGFFPDHQLDPAFEANSENPDWDLNPHKD
DQ993682_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB900105_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB555498_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB362933_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFQANSENPDWDLNPHKD
AB205122_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073839_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNTHKD
AB073835_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
DQ993680_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
DQ993683_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
DQ993685_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
DQ993681_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
JX026879_LHBs_P-B      MGGWSSKPRKGMGTNLPVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ027316_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDFNPHKD
GU815770_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939677_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939671_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306711_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDPNPHKD
EF473974_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AF121251_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB828708_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB471854_LHBs_P-B      MGGWSSKPRKDMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073849_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ993698_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ993699_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB931168_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB931169_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ717841_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPEHQLDPAFKANSDNPDWDLNPHKD
KC792998_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX504532_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ801524_LHBs_P-B      MGGWYSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNPNKD
JN604219_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ924630_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
GQ358139_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
FJ562253_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939638_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU882004_LHBs_P-B      MGGRSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU487257_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306707_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY766463_LHBs_P-B      MGGWSSKPQKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY206391_LHBs_P-B      MGGWPSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY167102_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKX
AB287321_LHBs_P-B      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB073855_LHBs_P-B      MVGWSYKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073841_LHBs_P-B      MGGVSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFKANSENPDWDLNPHKD
AB073843_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB900108_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148419_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148427_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
MG571321_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276996_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KJ717801_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN604244_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
JN604138_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
GU815651_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ562303_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
FJ562224_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386669_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939676_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU881998_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ463794_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AF121248_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GU815747_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815748_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815777_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
LC349868_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881944_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP659238_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP659219_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP406190_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406212_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793145_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ801474_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
HM011504_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815774_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815752_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815743_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815735_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ924646_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKD
GQ924606_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPFFKANSENPDWDLNPHKD
FJ562316_LHBs_P-B      MGGWSSKPRTGMGTNLSVPNPLGFFPDHHLDPAFKANSENPDWDLNPHKD
FJ562260_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ562231_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386688_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
FJ386666_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386615_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386610_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ032358_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ023636_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939639_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU564822_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306699_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU305547_LHBs_P-B      MGGWSSKPREGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKD
D23679_LHBs_P-B        MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
D23678_LHBs_P-B        MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
D00329_LHBs_P-B        MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY596112_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY596103_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY217360_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKD
AY217359_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKD
AY167093_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AF282918_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AF282917_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AF121247_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB900111_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB205121_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073852_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073848_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
AB073845_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073836_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073831_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB195934_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB195935_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306678_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306681_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY167101_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ993710_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY033072_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
FJ023634_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY033073_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
AB031267_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939678_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ562289_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815653_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
LC349870_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881955_LHBs_P-B      MRGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881952_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881849_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276828_LHBs_P-B      MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP659249_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148416_LHBs_P-B      MGGWSSKPRKGMGTDLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148414_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KJ803797_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHHLDPALKANSENPDWDLNPHKD
KJ717808_LHBs_P-B      RGGWSSKPRKGMGTNLSVPNPLGFFPDHHLDPALKANSENPDWDLNPHKD
KC792825_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDFKPHKD
KC792722_LHBs_P-B      MGGVSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFKANSENPDWDLNPXKD
JX429901_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKD
JQ707739_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
HM011490_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
HM011477_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPXKD
GU815778_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815739_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
GU815709_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815639_LHBs_P-B      MGGWSSRPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377525_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKD
FJ787475_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ562237_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNSHKD
FJ562234_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
FJ386681_LHBs_P-B      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386648_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386642_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939675_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSENPDWDLNPHKD
EU939661_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU595031_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU564826_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU522067_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306710_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306705_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306703_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU139543_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AP011084_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB900102_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB900095_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB368295_LHBs_P-B      TGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB287326_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB231909_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
AB100695_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073842_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073830_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815574_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815577_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815561_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815569_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306700_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306701_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306702_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306706_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306708_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306709_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306712_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ448624_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ993704_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ993705_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ993706_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ993707_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571331_LHBs_P-B      MGGVSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KX276827_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP659223_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSGNPDWDLNPHKD
KP148438_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148426_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148406_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KC793150_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
KC793098_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKADSENPDWDLNPHKD
KC793000_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFRANSDNPDWDLNPHKD
KC792794_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792712_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510650_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLHPAFKANSENPDWDLNPHKD
KC510646_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLHPAFKANSENPDWDLNPHKD
JX661480_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX504531_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNSHKD
JX026883_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX026881_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ707762_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ707755_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ341585_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ027334_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JN604213_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JN604212_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JN604149_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWNLNPHKD
JN604146_LHBs_P-B      MGGWSSKPRKGMGINLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
HM011499_LHBs_P-B      MGGXSSKPRHGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNSHKD
HM011474_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815734_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815722_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815640_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815578_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377638_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ562312_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386654_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386634_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ032357_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU881997_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ993709_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY167098_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY167094_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNTHKD
AB900110_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB900104_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB642094_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
AB246342_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFQANSENPDWDLNPHKD
AB212625_LHBs_P-B      MGGWSSKPRKGMGTNLSVPHPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073833_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073829_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB300364_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AF121244_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386583_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386584_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB010292_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKG
AB010289_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB365445_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
AB073840_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377542_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY293309_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386668_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386636_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571334_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881853_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276814_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDINPHKD
KX276782_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406179_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNQHKD
KP148433_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148429_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148423_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148411_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148410_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148407_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KC774405_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774397_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341605_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN604311_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815783_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815782_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815781_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815780_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815776_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815775_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815773_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815772_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815771_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815769_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815768_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815767_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815766_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815765_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815764_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815762_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815761_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815760_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815759_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815757_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815756_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815755_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815754_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815753_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815751_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815750_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815749_LHBs_P-B      MGGWSSKPRKGMGANLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815746_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815745_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815744_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815738_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815736_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815733_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLYPAFKANSENPDWDLNPHKD
GU815728_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815726_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815723_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815718_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815715_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815699_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815657_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815626_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815610_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815607_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815602_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815572_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815554_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815549_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ924653_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ924647_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ924644_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ924626_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPNKD
GQ924611_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ924607_LHBs_P-B      MGGWSSKPRKGMGTNVSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377612_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377588_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377519_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ562257_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ023632_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939664_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU919171_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU796068_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQSDPAFKANSENPDWDLNPHKD
EU306696_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ448627_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNSHKD
DQ448622_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
D00330_LHBs_P-B        MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPNKD
AY596110_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY596109_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY217362_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY167097_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AF100309_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AF100308_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSVNPDWDLNPHKD
AB900103_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB302945_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB302944_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB302943_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB302942_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB246341_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB205120_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB205119_LHBs_P-B      MGGWSSKSRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB195933_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073857_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073850_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073846_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073837_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB010291_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792992_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG826153_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSNNPDWDLNPHKD
MG826152_LHBs_P-B      MGGPSSKPRQGMGTNLSVPNPLGFFPRHQLDPAFKANSNNPDWDLNPHKD
MG571353_LHBs_P-B      MGGVSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSQNPDWDLNPHKD
MG571327_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881954_LHBs_P-B      MGGWSSQPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881869_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276801_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KX276785_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964252_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU964250_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU964246_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KP659246_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP659240_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP659239_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP659235_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP659224_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP406182_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNQHKD
KJ803784_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KJ803783_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KF053190_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KF053189_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793174_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793043_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792943_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFKANSANPDWDLNPHKD
KC774415_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774410_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774362_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX504543_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ707740_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ040138_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
HM011484_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815713_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815680_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815581_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
GQ924648_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377569_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ562254_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ562246_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386684_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386660_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939667_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU882002_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306698_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306697_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306695_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EF494380_LHBs_P-B      MGGRSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ993703_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ448626_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ448623_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ377158_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY596105_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY596102_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AF121249_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
AB900097_LHBs_P-B      MGGPSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB675676_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ023633_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
FJ023635_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
MG571376_LHBs_P-B      MGGVSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSPNPDWDLNPHKD
MG571357_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKADSENPDWDLNPHKD
LC349874_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFKANSDNPDWDLNPHKD
KY881864_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881841_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276819_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KU964394_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964249_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP659254_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP659250_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP406303_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406290_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406288_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148425_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KJ803808_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ803781_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWTFNPHKD
KJ717820_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173383_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KF053194_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWTFNPHKD
KC793136_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFGDHQLDPFFKANSENPDWDLNPHKD
KC793054_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFQANSENPDWDFNPHKD
KC792980_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPFFKANSENPDWDLNPHKD
KC792948_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFRANSENPDWDLNPHKD
KC792916_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKD
KC792887_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792724_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKD
KC792649_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKXNSENPDWDLNPHKD
KC774417_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774404_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774398_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774391_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774368_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KC774365_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510655_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPPKD
JX429911_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENSDWDLNSHKD
JX429910_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ801479_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFKANSKNPDWDLNPHKD
JQ341608_LHBs_P-B      MGGWSSKPRKGMGTNLXVPNPLGFFPDHQLDPLFRANSENPDWDLNPHKD
JQ341600_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341588_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341580_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341576_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ040128_LHBs_P-B      MGGWSSKPRKGXGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ027325_LHBs_P-B      MGGVSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN604143_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN604134_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNSHKD
JN604132_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
HQ700546_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSESPDWDLNPYKD
GU815658_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815646_LHBs_P-B      TGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815608_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ924632_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ349236_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939669_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU939663_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU350409_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDCDLNPHKD
DQ993708_LHBs_P-B      MKGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLSPHKD
AB115551_LHBs_P-B      MGGWSSKPRTGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792742_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
HM011475_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFXANSENPDWNLNPHKD
JX661478_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571339_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674440_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674436_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674415_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKD
LC349871_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881799_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KY881787_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KX276823_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KX276817_LHBs_P-B      MGGWTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KU964256_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964255_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964248_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP659252_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP659244_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP659237_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP659234_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP406297_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406286_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406176_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406180_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148440_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148437_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148435_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148430_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148415_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148413_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148409_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP148405_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KJ173375_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173297_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KC793124_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KC792783_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNSHKD
KC792715_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFGDHQLDPLFKANSENPDWDLNPHKD
KC792667_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774395_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510656_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510649_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510642_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX504538_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ801516_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ801506_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341603_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFXANSENPDWDLNPHKD
JQ341597_LHBs_P-B      XXGWSSKPRKGMGTNLXVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JQ341599_LHBs_P-B      XXGWSSKPRKGMGTNLXVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
JQ341572_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKPNSENPDWDLNPHKD
JQ027330_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ027331_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ027315_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
HM011494_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
HM011483_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
HM011482_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
HM011480_LHBs_P-B      MGGWSSKPXKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815742_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815740_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815737_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815732_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815731_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWGLNPHKD
GU815730_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815729_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815727_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815725_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815724_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815721_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815720_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815719_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815717_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815716_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815712_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815711_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815708_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815705_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815704_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815703_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815700_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815698_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815697_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815696_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815695_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815694_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815693_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815692_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815691_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815689_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815688_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815687_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815686_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815685_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815684_LHBs_P-B      MGGWSSKLRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815683_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815681_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815679_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815678_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815677_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815676_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815675_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815674_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815673_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815672_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815670_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815669_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815668_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815667_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815666_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815665_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815664_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815663_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815662_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815661_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815660_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815659_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815656_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815654_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815652_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815650_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815649_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815648_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815647_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815633_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815632_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815623_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815619_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815618_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815614_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815613_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815612_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815609_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815606_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815605_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815604_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815603_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815601_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815600_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815599_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815598_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815597_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815596_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815595_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815594_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815593_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815591_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815590_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815589_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815588_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815587_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815586_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815585_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815584_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815583_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815579_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815576_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815575_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815571_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815570_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815568_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815567_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815566_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815565_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815564_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815563_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815562_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815560_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815559_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815558_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815557_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815556_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815555_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815553_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815552_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815551_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815550_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GU815548_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ924634_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ924631_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ924627_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ924610_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ924608_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ924605_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ924603_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377643_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377641_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377639_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377625_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377587_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSEYPDWDLNPHKD
GQ377558_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377547_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377537_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ899779_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ787444_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANPENPDWDLNPHKD
FJ562321_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ562222_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386682_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386680_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386676_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386655_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ386582_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU570071_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU570070_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU564824_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU564823_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU522074_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQVDPAFKANSENPDWDLNPHKD
EU306680_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU306679_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU305548_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EU158263_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EF473975_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EF134946_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
EF134945_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ448628_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ448625_LHBs_P-B      MGVWPSQPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ448621_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ448620_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
DQ448619_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY518556_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AY167089_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AJ627225_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWNLNPHKD
AF479684_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AF279464_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSETPDWDLNPHKD
AF121246_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AF121245_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AF121243_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB471855_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB287329_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB287328_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB246339_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073834_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073827_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073826_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073825_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073824_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073822_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571336_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG372436_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674491_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674478_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANLESRDWDLNPHKD
MF674441_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674434_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674419_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881958_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881957_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881956_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881953_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881951_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881950_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881949_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881948_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPPGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881947_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881946_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881945_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881913_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881868_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881863_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPALKANSENPDWDLNPHKD
KY881861_LHBs_P-B      MGGWSPKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLKPHKD
KY881791_LHBs_P-B      VGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KY417926_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSGNPDWNLNQHKD
KX276784_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKD
KU964253_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU964251_LHBs_P-B      MGGWSSKPRKGMGTNLSVPXPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU964244_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU963854_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ803789_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ717798_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KJ717795_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173404_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173403_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173384_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173341_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKTNSENPDWDLNPHKD
KC793078_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793073_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793070_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792878_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNTHKD
KC792847_LHBs_P-B      MGGVSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792827_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKADTKNPDWDLNPHKD
KC792785_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792770_LHBs_P-B      MGGYSSKPRKGMGTNLSVPNPLGFXPXHQLDPAFKANSKNPDWDLNPHKD
KC792697_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792678_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KC792666_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792662_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXXPDWDLNPHKD
KC792661_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792660_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792648_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KC774413_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341596_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFXPDHQLDPAFKANSENPDWDLNPHKD
JQ341568_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ040157_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN604234_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWBXNPYKD
HM011473_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
HM011471_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
HM011467_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
HM011466_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
GQ377629_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
FJ562311_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKD
EU547563_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073832_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406187_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKD
KP406199_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKD
KC792839_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKD
KC793015_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNXHKD
KX276779_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKB
KC792677_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKB
KC792945_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341582_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341594_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN604221_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341601_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
KP406186_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406188_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406189_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406191_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406192_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406193_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406195_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406196_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406197_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406198_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406200_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406201_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406202_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406203_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406204_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406205_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406206_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406207_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406208_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406209_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406210_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406211_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406213_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406214_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406215_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406217_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406218_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406219_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571367_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571355_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571352_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFGDHQLDPAFKANSENPDWDLNPHKD
MF674432_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKD
MF674409_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
LC349869_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPEHQLDPAFKANSDNPDWDLNPHKD
KY881848_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFEANSENPDWDLNQHKD
KX276818_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KX276796_LHBs_P-B      MGGWXSXPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNXHKD
KU964302_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964300_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964292_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDHAFKANSENPDWDLNPHKD
KU964291_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964283_LHBs_P-B      MGGSSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963949_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963852_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963842_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHTD
KP659255_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP659248_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP406314_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406312_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406305_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406302_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406301_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406300_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406299_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406298_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406296_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406295_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406287_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148356_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLGPVFKANSENPDWDLNPHKD
KP148328_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ803796_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDLAFKANSENPDWDLNPHKD
KJ803758_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KJ717807_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDLAFKANSENPDWDLNPHKD
KF053165_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KC793163_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793086_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793028_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793021_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPFFKANSENPDWDLNPHKD
KC792966_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFRANSENPDWDLNPHKD
KC792953_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792949_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNSQKD
KC792924_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792897_LHBs_P-B      MGGWSSKPREGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792890_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792860_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSGNPDWDLNPHKD
KC792851_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792832_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPIGFFPDHQLDPAFRANSENPDWDLNPHKD
KC792788_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792782_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKD
KC792764_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792754_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSQNPDWDLNPHKD
KC792748_LHBs_P-B      MGGWSXKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792737_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPXKD
KC792711_LHBs_P-B      MGGWSSKPRXGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792692_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792687_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKD
KC792676_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792664_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792657_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774407_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774401_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774400_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774396_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774390_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774389_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774382_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774381_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KC774380_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774377_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774373_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KC774372_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774371_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774369_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774363_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510658_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPPKD
KC510657_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510654_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510651_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510647_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPPKD
JX978431_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX870001_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX661479_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX661475_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX661473_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX661471_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX504533_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKD
JX429902_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX429897_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ801494_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ801471_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ412092_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341609_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341593_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341589_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341570_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341564_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341552_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ040147_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
JN604284_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN604253_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN604223_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JN604154_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN604125_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN604124_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN604119_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JN406371_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JF412801_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
HM153811_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
HM011503_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKD
DQ995801_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB642093_LHBs_P-B      MGXWSXKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
AB073821_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
X98077_LHBs_P-B        MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSDNPDWDLNTHKD
MG571364_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674420_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSETPDWDLNPHKD
MF674396_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674389_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPVFRANSENPDWDLNPHKD
MF621878_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
KY881912_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881910_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881909_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881908_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881906_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881867_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881858_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881808_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KX276824_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KX276821_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KX276793_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964254_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU964161_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964109_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964108_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963955_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPFFKANSENPDWDLNPHKD
KU963948_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPFFKANSENPDWDLNPHKD
KU963815_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP659253_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP659251_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP659247_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP659245_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP406304_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406294_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406284_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406194_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406216_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP036970_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KJ843165_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ803773_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ803755_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KJ410500_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSQNPDWDLNPHKD
KJ173386_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173371_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KF053180_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KF053162_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KC793171_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHRD
KC793134_LHBs_P-B      MGGWSXKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPXKD
KC793128_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793121_LHBs_P-B      MGGWSXKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKD
KC793092_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793060_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793011_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793001_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFQANSENPDWDLNPHKD
KC792931_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792930_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792892_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792884_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792850_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792844_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKADSENPDWDLNPHKD
KC792820_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPYKD
KC792804_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDXQLDPAFKANSENPDWDLNPHKD
KC774409_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774402_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774379_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774370_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX661483_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX507213_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX429899_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ801485_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341598_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341592_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHXD
JQ341583_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341567_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341555_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPNKD
JQ341551_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN604187_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774412_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341553_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPXFKANSENPDWDLNPHKD
KC774367_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
X97851_LHBs_P-B        MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571373_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571365_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNTHKD
MG571351_LHBs_P-B      MGGWTSQPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571348_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571347_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571338_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWNLNPRKD
MF674507_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
MF674459_LHBs_P-B      MGGWFSNPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674446_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
MF674439_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPXKD
LC349879_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
LC349878_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881901_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881900_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881899_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881898_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881897_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881896_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881895_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881866_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881865_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881860_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSESPDWDLNPHKD
KY881859_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881857_LHBs_P-B      MGGWSSKSRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881855_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881854_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881852_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881836_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881831_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881829_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKD
KY881828_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881827_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881823_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPALKANSENPDWDLNPHKD
KY881780_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KX765841_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276809_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276807_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWBLNXHKD
KX276800_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964397_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964395_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964393_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964391_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964388_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964385_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964384_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964383_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964382_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964381_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964270_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964268_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPPKD
KU964266_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964264_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPPKD
KU964263_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964262_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964261_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964259_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964257_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPPKD
KU964096_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU964094_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU963987_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963953_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963951_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963946_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963827_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963826_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963825_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963824_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963823_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963822_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963821_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963820_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963819_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963818_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963817_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963816_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963814_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KT749820_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKE
KP659220_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KP406317_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNXHKD
KP406291_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406280_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406274_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406268_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406263_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406262_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406257_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148363_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPVFKANSENPDWDLNPHKD
KM213034_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ803821_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ803820_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ803775_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ803752_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ790200_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFGDHQLDPLFRANSENPDWDLNPHKD
KJ717837_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ717836_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ717818_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173378_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKD
KJ173377_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKD
KJ173348_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173347_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KF053182_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793193_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793191_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793177_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFKANSENPDWDLNPHKD
KC793160_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793080_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFXPDHQLDPAFKANSENPDWDFNPHXD
KC793059_LHBs_P-B      MGGWSSKPRKGMGTNLSIHNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793045_LHBs_P-B      MGGRTSQPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793036_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKN
KC793033_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793023_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDQQLDPAFKANSENPDWDLNPHKD
KC793016_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWNLNPHKD
KC793006_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792996_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792967_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNPXKD
KC792950_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKD
KC792944_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KC792939_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KC792925_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKD
KC792910_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792843_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792815_LHBs_P-B      MGGVSSKPRKGMGTNLXVPNPLGFFXDHQLDPXFRANSXNPDWDLNPHKD
KC792813_LHBs_P-B      MGGQTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792791_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWBXNPHKD
KC792736_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KC792729_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792675_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792674_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774385_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774378_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX869998_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX661482_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341581_LHBs_P-B      MGGXSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341578_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341571_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWBLNPHKD
JQ341569_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341566_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341563_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341561_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341558_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPXFKANSENPDWDLNPHKD
JQ341550_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ040171_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKAXSENPDWDLNPHKD
JQ040125_LHBs_P-B      MGGWSSKPRKGMGTBLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN604224_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571372_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571362_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571337_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674490_LHBs_P-B      MGSWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSGNPDWDLNPYKD
MF674466_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674422_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
MF674392_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
LC349877_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KY881914_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881893_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881844_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881834_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881826_LHBs_P-B      MGGWSSKPRKGMATNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881822_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KY881820_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881800_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KY470841_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY470832_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY470830_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHRD
KX276813_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276804_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFXANSENPDWDLNPHKD
KX276772_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWBLNPHKD
KX276770_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWNLNPHKD
KU964301_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964299_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964298_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964297_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964296_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964295_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964294_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964293_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964290_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964289_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964288_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964287_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964265_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964260_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964258_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964160_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964159_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964158_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964114_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964093_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU963853_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963851_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963850_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963849_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963848_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963847_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963846_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963845_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963844_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963843_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406316_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406315_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406313_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406311_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406310_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406309_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406308_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406307_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406306_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406289_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406285_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406281_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406265_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406165_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148348_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148342_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148325_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KM392083_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ803768_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ803756_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ717842_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173385_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173357_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173356_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKD
KF053174_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KF053163_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793185_LHBs_P-B      MGGPSSKPRKGMGTNLSVPNPLGFFPXHQLDPAFKANSENPDWBLNXHKD
KC793159_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793101_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793090_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFKANSENPDWDLNPHKD
KC793084_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793072_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFRANSENPDWDLNPHKD
KC793071_LHBs_P-B      MGGWSSKPRKGMGTNLXXPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793056_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793053_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793031_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPXKD
KC793020_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793014_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793013_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDRNPHKD
KC792964_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792956_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792954_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792947_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792919_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792901_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792898_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792807_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792766_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHND
KC792750_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792741_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792735_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENSDWDLNPHKD
KC792681_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792650_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDFNXHKD
KC774419_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774416_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774411_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774408_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774406_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774403_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774399_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774394_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774393_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774392_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774388_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774387_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774386_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774384_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774383_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774376_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774375_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774374_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC774366_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510660_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510659_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510653_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510652_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510648_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510644_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510643_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC510641_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC492739_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX869999_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX661484_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX661481_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX661477_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX661476_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSETPDWDLNPHKD
JX661474_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX661472_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX661470_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX507215_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX507210_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX429908_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JX429900_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ801514_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ801512_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ688405_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ412090_LHBs_P-B      MRGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSESPDWDLNPHKD
JQ341606_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341604_LHBs_P-B      MGGWSSKPRXGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341595_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKD
JQ341591_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341584_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWNLNPHKD
JQ341579_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341575_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
JQ341574_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341573_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341562_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341560_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341556_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341549_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ040173_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ040170_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN604122_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JF899335_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406267_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341557_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341577_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MH932712_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MH061283_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPEHQLDPAFKANSENPDWDLNPHKD
MG571344_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571341_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571328_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674500_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674473_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674469_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674464_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPLKD
MF674460_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674456_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674391_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPVFKANSENPDWDLNPHKD
MF674385_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881911_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881907_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881850_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KY881837_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881825_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSQNPDWDLNPHKD
KY881801_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KY881795_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KY881794_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KY881793_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KY881790_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KY881789_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KY881788_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KY881784_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KY881783_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KY881782_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KY881781_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KY470838_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY470833_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276820_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KX276795_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964286_LHBs_P-B      MGGSSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964281_LHBs_P-B      MGGSSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KU964280_LHBs_P-B      MGGSSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964247_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964245_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964168_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964165_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964163_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964157_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964156_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964143_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964135_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964122_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964121_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964120_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964119_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964116_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964113_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964112_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964111_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964110_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964106_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU964105_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU964100_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU964099_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU964097_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU964095_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU963980_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963967_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963963_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963962_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406334_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406330_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406282_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406273_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKD
KP406272_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406185_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406184_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406183_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406181_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406178_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406177_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148582_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148357_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148326_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148317_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KM213036_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ410507_LHBs_P-B      MGGWSSKPRKGMGTNFSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173398_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173397_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173372_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173353_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173351_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173342_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173298_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793190_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDXQLDPAFKANSENPDWDLNPHKD
KC793154_LHBs_P-B      MGGWXSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793106_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793096_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFRANSENPDWDLNPHKD
KC793088_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793063_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFXPDHQLDPAFKANSEDPDWDLNPHKD
KC793058_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793049_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793038_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793025_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKD
KC793005_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKD
KC792983_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792963_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KC792928_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792894_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792837_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792810_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSEXPDWDLNPHKD
KC792797_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KC792789_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792786_LHBs_P-B      MGGWSXKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDFNPHKD
KC792765_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDXNPHKD
KC792755_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792749_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792744_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792699_LHBs_P-B      MGXWSSXPRXGMGTNLXVPNPLGFFPDHQLDPXFXANSENPDWDLNPHKD
KC792654_LHBs_P-B      MGGWSSXPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341559_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPXFXANSENPDWDLNPHKD
MG571368_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
MG571354_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDRNPHKD
MG571323_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571322_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674515_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
MF674513_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674508_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674493_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674483_LHBs_P-B      MAKWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674482_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674481_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSETPDWDLNPHKD
MF674476_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674461_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
MF674450_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674443_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674438_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674437_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674416_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
MF674414_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674407_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
MF674387_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881904_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881862_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881843_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881842_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881839_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881833_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881824_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881798_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KY881797_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNQHKD
KY881796_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNQHKD
KY881786_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KY881785_LHBs_P-B      MGGLSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY629636_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
KY629635_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY470956_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276829_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KX276803_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276802_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276792_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KX276786_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPXKX
KX276777_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964285_LHBs_P-B      MGGSSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964284_LHBs_P-B      MGGSSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964279_LHBs_P-B      MGGSSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964278_LHBs_P-B      MGGSSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964277_LHBs_P-B      MGGSSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964276_LHBs_P-B      MGGSSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964274_LHBs_P-B      MGGSSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964272_LHBs_P-B      MGGSSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964269_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964152_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964151_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964150_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964149_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964148_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964147_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964146_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964145_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964144_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964142_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964141_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPRGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964140_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964139_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964138_LHBs_P-B      MGGLSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964107_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU964104_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU964102_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU964101_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KU963989_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963988_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963986_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963985_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963984_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963983_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963982_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963981_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963979_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963978_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963977_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963976_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963959_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963958_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963957_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963956_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963954_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963952_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963950_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963947_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963945_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963835_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDSDLNPHKD
KU963833_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU234318_LHBs_P-B      MAKWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KR232337_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406332_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406329_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406328_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406327_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406326_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406325_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406324_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406323_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406322_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406321_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406320_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406319_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406318_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406293_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406292_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406278_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406277_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406276_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406275_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406270_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406255_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406253_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406252_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHRD
KP406246_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KP148365_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFSDHQLDPAFKANSENPDWDLNPHKD
KP148361_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148360_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPVFKANSENPDWDLNPHKD
KP148359_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPVFKANSENPDWDLNPHKD
KP148334_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148331_LHBs_P-B      MGGWSSKPRKGMGTNLSAPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148324_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148321_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148320_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148319_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148318_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148314_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KM392084_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSEKPDWDLNPHKD
KM359440_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KM213032_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ803816_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ717829_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ717796_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ410516_LHBs_P-B      MGGWSSKPRKGMGTNFSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173388_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173387_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173369_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173366_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173364_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173363_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173362_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173361_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173343_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793196_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSQNPDWDLNPHKD
KC793194_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKD
KC793183_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793178_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793168_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793164_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793155_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793122_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793117_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793089_LHBs_P-B      MGGWXSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWXLNPHKD
KC793083_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793081_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793069_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KC793061_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793057_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793029_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793012_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793009_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792997_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792960_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792959_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAVKANSENPDWDLNPHKD
KC792958_LHBs_P-B      MGGWSSKPRKGMGTNLXVPNPLGFFPDHQLDPAFKANSENPDWDLNXHKD
KC792938_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792937_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANTENPDWDLSPHKD
KC792936_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792935_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792934_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFTANSENPDWDLNPRKD
KC792915_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792893_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792888_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792883_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792882_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792869_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792854_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792849_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792836_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792821_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792809_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792805_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792802_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792781_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792780_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNXHKD
KC792769_LHBs_P-B      MGGWXSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792767_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792752_LHBs_P-B      MGGWSSKPRXGMGTNLXVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792733_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792703_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792668_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792665_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JN604127_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406261_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406259_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406256_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
X97850_LHBs_P-B        MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MK052965_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MK052964_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MK052962_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MH663473_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571374_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571361_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571358_LHBs_P-B      MGGPSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDRNPHKD
MG571349_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571346_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571342_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571333_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWNLNPHKD
MF674505_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674487_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
MF674479_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674465_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674404_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674394_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
MF674382_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPYKD
KY881847_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881830_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881821_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY470962_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY470961_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY470960_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY470954_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY470953_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY470840_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY470839_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY470837_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY470836_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY470835_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY470834_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276812_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276781_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964271_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964267_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964166_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964164_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964155_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964154_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964153_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964118_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964115_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964103_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KP406335_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406333_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406331_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSANPDWDLNPHKD
KP406266_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406264_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406260_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406258_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406245_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406240_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406238_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406237_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNLHKD
KP406171_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406163_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148581_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148579_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148349_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148347_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148346_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148345_LHBs_P-B      MGGWSSKPRKGMGANLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148344_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148343_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148341_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148340_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148339_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148338_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148336_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KM875421_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KM875420_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KM875418_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KM392072_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ803805_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ717817_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ410490_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KJ173417_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KJ173416_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KJ173390_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173389_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173379_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173376_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173355_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173340_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KJ173339_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KC793197_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793182_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793181_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793180_LHBs_P-B      MGGWSSKPRKGMGTNLSXPNPLGFFPDHQLDPAFKANSENPDWDFNPHKD
KC793179_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793175_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793156_LHBs_P-B      MGGVSSKPRKGMGTNLSVPNPLGFFPDHQLDPFFKANSENPDWDLNPHKD
KC793152_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793146_LHBs_P-B      MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793139_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793114_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793111_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793104_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793099_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793094_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793027_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792986_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792985_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792975_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792973_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792970_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792918_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792913_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792908_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNXHKD
KC792906_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792903_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792900_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792881_LHBs_P-B      MGGWSSKPRKGMGTNQSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792879_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNXHKD
KC792875_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792867_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKADSENPDWDLNPHKD
KC792865_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792861_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWBLNPHKD
KC792848_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KC792845_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFKANSENPDWDRNPHKD
KC792842_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792838_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792772_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENSDWDLNPHKD
KC792727_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792720_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792719_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792709_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792698_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792689_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792663_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPYKD
KC792652_LHBs_P-B      MGGVSSKPRKGMGTNLSVPNPLGFFPDHQLDPXFKANSENPDWDLNXHKD
KC792651_LHBs_P-B      MGGWXSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSENPDWDLNPHKD
JQ341586_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MK075117_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571371_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571370_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571325_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674511_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674509_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
MF674506_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674480_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674477_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674462_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674455_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674447_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674426_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674405_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674400_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANTENPDWDLNPHKD
MF674383_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
LC279273_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
LC279272_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
LC279271_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
LC279270_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
LC279269_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
LC279268_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881905_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881903_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881902_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881894_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881846_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881835_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881779_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881778_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881761_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881760_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881759_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881757_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881756_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881753_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881752_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881747_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881746_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881745_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881741_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881740_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881735_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881734_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881733_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881732_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881731_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881730_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881729_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881728_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881727_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881726_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881725_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881724_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881723_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881722_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881721_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276790_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276788_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964275_LHBs_P-B      MGGSSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964273_LHBs_P-B      MGGSSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964091_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964090_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964089_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964086_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964085_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964084_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964081_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964079_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963975_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963974_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963973_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963972_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963971_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963970_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963969_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963968_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963966_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963965_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963964_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963961_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963960_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406283_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406249_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406236_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KM213035_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ803801_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ717813_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173412_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFQANSENPDWDLNPHKD
KJ173411_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFQANSENPDWDLNPHKD
KJ173402_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173401_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173368_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793148_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793147_LHBs_P-B      MGGWSSKPRKGMGTNLSIPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793131_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793125_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793047_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSQNPDWDLNPHKD
KC793034_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793004_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792990_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792987_LHBs_P-B      MGGWSSKPRKGMGTNLAVPNPLGFFPDHQLDPLFKANSENPDWDLNPHKD
KC792981_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792969_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792933_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKX
KC792909_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792907_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792896_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792889_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792864_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDXNPHKD
KC792863_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792855_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792846_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792841_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792812_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792798_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKABSENPDWDLNPHKD
KC792787_LHBs_P-B      MGGWSSKPREGMGTNLSVPNPLGFFPDHQLDPAFKABSENPDWDLNPHKD
KC792778_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792745_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSESPDWDLNPHKD
KC792743_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792717_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792694_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ341565_LHBs_P-B      XXXXXXXXRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
JQ027312_LHBs_P-B      MGGWXSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDXNPHKD
MG571369_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571360_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571356_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571340_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSESPDWDLNPHKD
MG571329_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674512_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674503_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674499_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674498_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674497_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
MF674496_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPNKD
MF674495_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674492_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674485_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674470_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
MF674453_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
MF674452_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674451_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674449_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674445_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674433_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674431_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674427_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674424_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
MF674423_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674421_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
MF674413_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674410_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
MF674401_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674397_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
MF674395_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674393_LHBs_P-B      MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674384_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
LT992442_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KY881838_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX765856_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276808_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276799_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276791_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276778_LHBs_P-B      MGGWSXKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKD
KX276773_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964167_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964162_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964136_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964134_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964133_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964132_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964131_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964130_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964129_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964128_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964127_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964126_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964125_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964124_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964123_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964092_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964088_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964087_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964083_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964082_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU964080_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963855_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963841_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963840_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963839_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963838_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963837_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963836_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963834_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963832_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963831_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963830_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963829_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963828_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963813_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963812_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963811_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963810_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963809_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963808_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963807_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963806_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963805_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963804_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963803_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963802_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963801_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963800_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KU963799_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KR152339_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406279_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406254_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406251_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406250_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406248_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406247_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406244_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406239_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406166_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148366_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148364_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148362_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148335_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPRKD
KP148333_LHBs_P-B      MGGVSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148332_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148330_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148329_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148327_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148323_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP148322_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KM875417_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KM875416_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ803764_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ717830_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ410517_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ410502_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173425_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173423_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173422_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173421_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173420_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173415_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173414_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173413_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173410_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173409_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173408_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173407_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173406_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173405_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173400_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173399_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173382_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173381_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173374_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173367_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173365_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173360_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173359_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173354_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173352_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ173345_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KF053171_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793200_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHXLDPXFXANSXNPDWDLNPHKD
KC793199_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793198_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793192_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793186_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793176_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793172_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793167_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793165_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793151_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793144_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793135_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793126_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793115_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793109_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793105_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793102_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793091_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793085_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793082_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793077_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPRKD
KC793067_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793065_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793062_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793048_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793032_LHBs_P-B      MGGPSSKPRKGMGTNLSVPNPLGFFGDHQLDPAFKANSENPDWDLNPHKD
KC793010_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793007_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793002_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792994_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792993_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792991_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792988_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792984_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFXPDHQLDPAFKANSENPDWDLNPHKD
KC792977_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792974_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792972_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792971_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792957_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792952_LHBs_P-B      MGGWSSKPRXGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792932_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFGDHQLDPAFKANSENPDWDLNPHKD
KC792920_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKNPDWDLNPHKD
KC792899_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792895_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792874_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792872_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792856_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792828_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792824_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792823_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792814_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792796_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFKANSENPDWDLNPHKD
KC792784_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792763_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792756_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792747_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792731_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792705_LHBs_P-B      MGGXSSKPRKGMGTNLXVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792702_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792701_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792696_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792686_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792685_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792659_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNXHKD
HM011478_LHBs_P-B      XGXXXSXPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571350_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MG571326_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674406_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276811_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276810_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276806_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276787_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276771_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406271_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406269_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406243_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406242_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406241_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406235_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406234_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406233_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406232_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406231_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406230_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406229_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406228_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406227_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406226_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406225_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406224_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406223_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406222_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406221_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406220_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406173_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KP406172_LHBs_P-B      MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KJ803763_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KF053192_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793188_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSGNPDWDLNPHKD
KC793166_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793116_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793095_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793055_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793041_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPXGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793022_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793018_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793008_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792982_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792978_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792955_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792917_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792912_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792877_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792866_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792858_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792835_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHXD
KC792822_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792819_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792800_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPYKD
KC792774_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792728_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792714_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MK818223_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
MF674510_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276805_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793189_LHBs_P-B      MGGPSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793170_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793161_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793130_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793127_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDXNPHKD
KC793113_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNTHKD
KC792905_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792870_LHBs_P-B      MXGWXSKPRKGMGTNLSVPNPLGFFPDHQLDPACKXNSENPDSDLNPHKD
KC792859_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792852_LHBs_P-B      MGGWXSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKX
KC792811_LHBs_P-B      MGGWSSXPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792726_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792721_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793158_LHBs_P-B      MGGXSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793157_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793143_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793140_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793138_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793137_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793132_LHBs_P-B      MGGWSSKPRKGMGTNLXVPNPLGFFPDHQLDPXFXABSENPDWDXNPHKD
KC793075_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793052_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793017_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792942_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792904_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKD
KC792871_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFKANSENPDWDLNPHKD
KC792829_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792795_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792773_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792768_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792725_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792723_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKD
KX276794_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSEXPDWDLNPHKD
KP406167_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793087_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDXQLDPAFKANSXNPDWBLNXHKD
KC793042_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792976_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792760_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792758_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792738_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792730_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792684_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KX276797_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792885_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSXNPDWDLNPHKD
KC792840_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792808_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKAXSENPDWDLNPHKD
KC792777_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793173_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793120_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNXHKD
KC793118_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSKXPDWBLNXXKD
KC792761_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792718_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC792683_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
KC793044_LHBs_P-B      MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKD
                                 .         *  *                 :   .    

JQ429081_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KX276774_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ801507_LHBs_P-B      NWPDANKVGVGAFGSGFTPPHGGLLGWSPQAQGLFTTVPAAPPPASTNRQ
KC793079_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSSQAQGILTTVPAAPPPASTNRQ
KC792688_LHBs_P-B      NWPBANKVGVGAFGPGFIPPHGGLLGWSPQAQGIXTTVPAAPPPASTNRQ
EF494382_LHBs_P-B      NWPDANKVGAGAFGPGFVPPHGGLLGWSPQAQGILTTMPAAPPPASTNRQ
KC792693_LHBs_P-B      XWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGLLTTXPAAPPPASTNRQ
EU882003_LHBs_P-B      PWPDAWKVGRGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB302095_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGRSPQAQGILTSVPAAPPPASTNRQ
KJ717831_LHBs_P-B      QWPAAHQVGVGSFGPGFTPPHGNLVGWSPQAQGILTTVPAAPPPASTNRQ
KJ803817_LHBs_P-B      QWPAAHQVGVGSFGPGFTPPHGNLVGWSPQAQGILTTVPAAPPPASTNRQ
EU939633_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGGSPQAQGILTTVPAAPPPASTNRQ
EU939634_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGGSPQAQGILTTVPAAPPPASTNRQ
AB073844_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB900107_LHBs_P-B      NWPDAQKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB900112_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
EU487256_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB014366_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB073838_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB073856_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB246343_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB106884_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB010290_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB073854_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
EU439023_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
DQ993702_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AF121250_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB073858_LHBs_P-B      NWPDAHKVGVGAFGSGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
FJ899787_LHBs_P-B      TWPDANKVGVGAFGLGFTPSHGGLLGWSPQAQGLLTTVPAAPPPASTNQQ
EU522072_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY206375_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY596104_LHBs_P-B      NWPDANKVGAGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AY206390_LHBs_P-B      NWPDANQVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
FJ032349_LHBs_P-B      NWPDANKVGAGAFGPGFTPPHGGLLGWSPQTQGLLTTVPAAPPPASTNRQ
AY220697_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB073828_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
DQ993697_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU451682_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPASTNRQ
D50521_LHBs_P-B        NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
D50522_LHBs_P-B        NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815642_LHBs_P-B      DWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU434372_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB900098_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILAHVPAAPPPASTNRQ
EU939672_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ899785_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ899786_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ899784_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815620_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815621_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815617_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815622_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ562322_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU939637_LHBs_P-B      NWPNANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
DQ993687_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
DQ904357_LHBs_P-B      SWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY596106_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU919173_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
FJ518812_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY220698_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU158262_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU919172_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
FJ032352_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ032353_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ032354_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY800389_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY220703_LHBs_P-B      NWPEANKVGVGTFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY220704_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815710_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815625_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377561_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ562259_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU439022_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU439020_LHBs_P-B      NWPDANKVEVGAFGLGFTPPHGGLLGWSPQAQGLLTTAPAAPPPASTNRQ
EF473973_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
DQ993700_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB246340_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLMGWSPQAQGILTTVPAAPPPASTNRQ
GU815627_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815628_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815629_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815630_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815631_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815635_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815636_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815637_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815638_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815641_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815643_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815644_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815645_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
DQ993701_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JN827419_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386675_LHBs_P-B      NWPDANKVGXGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU332695_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU439018_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU939636_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386658_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377566_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377568_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377582_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377610_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU434373_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU939666_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU939665_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU919175_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU919176_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AY163869_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AY163870_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU939559_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ562240_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AY217357_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY217358_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU796066_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU939673_LHBs_P-B      NWPNANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ562296_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815707_LHBs_P-B      NWPEANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815706_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ377567_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
GQ475340_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ562219_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ562236_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815701_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815702_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AY800391_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AY800392_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
HM011487_LHBs_P-B      NWPDSNKVGVGAFGSGLTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ717840_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KJ803824_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
GQ924617_LHBs_P-B      NWPNSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
AB713528_LHBs_P-B      NWPDSNKVGAGAFGPGFTPPHGGLLGWSPQSQGILTTVPAAPPPASTNRQ
JN604141_LHBs_P-B      YWPDANKVGVGAFGPGFTPPHGGMLGWSPQAQGILTTVPAAPPPASTNRQ
HM011496_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
HM011492_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KX276962_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
EF473972_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPTAPPPASTNRQ
KX276970_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KX276830_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGMLGWSPQAQGILTTVPTTPPPASTNRQ
KP148420_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148391_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
LC349875_LHBs_P-B      NWPDSNKVGVGAFGPGLTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KX276825_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
JQ341607_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KX765854_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148439_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148432_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148424_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148418_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148398_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148387_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148373_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
HQ700548_LHBs_P-B      NWPNSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148367_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ341590_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
HQ700549_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGIITTVPAAPPPASTNRQ
KJ803787_LHBs_P-B      NWPDSNKVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
LC349873_LHBs_P-B      NWPDSNKVGVGAFGTGFTPPHGGLLGWSPQAQGILTTVPTAPPSASTNRQ
LC349872_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPATTNRQ
KP148403_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148401_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148399_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148394_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148386_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148385_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148382_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148378_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148377_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148374_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLSGWSPQAQGILTTVPAAPPPASTNRQ
KP148368_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774418_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148451_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148369_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ429082_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KP148380_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148376_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
M54923_LHBs_P-B        NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KP148397_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148396_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148395_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148392_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148390_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148389_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148388_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148384_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148383_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148379_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148375_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148372_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148371_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148370_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ027311_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KX276815_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
HM011469_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KX276822_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JN792901_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
JN792902_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
KJ717843_LHBs_P-B      NWLDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTAVPAAPPPASTNRQ
KJ803825_LHBs_P-B      NWLDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTAVPAAPPPASTNRQ
GQ358144_LHBs_P-B      NWPNSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148458_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KP148455_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KP148456_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KP148459_LHBs_P-B      NWPNANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KP148461_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KP148452_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
AB493833_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
AB287325_LHBs_P-B      NQSDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
AB287320_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
AB287316_LHBs_P-B      NWPDANKVGEGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPTSTNRQ
GQ924638_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTPVPAAPPPASTNRQ
GQ924639_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTPVPAAPPPASTNRQ
KF053191_LHBs_P-B      NWPDSDKVGVGAFGPGVTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KJ803786_LHBs_P-B      NWPDSDKVGVGAFGPGVTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
GQ924621_LHBs_P-B      NWPDSNKVGVGAFGSGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EF473976_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
DQ463801_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASANRQ
JN792893_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASANRQ
DQ463793_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASANRQ
JN792894_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASANRQ
EU330994_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTVPAVPPPASTNRQ
AP011095_LHBs_P-B      SWPDSNKVGVGAFGTGFTPPHGGLLGWSPQAQGMLTTVPTAPPPASANRQ
AB241117_LHBs_P-B      YWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB219426_LHBs_P-B      YWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPASPPPASTNRQ
AB287314_LHBs_P-B      NWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPTSTNRQ
AB287315_LHBs_P-B      NWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPTSTNRQ
GQ924637_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTPVPAAPPPASTNRQ
DQ463789_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB287319_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
DQ463797_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
JN792895_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
DQ463791_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
DQ463798_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
JN792899_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
JN792896_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
DQ463802_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
DQ463796_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPATPPPASTNRQ
AB287317_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
AB287322_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
DQ463788_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
JN792900_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPANTNRQ
JN792898_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
JN792897_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
DQ463800_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
DQ463799_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
DQ463790_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRK
DQ463792_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
AP011096_LHBs_P-B      NWPDSNKVGVGAFGTGFTPPHGGLLGWSPQAQGMLTTVPTAPPPASTNRQ
GQ358148_LHBs_P-B      NWPDSNKVGVGAFGTGFTPPHGGLLGWSPQAQGMLTTVPAAPPPASTNRQ
GQ358149_LHBs_P-B      NWPDSNKVGVGAFGTGFTPPHGGLLGWSPQAQGMLTTVPAAPPPASTNRQ
GQ358152_LHBs_P-B      NWPDSNKVGVGAFGTGFTPPHGGLLGWSPQAQGMLTTVPAAPPPASTNRQ
GQ358150_LHBs_P-B      NWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGMLTTVPAAPPPASTNRQ
GQ358151_LHBs_P-B      NWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGMLTTVPAAPPPASTNRQ
GQ358147_LHBs_P-B      NWPDSNKVGVGAFGSGFTPPHGGLLGWSPQAQGILTTMPAAPPSASTNRQ
AB713529_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPAFHNRQ
AB493827_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB033554_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
D00331_LHBs_C-B        NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
EU330989_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTVPTAPPPASTNRQ
EU330990_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTVPTAPPPASTNRQ
FJ023637_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTXPPPASTNRQ
EU330998_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTVPAAPPPASTNRQ
EU330999_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTVPAAPPPASTNRQ
FJ023638_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
EU331000_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTVPAAPPPASTNRQ
EU331001_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTVPAAPPPASTNRQ
EU330995_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTVPAAPPPASTNRQ
EU330996_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTVPAAPPPASTNRQ
EU330997_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTVPAAPPPASTNRQ
GQ924624_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ358146_LHBs_P-B      NWPDSNKVGVGAFGSGFTPPHGGLLGWSPQAQGILTTMPAAPPSASTNRQ
EF473977_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB713527_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB033555_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
GQ358143_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ358140_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
GQ358142_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AP011088_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ358145_LHBs_P-B      NWPDSNKVGVGAFGSGFTPPHGGLLGWSPQAQGILTTMPAAPPSASTNRQ
AP011086_LHBs_P-B      NWPDSNKVGVGAFGLGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB219428_LHBs_C-B      NWPDSNKVGVGAFGLGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AP011087_LHBs_P-B      NWPDSNKVGVGAFGLGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ924651_LHBs_P-B      NWPDSNKVGVGAFGLGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ924654_LHBs_P-B      NWPDSNKVGVGAFGLGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB976562_LHBs_P-B      NWPDSNKVGVGAFGLGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB219427_LHBs_P-B      YWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB219429_LHBs_P-B      YWPDSNKVGVGAFGPGFTPPHGGLLGWSPQSQGILTTVPAAPPPASTNRQ
GQ924625_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AP011089_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB219430_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
GQ924628_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ358137_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
AB493835_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
AP011085_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
AP011090_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AP011091_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AP011092_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EF473971_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
GQ924640_LHBs_P-B      NWPDSNKVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ358141_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ358136_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
GQ358138_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB642101_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLVGWSPQAQGILTSVPAAPPPASTNRQ
KJ717806_LHBs_P-B      HWPDANKVGVGAFGPGFTPPHGGLLGWSSQAQGLLTTVPAAPPPASTNRQ
KJ803795_LHBs_P-B      HWPDANKVGVGAFGPGFTPPHGGLLGWSSQAQGLLTTVPAAPPPASTNRQ
FJ032342_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQSIFTTVPAAPPPASTNRQ
JQ707734_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707735_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707737_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707738_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707742_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707743_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707744_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707745_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707746_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707747_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707749_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707750_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707753_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707758_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707759_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707763_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707764_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707765_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707766_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707767_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
AB555499_LHBs_P-B      QWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLSSVSAAPPPASTNRQ
DQ463787_LHBs_P-B      NWPDANKVGVGAFGPGFTPLHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
DQ463795_LHBs_P-B      NWPDANKVGVGAFGPGFTPLHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
JN604130_LHBs_P-B      NWPEANKVGVGAFGLGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU939670_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
DQ993696_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ924645_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU939635_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLVTTVPAAPPPASTNRQ
DQ995804_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGGSPQAQGIFTTVPAAPPPASTNRQ
AP011094_LHBs_P-B      SWPDSNKVGVGAFGTGFTPPHGGLLGWSPQAQGMLTTVPTAPPPASTNRQ
AB073851_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
JF436921_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPAFTNRQ
DQ995802_LHBs_P-B      NWPEANKVGVGAFGPGFTPLHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY206373_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLFTTVPAAPPPASTNRQ
AB300371_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
EU939674_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
FJ899790_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
FJ899791_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JN604123_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTPVPAAPPPASTNRQ
DQ993684_LHBs_P-B      TWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPLASTNRQ
AY206383_LHBs_P-B      NWPDANKVRVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB073823_LHBs_P-B      NWPDAWKVGVGAFGPGFTPPHGGLLGWSPQAQGXLTTVPAAPPPASTNRQ
KC792671_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ924656_LHBs_P-B      NWPDSNKVGVGAFGPGLTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
GQ924641_LHBs_P-B      NWPDSNKVGVGAFGPGLTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ377644_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377622_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
FJ386600_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLFTTVPAAPPPASTNRQ
EU570075_LHBs_P-B      NWPDANKAGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EF494381_LHBs_P-B      TWPDANEVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB900096_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGITTSLPAAPPPASTNRQ
AB287318_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
AB073847_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGMVGWSPQAQGILTSVPAAPPPASTNRQ
HM011476_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTYRQ
GQ377606_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPASTNRQ
FJ787477_LHBs_P-B      PWPDAWKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY167100_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB287323_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
AB073853_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB117759_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
DQ993686_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AY217355_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLFTTVPAAPPPATTNRQ
AY217356_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLFTTVPAAPPPASTNRQ
EU579441_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU589335_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386656_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP148457_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTPPPPASTNRQ
GU357842_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWNPQAQGILTTVPAAPPPASTNRQ
FJ386608_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQTQGLLTTVPAAPPPASTNRQ
FJ032344_LHBs_P-B      NWPDANKAGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AP011093_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGMLTTVPTAPPPASTNRQ
AB900106_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB713531_LHBs_P-B      NWRDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB287327_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
JX026886_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQALGMVTTVPAAPPPASTNRQ
JQ341587_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGQLTTVPADPPPASTNRQ
HM011470_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815779_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGTLTTVSAAPPPASTNRQ
FJ386683_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
FJ023631_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
EU796067_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU306704_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTAPAAPPPASTNRQ
DQ993682_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB900105_LHBs_P-B      NWPDAHKVGIGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB555498_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGQLGWSPQAQGILTTVPAAPPPASTNRQ
AB362933_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB205122_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB073839_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB073835_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
DQ993680_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
DQ993683_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
DQ993685_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
DQ993681_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JX026879_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAASPPASTNRQ
JQ027316_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQSQGILTTVPAAPPPASTNRQ
GU815770_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU939677_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU939671_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGQLTTVPAAPPPASTNRQ
EU306711_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EF473974_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQVILTTVPAAPPPASTNRQ
AF121251_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTSRQ
AB828708_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGIITSVPAAPPPASTNRQ
AB471854_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB073849_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
DQ993698_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
DQ993699_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB931168_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB931169_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
KJ717841_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTNVPAAPPPASTNRQ
KC792998_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX504532_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ801524_LHBs_P-B      QWPAANQVGAGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JN604219_LHBs_P-B      NWPDANKVGVGAFGPGLIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ924630_LHBs_P-B      NWPDANKVGVGAFGSGFTPPHGGLLGWSPQAQGVLTTVPVAPPPASTNRQ
GQ358139_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGMLGWSPQAQGILTTVPAAPPPASTNRQ
FJ562253_LHBs_P-B      NWPDANQVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPATPPPASTNRK
EU939638_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU882004_LHBs_P-B      PWPDAWKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU487257_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU306707_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY766463_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY206391_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILATVPAAPPPASTNRQ
AY167102_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB287321_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
AB073855_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB073841_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB073843_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB900108_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWNPQAQGILTSVPAAPPPASTNRQ
KP148419_LHBs_P-B      NWPDSNKVGVGAFGPGLAPPHGGLLGWSPQAQGILTTVPAAP--ASTNRQ
KP148427_LHBs_P-B      NWPDSNKVGVGAFGPGLAPPHGGLLGWSPQAQGILTTVPAAP--ASTNRQ
MG571321_LHBs_P-B      NWPDANKVGVGAFGPGLTPPHGGMLGWSSQAQGLLTTVPAAPPPASTNRQ
KX276996_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KJ717801_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSSQAQGLLTTVPAAPPPASTNRQ
JN604244_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JN604138_LHBs_P-B      NGQDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815651_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ562303_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTMPAAPPPASPNRQ
FJ562224_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386669_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU939676_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU881998_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAATNRQ
DQ463794_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
AF121248_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815747_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815748_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815777_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
LC349868_LHBs_P-B      IWPDSNKVGVGAFGPGFTPPHGGLLGWSSQAHGELTTVPAAPPPASTNRQ
KY881944_LHBs_P-B      NWPDSNKVGVEAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP659238_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
KP659219_LHBs_P-B      NWPDANKVGEGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
KP406190_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQTQGLLTTVPAAPPPASTNRQ
KP406212_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQTQGLLTTVPAAPPPASTNRQ
KC793145_LHBs_P-B      NWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASSNRQ
JQ801474_LHBs_P-B      NWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
HM011504_LHBs_P-B      NWPDANKVGVGAFGPGFXPPHGGLLGWSPQTQGILTTVPAAPPPVSTNRQ
GU815774_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGTLTTVPAAPPPASTNRQ
GU815752_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815743_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815735_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ924646_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ924606_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGXLSTVPAAPPPASTNRQ
FJ562316_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGMLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ562260_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
FJ562231_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASINRQ
FJ386688_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGMLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386666_LHBs_P-B      TWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386615_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGMLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386610_LHBs_P-B      SWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRK
FJ032358_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ023636_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPLAQGILTTVPAAPPPASTNRQ
EU939639_LHBs_P-B      NWPDANKVGVGAFGSGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU564822_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPSAPPPASTNRQ
EU306699_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU305547_LHBs_P-B      NWPDANKVGVGEFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
D23679_LHBs_P-B        NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
D23678_LHBs_P-B        NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
D00329_LHBs_P-B        NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AY596112_LHBs_P-B      NWTDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY596103_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPATPPPASTNRQ
AY217360_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AY217359_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AY167093_LHBs_P-B      NWTDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPVAPPPASTNRQ
AF282918_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
AF282917_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQSQGLLTTVPAAPPPASTNRQ
AF121247_LHBs_P-B      NWPNANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB900111_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB205121_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB073852_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB073848_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB073845_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB073836_LHBs_P-B      YWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB073831_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGIHTTVPAAPPPASTNRQ
AB195934_LHBs_P-B      NWPDANKVGVGAFGPGFAPPHGGLLGWSPQAQGLLTTVPAVPPPASTNRQ
AB195935_LHBs_P-B      NWPDANKVGVGAFGPGFAPPHGGLLGWSPQAQGLLTTVPAVPPPASTNRQ
EU306678_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU306681_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY167101_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
DQ993710_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AY033072_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
FJ023634_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AY033073_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB031267_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU939678_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ562289_LHBs_P-B      NWPDANKVGVGAFGPGFTPLHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
GU815653_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
LC349870_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGIITTVPTAPPPASTNRQ
KY881955_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881952_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881849_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276828_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KP659249_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
KP148416_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148414_LHBs_P-B      NWPDSNKVGVGAYGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ803797_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGQLGWSSQAQGLLTRGPAAPPSASTNRQ
KJ717808_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGQLGWSSQAQGLLTRGPAAPPSASTNRQ
KC792825_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRH
KC792722_LHBs_P-B      YWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JX429901_LHBs_P-B      DWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ707739_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
HM011490_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGXLGWSPQAQGILTTVPTAPPPASTNRQ
HM011477_LHBs_P-B      NWPDANKXGVGAFGPGFXPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815778_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGTLTTVPAAPPPASTNRQ
GU815739_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815709_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815639_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377525_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ787475_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGILTTVPAAPPPASTNRQ
FJ562237_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ562234_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386681_LHBs_P-B      NWPDANKVGVGSFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
FJ386648_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386642_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU939675_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU939661_LHBs_P-B      NWTDSNKVGVGAFGPGFTPPHGGLLGWSPQALGILTAVPAAPPPASTNRQ
EU595031_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU564826_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGRSPQAQGILTTVPAAPPPASTNRQ
EU522067_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU306710_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU306705_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU306703_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU139543_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
AP011084_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB900102_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPATPPPASTNRQ
AB900095_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB368295_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILATVPAAPPPASTNRQ
AB287326_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB231909_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB100695_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB073842_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB073830_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815574_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815577_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815561_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815569_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU306700_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU306701_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU306702_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU306706_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU306708_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU306709_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU306712_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
DQ448624_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
DQ993704_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
DQ993705_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
DQ993706_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
DQ993707_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571331_LHBs_P-B      NWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276827_LHBs_P-B      NWPDSNKVGVGAFGLGFTPPHGGLLGWSPQAQGIITTVPAAPPPASTNRQ
KP659223_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPADPPPASTNRQ
KP148438_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148426_LHBs_P-B      NWPDSNKVGVGAFGPGLAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148406_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILKTVPAAPPPASTNRQ
KC793150_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRK
KC793098_LHBs_P-B      NWPDANEVGAGAFGPGFIPPHGGLLGRSPQAQGMLTTVPAAPPPASTNRQ
KC793000_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGGSPQAQGILTTVPAAPPPASTNRQ
KC792794_LHBs_P-B      NWPDASKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792712_LHBs_P-B      NWPDANKVGVGAFGPGVVPPHGGLLGWSPQAQGILTNVPAAPPPASTNRQ
KC510650_LHBs_P-B      NWPGANKVGVGAFGPRFTPPHGVLLGWSPQAQGLLTTMPAAPPPASTNRQ
KC510646_LHBs_P-B      NWPGANKVGVGAFGPRFTPPHGVLLGWSPQAQGLLTTMPAAPPPASTNRQ
JX661480_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX504531_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQSQVLLTTVPAAPPPASTNRQ
JX026883_LHBs_P-B      NWPDANKVGVGAFGPGLTPPHGGLLGWSPQAQGLLTTVPAAPPPASANRQ
JX026881_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQSQGLLTTVPAAPPPASTNRQ
JQ707762_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ707755_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ341585_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ027334_LHBs_P-B      XWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JN604213_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTPVPAAPPPASTNRQ
JN604212_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JN604149_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILATVPAAPPPASTNRQ
JN604146_LHBs_P-B      NWTDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
HM011499_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRX
HM011474_LHBs_P-B      NWPDANKVGVGAFGPGFTPTHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815734_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815722_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815640_LHBs_P-B      KWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815578_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377638_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLFTTVPAAPPPASTNRQ
FJ562312_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386654_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386634_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
FJ032357_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU881997_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAATNRQ
DQ993709_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY167098_LHBs_P-B      NWPNANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY167094_LHBs_P-B      NWPDANKVGAGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB900110_LHBs_P-B      NWQDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
AB900104_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB642094_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB246342_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB212625_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILATVPAAPPPASTNRQ
AB073833_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB073829_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB300364_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AF121244_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386583_LHBs_P-B      NWPDANKVGVGAFGPGFTPLHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
FJ386584_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB010292_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB010289_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB365445_LHBs_P-B      NWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB073840_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377542_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLLTTVPAAPPPASTNRQ
AY293309_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLRWSPQAQGLLTTVPAAPPPASTNRQ
FJ386668_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386636_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571334_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881853_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276814_LHBs_P-B      NWPDSNKVGVGAFGSGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTIRQ
KX276782_LHBs_P-B      NWPDANKVGGGAFGPGFIPPHGGLLGWSPQAQGILTSVPAAPLPASTNRQ
KP406179_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQTQGLLTTVPAAPPPASTNRQ
KP148433_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148429_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148423_LHBs_P-B      NWPDSNKVGVGAFGPGVAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148411_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148410_LHBs_P-B      DWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148407_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774405_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
KC774397_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341605_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JN604311_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815783_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGTLTTVPAAPPPASTNRQ
GU815782_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGTLTTVPAAPPPASTNRQ
GU815781_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGTLTTVPAAPPPASTNRQ
GU815780_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815776_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815775_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGTLTTVPAAPPPASTNRQ
GU815773_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815772_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGTLTTVPAAPPPASTNRQ
GU815771_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815769_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815768_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815767_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815766_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815765_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815764_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815762_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815761_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815760_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815759_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815757_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815756_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815755_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815754_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815753_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815751_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815750_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815749_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815746_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815745_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815744_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815738_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815736_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815733_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815728_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815726_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815723_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815718_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815715_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815699_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815657_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815626_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815610_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815607_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815602_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815572_LHBs_P-B      NWPDANKVGVAAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815554_LHBs_P-B      NWPDAYKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815549_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ924653_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ924647_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ924644_LHBs_P-B      NWQDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ924626_LHBs_P-B      NWPEANKVGVGAFGPGFTPPHGGLLGWSPQAQGIXTTMPAAPPPASTNRQ
GQ924611_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ924607_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ377612_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377588_LHBs_P-B      IWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377519_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWIPQAQGLLTTVPAAPPPASTNRQ
FJ562257_LHBs_P-B      NWPDANKVGVGAFGPGFTPLHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
FJ023632_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPLAQGILTTVPAAPPPASTNRQ
EU939664_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU919171_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU796068_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPASTNRQ
EU306696_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
DQ448627_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGQLTTVPAAPPPASTNRQ
DQ448622_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
D00330_LHBs_P-B        NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY596110_LHBs_P-B      NWPDSNKVGIGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AY596109_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AY217362_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AY167097_LHBs_P-B      NWPNANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AF100309_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPTAPPPASTNRQ
AF100308_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
AB900103_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB302945_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQTQGLLTTVPAAPPPASTNRQ
AB302944_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQTQGLLTTVPAAPPPASTNRQ
AB302943_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQTQGLLTTVPAAPPPASTNRQ
AB302942_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQTQGLLTTVPAAPPPASTNRQ
AB246341_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB205120_LHBs_P-B      NWPDADKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB205119_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTLPAAPPPASTNRQ
AB195933_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAVPPPASTNRQ
AB073857_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB073850_LHBs_P-B      NWPNAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB073846_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
AB073837_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
AB010291_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
KC792992_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQTQGLLTTVPAAPPPASTNRQ
MG826153_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGIFTTVPAAPPPASTNRQ
MG826152_LHBs_P-B      NWPDANKVGVGAFGPGFTPSHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MG571353_LHBs_P-B      NWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571327_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881954_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881869_LHBs_P-B      NWPDANKVGVGAFGLGFTLPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276801_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276785_LHBs_P-B      NWPDANQVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964252_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964250_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964246_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP659246_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
KP659240_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
KP659239_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASANRQ
KP659235_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
KP659224_LHBs_P-B      NWPDANKVGVGAFGPGSTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
KP406182_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQTQGLLTTVPAAPPPASTNRQ
KJ803784_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KJ803783_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSSQAQGLLTTVPAAPPPASTNRQ
KF053190_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KF053189_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSSQAQGLLTTVPAAPPPASTNRQ
KC793174_LHBs_P-B      NWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793043_LHBs_P-B      NWPDANKVGVGTFGPGFIPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KC792943_LHBs_P-B      SWPDANEVGVGAFGPGFTPPHGGMLGWSPQAQGILTTVPAAPPPASTNRQ
KC774415_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774410_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQSIFTTVPAAPPPASTNRQ
KC774362_LHBs_P-B      NWPDANKVGVGAFGSGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JX504543_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
JQ707740_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
JQ040138_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGQLTTVPAAPPPASTNRQ
HM011484_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815713_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815680_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815581_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ924648_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTLPAAPPPASTNRQ
GQ377569_LHBs_P-B      NWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
FJ562254_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ562246_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
FJ386684_LHBs_P-B      SWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386660_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU939667_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
EU882002_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU306698_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
EU306697_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
EU306695_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
EF494380_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
DQ993703_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPATPPPASTNRQ
DQ448626_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
DQ448623_LHBs_P-B      NWPDANQVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
DQ377158_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
AY596105_LHBs_P-B      NWPDANKVGVGAFRPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY596102_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AF121249_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB900097_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQXQGILTSVPAAPPPASTNRQ
AB675676_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
FJ023633_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ023635_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MG571376_LHBs_P-B      NWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571357_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
LC349874_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KY881864_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881841_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KX276819_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILXTVPAAPPPASTNRQ
KU964394_LHBs_P-B      TWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964249_LHBs_P-B      TWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP659254_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
KP659250_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
KP406303_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406290_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406288_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP148425_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ803808_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ803781_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ717820_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ173383_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KF053194_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793136_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGWSPQAQGTLTTVPAAPPPASTNRQ
KC793054_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792980_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGQLTTVPAAPPPASTNRQ
KC792948_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792916_LHBs_P-B      NWPNANKVGVGAFGPGFIPPHGGMLGWSPQAQGILTTVPAAPPPASTNRQ
KC792887_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGMLGWSPQAQGILTTVPTAPPPASTNRQ
KC792724_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792649_LHBs_P-B      NWXXANNXGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774417_LHBs_P-B      IWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
KC774404_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPASTNRQ
KC774398_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLFTTVPAAPPPAATNRQ
KC774391_LHBs_P-B      NWPDANKVGVGAFGSGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNGQ
KC774368_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774365_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC510655_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX429911_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX429910_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASANRQ
JQ801479_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341608_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPSAPPPASTNRQ
JQ341600_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341588_LHBs_P-B      YWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ341580_LHBs_P-B      TWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ341576_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
JQ040128_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ027325_LHBs_P-B      NWPDAWKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JN604143_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JN604134_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JN604132_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTPVPAAPPPASTNRQ
HQ700546_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815658_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815646_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815608_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ924632_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ349236_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPLAQGILTTVPAAPPSASTNRQ
EU939669_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
EU939663_LHBs_P-B      NWPDANKVGVGSFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU350409_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
DQ993708_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLLPTVPAAPPPASTNRQ
AB115551_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792742_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
HM011475_LHBs_P-B      NWPDANKVGEGAFGPGXTPPHGGLLGWSPQAQGLXTTXPAAPPPASTNRQ
JX661478_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571339_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674440_LHBs_P-B      TWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674436_LHBs_P-B      NWPNANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674415_LHBs_P-B      TWPDANKVGVGAFGPGFIPPHGGLLGWSPQSQGILTTVPAAPPPASTNRQ
LC349871_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881799_LHBs_P-B      NWPDANEVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881787_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276823_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KX276817_LHBs_P-B      NWPDSNKQGVGAFGPGFTPPHGGLLGWNPQAQGILTTVPAAPPPASTNRQ
KU964256_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964255_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964248_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP659252_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
KP659244_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPTAPPPASTNRQ
KP659237_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
KP659234_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
KP406297_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406286_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406176_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406180_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP148440_LHBs_P-B      NWPDSNKVGVGAFEPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148437_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148435_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148430_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148415_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148413_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148409_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP148405_LHBs_P-B      NWPDSNKVGVGAFGPGFAPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ173375_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KJ173297_LHBs_P-B      NWPDANQVGVGAFGPGFNPPQGDLLGWSPQAQGILTTVPATPPPASTNRQ
KC793124_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KC792783_LHBs_P-B      NWPEANKVGVGAFGPGFTPPHGGXLGWSPQAXGLLTTVPAAPPPASTNRQ
KC792715_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGQLTTVPAAPPPASTNRQ
KC792667_LHBs_P-B      NWPDSNKVGVGAFGPGFIPPHGGXLGWSPQAQGILTXVPAAPPTASTNRQ
KC774395_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KC510656_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASANRQ
KC510649_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASANRQ
KC510642_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASANRQ
JX504538_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGQLTTLPAAPPPASTNRQ
JQ801516_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ801506_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ341603_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTVXATPPPASTNRQ
JQ341597_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
JQ341599_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
JQ341572_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ027330_LHBs_P-B      NWPDANKVGVGAFGPGXIPPHGGLLGWSPQAQGIXTXVPAAPPPASTNRQ
JQ027331_LHBs_P-B      NWPDANKVGVGAFGPGXIPPHGGLLGWSPQAQGIXTXVPAAPPPASTNRQ
JQ027315_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
HM011494_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
HM011483_LHBs_P-B      NWPBANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
HM011482_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGQLTTVPAAPPPASTNRQ
HM011480_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815742_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815740_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815737_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815732_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815731_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815730_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815729_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815727_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815725_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815724_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815721_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815720_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815719_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815717_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815716_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815712_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815711_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815708_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815705_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815704_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815703_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815700_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815698_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815697_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815696_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815695_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815694_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815693_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815692_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815691_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815689_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815688_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815687_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815686_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815685_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815684_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815683_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815681_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815679_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815678_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815677_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815676_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815675_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815674_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815673_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815672_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815670_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815669_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815668_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815667_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815666_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815665_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815664_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815663_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815662_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815661_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815660_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815659_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815656_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815654_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815652_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815650_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815649_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815648_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815647_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815633_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815632_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815623_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815619_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815618_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815614_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815613_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815612_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815609_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815606_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815605_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815604_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815603_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815601_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815600_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815599_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815598_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815597_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815596_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815595_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815594_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815593_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815591_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815590_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815589_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815588_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815587_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815586_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815585_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815584_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815583_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815579_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GU815576_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815575_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815571_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815570_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815568_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815567_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815566_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815565_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815564_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815563_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815562_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815560_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815559_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815558_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815557_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815556_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815555_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815553_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815552_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815551_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815550_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GU815548_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ924634_LHBs_P-B      NWPNANKVGVGAFGPGFIPPHGGLLGWNPQAQGMLTTVPAAPPPASTNRQ
GQ924631_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
GQ924627_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ924610_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ924608_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ924605_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ924603_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377643_LHBs_P-B      NWPDANKVGVGAFGPGFTPLHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
GQ377641_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377639_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377625_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377587_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377558_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377547_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377537_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ899779_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
FJ787444_LHBs_P-B      NWPDANKVGGGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
FJ562321_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
FJ562222_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386682_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386680_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
FJ386676_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
FJ386655_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
FJ386582_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU570071_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU570070_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU564824_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPSAPPPASTNRQ
EU564823_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPSAPPPASTNRQ
EU522074_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU306680_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU306679_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU305548_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EU158263_LHBs_P-B      NWPEANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EF473975_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
EF134946_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EF134945_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
DQ448628_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
DQ448625_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
DQ448621_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
DQ448620_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
DQ448619_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY518556_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AY167089_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AJ627225_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILATVPAAPPPASTNRQ
AF479684_LHBs_P-B      NWPDANKVGVGAFGPGFTPSHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AF279464_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPSASTNRQ
AF121246_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AF121245_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AF121243_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB471855_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB287329_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB287328_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB246339_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB073834_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB073827_LHBs_P-B      NWPEANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB073826_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
AB073825_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRX
AB073824_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB073822_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571336_LHBs_P-B      NWPHANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVSAAPPPASTNRQ
MG372436_LHBs_P-B      NWPDANQVGVGAFGPGFTPPHGGMMGWSPQAQGLLTAVPAAPPPASTNRQ
MF674491_LHBs_P-B      TWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674478_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674441_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674434_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674419_LHBs_P-B      NWPDANKVGVGSFGPGFTPPHGGLLGWSPQAQGILTPVPAAPPPASTNRQ
KY881958_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881957_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881956_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881953_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881951_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881950_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881949_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881948_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881947_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881946_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881945_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881913_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881868_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881863_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881861_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881791_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY417926_LHBs_P-B      SWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KX276784_LHBs_P-B      NWPDANQVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964253_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964251_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964244_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963854_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KJ803789_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ717798_LHBs_P-B      NWPDSNKVGVGAFGPGLTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KJ717795_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173404_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173403_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173384_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173341_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPATPPPASTNRQ
KC793078_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQTQGILTTVPAAPPPASTNRQ
KC793073_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793070_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792878_LHBs_P-B      NWPDANKVGVGAFGPGXTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792847_LHBs_P-B      NWLDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792827_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792785_LHBs_P-B      XWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792770_LHBs_P-B      NWPBANKVGVGAFGPGFTPPHGGLLGWSXQAQGLLTTVPAAPPPASTNRQ
KC792697_LHBs_P-B      NWPDANKVAVGAFGPGFIPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KC792678_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792666_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792662_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792661_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTVPAXPPPASTNRQ
KC792660_LHBs_P-B      NWQDNNKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792648_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774413_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341596_LHBs_P-B      TWPDANKVGVGAFGPGXIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ341568_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ040157_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JN604234_LHBs_P-B      NWPDXNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAXTNRQ
HM011473_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
HM011471_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
HM011467_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASXNRQ
HM011466_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
GQ377629_LHBs_P-B      NWPDANKVGVGAFGPGFTPLHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
FJ562311_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
EU547563_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB073832_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP406187_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406199_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KC792839_LHBs_P-B      NWPEANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793015_LHBs_P-B      NWPDANKVGVGAFGXGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276779_LHBs_P-B      NWPDANKVGVGAFGXGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792677_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792945_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341582_LHBs_P-B      NWPDANKVGGGAFGPGFIPPHGGLLGWSPQAQGILTTMPAAPPPASTNRQ
JQ341594_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JN604221_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ341601_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP406186_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406188_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406189_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406191_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406192_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406193_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406195_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406196_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406197_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406198_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406200_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406201_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406202_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406203_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406204_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406205_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406206_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406207_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406208_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406209_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406210_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406211_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406213_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406214_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406215_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406217_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406218_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406219_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
MG571367_LHBs_P-B      NWPDAIKVGAGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571355_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
MG571352_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674432_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILATVPAAPPPASTNRQ
MF674409_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
LC349869_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KY881848_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KX276818_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KX276796_LHBs_P-B      NWPNANKVGXGAXGPGFIPPHGGLLGWSPQAQGIXTTVPAAPPPASTNRQ
KU964302_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964300_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964292_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964291_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964283_LHBs_P-B      NWPDANKVGVGAFGPGSTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963949_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963852_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963842_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP659255_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
KP659248_LHBs_P-B      NWPBANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTSLPAAPPPASTNRQ
KP406314_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406312_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406305_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406302_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406301_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406300_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406299_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406298_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406296_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406295_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406287_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP148356_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148328_LHBs_P-B      NWPDANKVGVGAFGPGFTPPRGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KJ803796_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ803758_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KJ717807_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KF053165_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KC793163_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGRSPQAQGILTTVPAAPPPASTNRQ
KC793086_LHBs_P-B      NWPNANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793028_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793021_LHBs_P-B      NWRDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792966_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792953_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792949_LHBs_P-B      NWPDAHKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792924_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQTQGLLTTVPAPPPPASTNRQ
KC792897_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSSQAQGILTTVPAAPPPASTNRQ
KC792890_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792860_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792851_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792832_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGWSPQXQGILTTVPAAPPPASTNRQ
KC792788_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPVAPPPASTNRQ
KC792782_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQXQGILTTVPAAPPPASTNRQ
KC792764_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPSAPPPASTNRQ
KC792754_LHBs_P-B      NWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792748_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLXGWSPQAQGXLTTVPAAPPPASTNRX
KC792737_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792711_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGMLGWSPQAQGILTTVPAAPPPASTNRQ
KC792692_LHBs_P-B      NWPDANKVGVGAFGPGXTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792687_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792676_LHBs_P-B      NWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGILXTVPAAPPPASTNRQ
KC792664_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792657_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KC774407_LHBs_P-B      SWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774401_LHBs_P-B      NWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774400_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774396_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774390_LHBs_P-B      NWPDANKVGVGAFGSGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774389_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774382_LHBs_P-B      NWPDANKVGVGAFGSGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774381_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774380_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774377_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWGPQAQGLLTTVPAAPPPASTNRQ
KC774373_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774372_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774371_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774369_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774363_LHBs_P-B      NWPDANKVGVGAFGSGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC510658_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC510657_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC510654_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASANRQ
KC510651_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC510647_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX978431_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX870001_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX661479_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX661475_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX661473_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX661471_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX504533_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JX429902_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX429897_LHBs_P-B      NWPDADKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ801494_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTGPAAPPPASTNRQ
JQ801471_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ412092_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPASTNRQ
JQ341609_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGIHTTVPAAPPPASTNRQ
JQ341593_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341589_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQALGTLTTVPAAPPPASTNRQ
JQ341570_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341564_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ341552_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ040147_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JN604284_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPLAQGILTTVPAAPPSASTNRQ
JN604253_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JN604223_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JN604154_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPLAQGILTTVPAAPPSASTNRQ
JN604125_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGILTTVPAAPPPASTNRQ
JN604124_LHBs_P-B      NWPDANKVGVGAFGSGFTPPHGGLLGWSPQAQGQLTTVPAAPPPASTNRQ
JN604119_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JN406371_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLFTTVPAAPPPASTNRQ
JF412801_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
HM153811_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQSQGLLTTVPAAPPPASTNRQ
HM011503_LHBs_P-B      NWPDADKVGVGAFGPGXTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
DQ995801_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
AB642093_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
AB073821_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
X98077_LHBs_P-B        YWPDAWKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571364_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MF674420_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILATVPATPPPASTNRQ
MF674396_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674389_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF621878_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGRSPQAQGILTTVPAAPPPASTNRQ
KY881912_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881910_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881909_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881908_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881906_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881867_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQDQGILTTVPATPPPASTNRQ
KY881858_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881808_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276824_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTPVPAAPPPASTNRQ
KX276821_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGXLGWSPQAQGILTTVPTAPXPASTNRQ
KX276793_LHBs_P-B      NWPDAXKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964254_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964161_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964109_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964108_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963955_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963948_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963815_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KP659253_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
KP659251_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
KP659247_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
KP659245_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSLPAAPPPASTNRQ
KP406304_LHBs_P-B      NWPAANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406294_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406284_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406194_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406216_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP036970_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ843165_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ803773_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ803755_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KJ410500_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173386_LHBs_P-B      NWPDANKVGVGAFGSGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ173371_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPASTNRQ
KF053180_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KF053162_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
KC793171_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793134_LHBs_P-B      NWXDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPXXPPPASTNRQ
KC793128_LHBs_P-B      NWPDANKVGVGAFGXGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793121_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGXLGWSPQAQGILTTVPAAPPPASTNRQ
KC793092_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793060_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793011_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KC793001_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792931_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792930_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792892_LHBs_P-B      NWPDANKVGVGTFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792884_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792850_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792844_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGMLGWSPQAQGILTTVPATPPPASTNRQ
KC792820_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRK
KC792804_LHBs_P-B      NWPDANKVGVGAFGPGXTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774409_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774402_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KC774379_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774370_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
JX661483_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
JX507213_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX429899_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ801485_LHBs_P-B      NWTDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341598_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTPVPAAPPPASTNRQ
JQ341592_LHBs_P-B      XWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341583_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNSQAQGLLTTVPAAPPPASTNRQ
JQ341567_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ341555_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
JQ341551_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JN604187_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KC774412_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341553_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGXLTTVPAAPPPASTNRQ
KC774367_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
X97851_LHBs_P-B        NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
MG571373_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571365_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571351_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571348_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571347_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571338_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTAVPAAPPPASTNRQ
MF674507_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674459_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674446_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674439_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
LC349879_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPASTNRQ
LC349878_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881901_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881900_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881899_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881898_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881897_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881896_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881895_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881866_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881865_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881860_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881859_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881857_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881855_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881854_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881852_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881836_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881831_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881829_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881828_LHBs_P-B      NWPDANKVGVGAFGSGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881827_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881823_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881780_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQAILTTVPAAPPPASTNRQ
KX765841_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPLAQGLLTTVPAAPPPASTNRQ
KX276809_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KX276807_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KX276800_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KU964397_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGRSPQAQGILTTVPAAPPPASTNRR
KU964395_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGRSPQAQGILTTVPAAPPPASTNRR
KU964393_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGRSPQAQGILTTVPAAPPPASTNRR
KU964391_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGRSPQAQGILTTVPAAPPPASTNRR
KU964388_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGRSPQAQGILTTVPAAPPPASTNRR
KU964385_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGRSPQAQGILTTVPAAPPPASTNRR
KU964384_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGRSPQAQGILTTVPAAPPPASTNRR
KU964383_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGRSPQAQGILTTVPAAPPPASTNRR
KU964382_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGRSPQAQGILTTVPAAPPPASTNRR
KU964381_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGRSPQAQGILTTVPAAPPPASTNRR
KU964270_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964268_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964266_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964264_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964263_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964262_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964261_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964259_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964257_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964096_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964094_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963987_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963953_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963951_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963946_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963827_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KU963826_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KU963825_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KU963824_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KU963823_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KU963822_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KU963821_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KU963820_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KU963819_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KU963818_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KU963817_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KU963816_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963814_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KT749820_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQPQGLHTTVPAAPPPASTNRQ
KP659220_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTLPAAPPPASTNRQ
KP406317_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406291_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406280_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406274_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406268_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406263_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406262_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLVGWSPQAQGLLTTVPAAPPPASTNRQ
KP406257_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLMGWSPQAQGLLTTVPAAPPPASTNRQ
KP148363_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KM213034_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ803821_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ803820_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGRSPQAQGILTTVPAAPPPASTTRQ
KJ803775_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ803752_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSSQAQGLLTTVPAAPPPASTNRQ
KJ790200_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGRLTTVPAAPPPASTNRQ
KJ717837_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ717836_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGRSPQAQGILTTVPAAPPPASTTRQ
KJ717818_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173378_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ173377_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ173348_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPTAPPPASTNRQ
KJ173347_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPTAPPPASTNRQ
KF053182_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793193_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793191_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793177_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793160_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793080_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793059_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTTRQ
KC793045_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQASGILTTVPAAPPPASTNRQ
KC793036_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGIITTIPAAPPPASTNRQ
KC793033_LHBs_P-B      TFQNANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KC793023_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793016_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAALPPASTNRQ
KC793006_LHBs_P-B      NWPDAHKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792996_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792967_LHBs_P-B      NWPDAWKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792950_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPASTNRQ
KC792944_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792939_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
KC792925_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792910_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792843_LHBs_P-B      NWPDANKVGVGAFGXGFTPPHGGLLGWSPQAQGILTTVPAAPPLASTNRQ
KC792815_LHBs_P-B      NWPDAXKVGVGAFGPGFXPPHGGLLGWSPQAQGILTTVPAAPPPAXTNRQ
KC792813_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRR
KC792791_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792736_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792729_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGLFTTVPAAPPPASTNRQ
KC792675_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792674_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774385_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774378_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JX869998_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGQLTTVPAAPPPASTNRQ
JX661482_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341581_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341578_LHBs_P-B      NWPDANKVGVGAFGPGFTPSHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341571_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ341569_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341566_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341563_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341561_LHBs_P-B      NWPDANQVGXGAFGPGFTPPHGGMLGWSPQAQGLXTTVPAAPPPASTNRQ
JQ341558_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341550_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ040171_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ040125_LHBs_P-B      NWPDANKVGIGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JN604224_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILATVPAAPPPASTNRQ
MG571372_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571362_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASANRQ
MG571337_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MF674490_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIITTVPAAPPPASTNRQ
MF674466_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674422_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MF674392_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
LC349877_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881914_LHBs_P-B      NWLDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881893_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881844_LHBs_P-B      NWPDDRKVGVGAFGPGFTPPHGGLLRWSPQAQGILTTVPATPPPASTNRQ
KY881834_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881826_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881822_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881820_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881800_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY470841_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY470832_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY470830_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276813_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGMLGWSPQAQGLHTTVPAAPPPASTNRQ
KX276804_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGQLTTVPAAPPPASTNRQ
KX276772_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KX276770_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILSTVPAAPPPASTNRQ
KU964301_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964299_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964298_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964297_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964296_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964295_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964294_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964293_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964290_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964289_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964288_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964287_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964265_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964260_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964258_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964160_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964159_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964158_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964114_LHBs_P-B      NWPDANTVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964093_LHBs_P-B      NWPDANKVGVGAFGPGLTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963853_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963851_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963850_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963849_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963848_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963847_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963846_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963845_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963844_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963843_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406316_LHBs_P-B      NWPAANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406315_LHBs_P-B      NWPAANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406313_LHBs_P-B      NWPAANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406311_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406310_LHBs_P-B      NWPAANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406309_LHBs_P-B      NWPAANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406308_LHBs_P-B      NWPAANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406307_LHBs_P-B      NWPAANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406306_LHBs_P-B      NWPAANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406289_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406285_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406281_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406265_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406165_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQTQGLLTTVPAXPPPASTNRQ
KP148348_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KP148342_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KP148325_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KM392083_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAHVLLTTVPAAPPPASTNRQ
KJ803768_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ803756_LHBs_P-B      NWPDANKVGVGAFGSGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ717842_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ173385_LHBs_P-B      NWPDANKVGVGAFGSGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ173357_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KJ173356_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KF053174_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KF053163_LHBs_P-B      NWPDANKVGVGAFGSGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793185_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793159_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793101_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793090_LHBs_P-B      NWPDAXKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793084_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793072_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793071_LHBs_P-B      NWPDANKVGVGAFGPGFXPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793056_LHBs_P-B      NWPDANKVGVGAFGPGFXPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KC793053_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793031_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KC793020_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793014_LHBs_P-B      NWXDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793013_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPTTPPPASTNRQ
KC792964_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGRSPQAQGILTTMPAAPPPASTNRQ
KC792956_LHBs_P-B      NWPEXNKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792954_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGMLGWSPQAQGILTTVPAAPPPASTNRQ
KC792947_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KC792919_LHBs_P-B      KWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792901_LHBs_P-B      NWPDANKVGVGAFGPGFSPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792898_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792807_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792766_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792750_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVQAAPPPASTNRQ
KC792741_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGXSPQAQGILTTVPAAPPPASTNRK
KC792735_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792681_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGQLTTVPAAPPPASTNRQ
KC792650_LHBs_P-B      NWPDANKVGXGAFGLGXTPPHGGLLGWSPQAQGLLTTVPXAPPPASTNRQ
KC774419_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774416_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774411_LHBs_P-B      NWPEANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774408_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774406_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
KC774403_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KC774399_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774394_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774393_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774392_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774388_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774387_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774386_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAATNRQ
KC774384_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774383_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774376_LHBs_P-B      NWPDAIKVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC774375_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774374_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC774366_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC510660_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC510659_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC510653_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC510652_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC510648_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC510644_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC510643_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC510641_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC492739_LHBs_P-B      NWPNANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
JX869999_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX661484_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JX661481_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX661477_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX661476_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX661474_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX661472_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPTAPPPASTNRQ
JX661470_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JX507215_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX507210_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX429908_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JX429900_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ801514_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ801512_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ688405_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ412090_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
JQ341606_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341604_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ341595_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGXLGWSPQAQGILTTVPAAPPPASTNRQ
JQ341591_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ341584_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341579_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILATVPAAPPPASTNRQ
JQ341575_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341574_LHBs_P-B      NWPDAIKVGAGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341573_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341562_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341560_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341556_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341549_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ040173_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
JQ040170_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JN604122_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JF899335_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406267_LHBs_P-B      NWPDANKVGVGAFGPEFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341557_LHBs_P-B      XWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ341577_LHBs_P-B      SWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MH932712_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
MH061283_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571344_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571341_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTLPAAPPPASTNRQ
MG571328_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MF674500_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674473_LHBs_P-B      NWQDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILATVPAAPPPASTNRQ
MF674469_LHBs_P-B      TWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674464_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674460_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTIVPAAPPPASTNRQ
MF674456_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674391_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MF674385_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881911_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881907_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881850_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881837_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881825_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881801_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881795_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881794_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881793_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881790_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881789_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881788_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881784_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881783_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881782_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881781_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY470838_LHBs_P-B      NWPDANKVGVGAFGPGFTPPPWGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY470833_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276820_LHBs_P-B      XXPDXNKVGVGAFGPGFTPTHGGLLGWSPQAQGILTPVPAAPPPASTNRQ
KX276795_LHBs_P-B      NWPDANXXGVGAFGPGFXPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KU964286_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964281_LHBs_P-B      NWPDANKVGVGAFGPGSTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964280_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964247_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964245_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964168_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964165_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964163_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964157_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964156_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964143_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964135_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KU964122_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964121_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964120_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964119_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964116_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964113_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964112_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964111_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964110_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964106_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964105_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964100_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964099_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964097_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964095_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963980_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963967_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLATVPAAPPPASTNRQ
KU963963_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLATVPAAPPPASTNRQ
KU963962_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLATVPAAPPPASTNRQ
KP406334_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406330_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406282_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406273_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406272_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406185_LHBs_P-B      NWPNANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406184_LHBs_P-B      NWPNANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406183_LHBs_P-B      NWPNANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406181_LHBs_P-B      NWPNANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406178_LHBs_P-B      NWPNANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406177_LHBs_P-B      NWPNANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP148582_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KP148357_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148326_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148317_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KM213036_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLFTTVPAAPPPASTNRQ
KJ410507_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPASPPPASTNRQ
KJ173398_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPASTNRQ
KJ173397_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPASTNRQ
KJ173372_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPASTNRQ
KJ173353_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KJ173351_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KJ173342_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGMFTTVPAAPPPASTNRQ
KJ173298_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KC793190_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGXSPQXQGILTTVPAAPPPASTNRQ
KC793154_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASXXRX
KC793106_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793096_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793088_LHBs_P-B      NWPDANKVGVGAFGPGFXPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793063_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGRSPQAQGILTTVPAAPPPASTNRQ
KC793058_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793049_LHBs_P-B      NWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793038_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTAVPAXPPPASTNRQ
KC793025_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793005_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792983_LHBs_P-B      NWPXANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792963_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792928_LHBs_P-B      NWPNANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792894_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792837_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792810_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792797_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792789_LHBs_P-B      NWPNANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPVSTNRQ
KC792786_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KC792765_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792755_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792749_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792744_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792699_LHBs_P-B      NWPDAXKVGVGAFGPGFXPPHGGLLGWSPQAQGXLTTVPAAPPPASTNRQ
KC792654_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
JQ341559_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571368_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571354_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571323_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571322_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MF674515_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674513_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674508_LHBs_P-B      NWPNANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674493_LHBs_P-B      TWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674483_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674482_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIITTVPAAPPPASTNRQ
MF674481_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQALGILTTVPAAPPPASTNRQ
MF674476_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWNPQAQGILTTVPAAPPPASTNRQ
MF674461_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674450_LHBs_P-B      NWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MF674443_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674438_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPLAQGILTTVPAAPPPASTNRQ
MF674437_LHBs_P-B      TWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674416_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674414_LHBs_P-B      NWPEANKVGEGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674407_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674387_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881904_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881862_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881843_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881842_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881839_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881833_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881824_LHBs_P-B      NWPDANKAGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881798_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881797_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881796_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881786_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY881785_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY629636_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY629635_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY470956_LHBs_P-B      KWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276829_LHBs_P-B      NWPDSNKVGVGAFGPGFTPPHGGLLGWXPQAQGILTTVPTAPPPASTNRQ
KX276803_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KX276802_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276792_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276786_LHBs_P-B      NWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KX276777_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KU964285_LHBs_P-B      NWPDANKVGVGAFGPGSTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964284_LHBs_P-B      NWPDANKVGVGAFGPGSTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964279_LHBs_P-B      NWPDANKVGVGAFGPGSTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964278_LHBs_P-B      NWPDANKVGVGAFGPGSTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964277_LHBs_P-B      NWPDANKVGVGAFGPGSTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964276_LHBs_P-B      NWPDANKVGVGAFGPGSTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964274_LHBs_P-B      NWPDANKVGVGAFGPGSTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964272_LHBs_P-B      NWPDANKVGVGAFGPGSTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964269_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964152_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964151_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964150_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
KU964149_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964148_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964147_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964146_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964145_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964144_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964142_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964141_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964140_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964139_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964138_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964107_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964104_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964102_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964101_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963989_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963988_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963986_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963985_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963984_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963983_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963982_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963981_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963979_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963978_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963977_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963976_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963959_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963958_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963957_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963956_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963954_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963952_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963950_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963947_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963945_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963835_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963833_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU234318_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KR232337_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPASTNRQ
KP406332_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406329_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406328_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406327_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406326_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406325_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406324_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406323_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406322_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406321_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406320_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406319_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406318_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406293_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406292_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406278_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406277_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406276_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406275_LHBs_P-B      NWPDAKKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406270_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406255_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406253_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406252_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406246_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP148365_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148361_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148360_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148359_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148334_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148331_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148324_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148321_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148320_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148319_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148318_LHBs_P-B      NWPDANRVGVGAFGPGFTPPHGGLLGWGPQAQGLLTNVPAAPPPASTNRR
KP148314_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KM392084_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAPPPPASTNRQ
KM359440_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAVPPPASTNRQ
KM213032_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ803816_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ717829_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ717796_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILATVPAAPPPASTNRQ
KJ410516_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173388_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173387_LHBs_P-B      NWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173369_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173366_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173364_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGLLTTAPAAPPPASTNRQ
KJ173363_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGLLTTAPAAPPPASTNRQ
KJ173362_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KJ173361_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KJ173343_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793196_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRR
KC793194_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQXLLTTVPAAPPPASTNRQ
KC793183_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793178_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793168_LHBs_P-B      NWPDANKVGVGAFGSGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793164_LHBs_P-B      NWLDASKVGVGAFGPGFTPTHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793155_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793122_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793117_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793089_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793083_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793081_LHBs_P-B      NWPDASKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793069_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793061_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793057_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793029_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793012_LHBs_P-B      NWPDDNKVGVGAFGPGFVPPHGGLLGWSXQAQGILTTVPAAPPTASTNRQ
KC793009_LHBs_P-B      NXPDXNKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792997_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPXAPPPASTNRQ
KC792960_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792959_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792958_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792938_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRR
KC792937_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792936_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPXAPPPASTNRQ
KC792935_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792934_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792915_LHBs_P-B      NWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRL
KC792893_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792888_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTMPAAPPPASTNRQ
KC792883_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792882_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792869_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792854_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792849_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792836_LHBs_P-B      NXPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGXLTTVPAAPPPASTNRQ
KC792821_LHBs_P-B      NWPBAKKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792809_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792805_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGVXGWSPQAQGLLTTVPAAPPPASTNRQ
KC792802_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792781_LHBs_P-B      NWPDAWKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792780_LHBs_P-B      NWPDANKVGAGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792769_LHBs_P-B      NWPDANKVGVGAFGPGFXPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792767_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792752_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILXTVQXAPPPASTNRQ
KC792733_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792703_LHBs_P-B      NWPDANKVGAGAFGPGFXPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792668_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792665_LHBs_P-B      XXPDANKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JN604127_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406261_LHBs_P-B      NWPDANKVGVGAFGPEFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406259_LHBs_P-B      NWPDANKVGVGAFGPEFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406256_LHBs_P-B      NWPDANKVGVGAFGPEFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTDRQ
X97850_LHBs_P-B        NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MK052965_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
MK052964_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
MK052962_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
MH663473_LHBs_P-B      NWPDANKVGVGAFGPGFTPAHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
MG571374_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571361_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571358_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRR
MG571349_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
MG571346_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MG571342_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571333_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MF674505_LHBs_P-B      NWPDAHKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674487_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQLILTTVPAAPPPASTNRQ
MF674479_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674465_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGMLGWSPQAQGILTTVPAAPPPASTNRQ
MF674404_LHBs_P-B      HWRDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674394_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674382_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881847_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881830_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881821_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY470962_LHBs_P-B      KWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY470961_LHBs_P-B      KWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY470960_LHBs_P-B      KWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY470954_LHBs_P-B      KWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY470953_LHBs_P-B      KWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY470840_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY470839_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY470837_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY470836_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY470835_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KY470834_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276812_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KX276781_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964271_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964267_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964166_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964164_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964155_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964154_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964153_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964118_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964115_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964103_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406335_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406333_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406331_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406266_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406264_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406260_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406258_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406245_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406240_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406238_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406237_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406171_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQTQGLLTTVPAAPPPASTNRQ
KP406163_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQTQGLLTTVPAAPPPASTNRQ
KP148581_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KP148579_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KP148349_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KP148347_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KP148346_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KP148345_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KP148344_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KP148343_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KP148341_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KP148340_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KP148339_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KP148338_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KP148336_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KM875421_LHBs_P-B      SWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KM875420_LHBs_P-B      SWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KM875418_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KM392072_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ803805_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ717817_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ410490_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173417_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173416_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173390_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KJ173389_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KJ173379_LHBs_P-B      NWPDANKVGVGAFGPGFTPSHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KJ173376_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KJ173355_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KJ173340_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173339_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793197_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793182_LHBs_P-B      NWQDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793181_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPVAPPPASTNRQ
KC793180_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAXGLLTTVPAXPPPASTNRQ
KC793179_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793175_LHBs_P-B      NWXDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793156_LHBs_P-B      NWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793152_LHBs_P-B      PWPDAWKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793146_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793139_LHBs_P-B      NXPDANKVGVGAFGPGXTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793114_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793111_LHBs_P-B      NWPDANKVGVGAFGTGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793104_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793099_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793094_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793027_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792986_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGLLTSVPAAPPPAXTNRQ
KC792985_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792975_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792973_LHBs_P-B      NWPDANKVGVGXFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792970_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792918_LHBs_P-B      NWPNANKVGAGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792913_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQTQGLLTTVPAAPPPASTNRQ
KC792908_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGXLGWSPQAQGLLTTVPAAPPPASTNRX
KC792906_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGQLTTVPAAPPPASTNRQ
KC792903_LHBs_P-B      NWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792900_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792881_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792879_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTMPAAPPPASTNRQ
KC792875_LHBs_P-B      NWPDXXKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792867_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792865_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792861_LHBs_P-B      NWPDANKVGVGAFGPGFTPSHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792848_LHBs_P-B      NWPXXXKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792845_LHBs_P-B      PWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTIRQ
KC792842_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792838_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792772_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792727_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792720_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792719_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792709_LHBs_P-B      NWPDAKKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792698_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792689_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAXPPPASTNRQ
KC792663_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWXPQXQGXLTTXPAAPPPASTNRQ
KC792652_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGXLTTVPAAPPPASTNRQ
KC792651_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
JQ341586_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MK075117_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPASTNRQ
MG571371_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLFTTVPAAPPPASTNRQ
MG571370_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571325_LHBs_P-B      NWSDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MF674511_LHBs_P-B      TWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674509_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674506_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674480_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGIFTTVPAAPPPASTNRQ
MF674477_LHBs_P-B      TWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674462_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674455_LHBs_P-B      TWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674447_LHBs_P-B      TWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674426_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MF674405_LHBs_P-B      TWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674400_LHBs_P-B      TWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674383_LHBs_P-B      TWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
LC279273_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
LC279272_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
LC279271_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
LC279270_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
LC279269_LHBs_P-B      NWPDAHKVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
LC279268_LHBs_P-B      NWPDAHKVGVGAFRPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQ
KY881905_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGIITTVPATPPPASTNRQ
KY881903_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881902_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881894_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881846_LHBs_P-B      NWPDARKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KY881835_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881779_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881778_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881761_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881760_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881759_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881757_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881756_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881753_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881752_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881747_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881746_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881745_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881741_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881740_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881735_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881734_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881733_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881732_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881731_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881730_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881729_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881728_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881727_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881726_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881725_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881724_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881723_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881722_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881721_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KX276790_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276788_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KU964275_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964273_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964091_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLLTTVPAAPPPASTNRQ
KU964090_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLLTTVPAAPPPASTNRQ
KU964089_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLLTTVPAAPPPASTNRQ
KU964086_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLLTTVPAAPPPASTNRQ
KU964085_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLLTTVPAAPPPASTNRQ
KU964084_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLLTTVPAAPPPASTNRQ
KU964081_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLLTTVPAAPPPASTNRQ
KU964079_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLLTTVPAAPPPASTNRQ
KU963975_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLATVPAAPPPASTNRQ
KU963974_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLATVPAAPPPASTNRQ
KU963973_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLATVPAAPPPASTNRQ
KU963972_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLATVPAAPPPASTNRQ
KU963971_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLATVPAAPPPASTNRQ
KU963970_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLATVPAAPPPASTNRQ
KU963969_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLATVPAAPPPASTNRQ
KU963968_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLATVPAAPPPASTNRQ
KU963966_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLATVPAAPPPASTNRQ
KU963965_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLATVPAAPPPASTNRQ
KU963964_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLATVPAAPPPASTNRQ
KU963961_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLATVPAAPPPASTNRQ
KU963960_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLATVPAAPPPASTNRQ
KP406283_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406249_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406236_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KM213035_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ803801_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ717813_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ173412_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173411_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173402_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ173401_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ173368_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793148_LHBs_P-B      NWPDANNVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793147_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793131_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793125_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793047_LHBs_P-B      NWPNANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTMPAAPPPASTNRR
KC793034_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793004_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIXTTVPAAPPPASTNRQ
KC792990_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792987_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGXLGWSPQAQGILTTVPAAPPPASTNRX
KC792981_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLFTTVPAAPPPASTNRQ
KC792969_LHBs_P-B      NWPDANKVGVGAFGPGLIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRK
KC792933_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792909_LHBs_P-B      NWRDANKVGVGAFGPGFIPPHGGLLGWNPQAQGILTTVPAAPPPASTNRQ
KC792907_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLLTTVPVAPPPASTNRQ
KC792896_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792889_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPASTNRQ
KC792864_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792863_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792855_LHBs_P-B      NWTDTNKVGVGAFGPGFSPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792846_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792841_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792812_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGXLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792798_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792787_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792778_LHBs_P-B      NWPDXNKVGVGAFGPGXTPPHGGLMGWSPQAQGILTTVPAAPPPASTNRQ
KC792745_LHBs_P-B      NWPDANKVGVGAFGPGVTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792743_LHBs_P-B      TWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792717_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792694_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPATPPPASTNRQ
JQ341565_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQXQGLLTTVPAAPPPASTNRQ
JQ027312_LHBs_P-B      XWPDABKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571369_LHBs_P-B      NWPDAIKVGAGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571360_LHBs_P-B      NWPDAIKVGAGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571356_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MG571340_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571329_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674512_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674503_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674499_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674498_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674497_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674496_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674495_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674492_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674485_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674470_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MF674453_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674452_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674451_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674449_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MF674445_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTLPAAPPPASTNRQ
MF674433_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674431_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGMLGWSPQAQGILTTVPAAPPPASTNRQ
MF674427_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MF674424_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674423_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674421_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674413_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674410_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674401_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674397_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674395_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674393_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674384_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
LT992442_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHXGLLGWSPQAQGILTTVPAAPPPASTNRQ
KY881838_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAASPPASTNRQ
KX765856_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KX276808_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276799_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQXQGLLTTVPAAPPPASTNRQ
KX276791_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276778_LHBs_P-B      NWPDANKVGVGSFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KX276773_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILATVPAAPPPASTNRQ
KU964167_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964162_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU964136_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KU964134_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KU964133_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KU964132_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KU964131_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KU964130_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KU964129_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KU964128_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KU964127_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KU964126_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KU964125_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KU964124_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KU964123_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KU964092_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLLTTVPAAPPPASTNRQ
KU964088_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLLTTVPAAPPPASTNRQ
KU964087_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLLTTVPAAPPPASTNRQ
KU964083_LHBs_P-B      NWPDAIKVGVGAFGPGFTPPHGGLLGWNPQAQGLLTTVPAAPPPASTNRQ
KU964082_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLLTTVPAAPPPASTNRQ
KU964080_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWNPQAQGLLTTVPAAPPPASTNRQ
KU963855_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963841_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963840_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963839_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963838_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963837_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963836_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963834_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963832_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963831_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963830_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963829_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963828_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963813_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963812_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963811_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963810_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963809_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963808_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963807_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963806_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963805_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963804_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963803_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963802_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963801_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963800_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KU963799_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KR152339_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KP406279_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406254_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406251_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406250_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406248_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406247_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406244_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406239_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406166_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGGSPQAQGLLTTVPAAPPPASTNRR
KP148366_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148364_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148362_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148335_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148333_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148332_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148330_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148329_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148327_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148323_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KP148322_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTNVPAAPPPASTNRQ
KM875417_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KM875416_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ803764_LHBs_P-B      NWPEANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ717830_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ410517_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ410502_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173425_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173423_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173422_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173421_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173420_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173415_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173414_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173413_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173410_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173409_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173408_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173407_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173406_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173405_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173400_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173399_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173382_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173381_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173374_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KJ173367_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173365_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173360_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173359_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173354_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173352_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KJ173345_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KF053171_LHBs_P-B      NWPEANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793200_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793199_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793198_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793192_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSXQAQGLLTTVPVAPPPASTNRQ
KC793186_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWNPQAQGILTTVPAAPPPASTNRQ
KC793176_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793172_LHBs_P-B      NWPDABKVGVGAFGPGFIPPHGGLLGWNPQAQGIFTTVPAAPPPASTNRQ
KC793167_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793165_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILATVPAAPPPASTNRQ
KC793151_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793144_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793135_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793126_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793115_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793109_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTXRQ
KC793105_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793102_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793091_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793085_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793082_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILATVPAAPPPASTNRQ
KC793077_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793067_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793065_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQXQGLLTTVPAAPPPASTNRQ
KC793062_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793048_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793032_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793010_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793007_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793002_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792994_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792993_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792991_LHBs_P-B      NWPDANKVXVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792988_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792984_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792977_LHBs_P-B      NWPDANKVGXGAFGPGFIPPHGGXLGWSPQAQGILTTVPAAPPPASTNRQ
KC792974_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792972_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792971_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792957_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792952_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792932_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGWSPQAQGILTTMPAAPPPASTNRQ
KC792920_LHBs_P-B      XWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792899_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792895_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792874_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792872_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792856_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792828_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792824_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792823_LHBs_P-B      NWPDANKVGVGAFGPGFXPPHGGLLGWSPQAQGILTTVPAAPPPASTNRX
KC792814_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792796_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGXLGWSPQAQGILTTVPAAPPPASTNRQ
KC792784_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792763_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILXTVPAAPPPASTNRQ
KC792756_LHBs_P-B      NWXDANKVGAGAFGPGFTPPHGGLLGWNPQAQGLLTTVPAAPPPASTNRQ
KC792747_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792731_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792705_LHBs_P-B      NWPDANKVGXGAFGPGXTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792702_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KC792701_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792696_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792686_LHBs_P-B      NWPDANKVGVGAFGPGFXPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792685_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792659_LHBs_P-B      NWQDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
HM011478_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571350_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MG571326_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
MF674406_LHBs_P-B      YWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KX276811_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276810_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276806_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276787_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGXLTTVPXAPPPASTNRQ
KX276771_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGMLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406271_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406269_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406243_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406242_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406241_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406235_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406234_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406233_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406232_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406231_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406230_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406229_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406228_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406227_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406226_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406225_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406224_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406223_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406222_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406221_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406220_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406173_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQTQGLLTTVPAAPPPASTNRQ
KP406172_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWIPQAQGQLTTVPAAPPPASTNRQ
KJ803763_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KF053192_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793188_LHBs_P-B      NWPDANKVGVGAFGPGFXPPHGGLLGWSPQXQGMLTTVPAAPPPASTNRQ
KC793166_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793116_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPAXTNRQ
KC793095_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPASTNRQ
KC793055_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793041_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLXTVPAAPPPASTNRQ
KC793022_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPVSTNRQ
KC793018_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793008_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLXGWSPQAQGLLTTVPAAPPPASTNRQ
KC792982_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792978_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792955_LHBs_P-B      NXPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRX
KC792917_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792912_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792877_LHBs_P-B      NWPDANKVGVGAFGPGXTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRX
KC792866_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792858_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792835_LHBs_P-B      NWXDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792822_LHBs_P-B      NWPNANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792819_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792800_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792774_LHBs_P-B      NWPDAWKVGVGAFGPGFVPPHGGLLGWSPQAQGTLTTVPAAPPPASTNRQ
KC792728_LHBs_P-B      NWPVANKVGVGAFGPGFTPPHGGLLGWSPQALGLLTTAPAAPPPASTNRK
KC792714_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MK818223_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
MF674510_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KX276805_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793189_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGMLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793170_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793161_LHBs_P-B      NWPDAXXVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793130_LHBs_P-B      NWPDANKVGVGAFGPGFTPSHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793127_LHBs_P-B      NWPDANKVGXGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793113_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRX
KC792905_LHBs_P-B      NWPDTNKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTTRQ
KC792870_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTXRQ
KC792859_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTAVPAAPPPASTNRQ
KC792852_LHBs_P-B      NWPDXNKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792811_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAVPPPASTNRX
KC792726_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792721_LHBs_P-B      NXPBXXKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTLPAAPPPASTNRQ
KC793158_LHBs_P-B      NWPDANKVGXGAFGPGFVPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793157_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793143_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793140_LHBs_P-B      NWPDANKVGVGAFGPGFTPSHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793138_LHBs_P-B      NWPDXNKVGVGAFGXGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793137_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793132_LHBs_P-B      NWPDANKVGVGXFGPGFXPPHGGLLGWSPQAQGXLTTVPAAPPPASTNRQ
KC793075_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTMPAAPPPASTNRQ
KC793052_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793017_LHBs_P-B      XWPDANKVGVGAFGPGFTPPHGGLLGXSPQXQGLLTTVPAAPPPASTNRQ
KC792942_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792904_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGXLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792871_LHBs_P-B      NWPDATKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTIVPAAPPPASTNRQ
KC792829_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792795_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792773_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792768_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792725_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792723_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTMPAAPPPASTNRQ
KX276794_LHBs_P-B      NWPDANXVGVGAFGXGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KP406167_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGQLPTVPAAPPPASTNRQ
KC793087_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793042_LHBs_P-B      NWPDANKVGVGAFGPGFVPPHGGLLGWSPLAQGILTTVPAAPPPASTNRQ
KC792976_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGXLGWSPQAQGILTXVPAAPPPASTNRQ
KC792760_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792758_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792738_LHBs_P-B      XWPDANKVGVGAFGPGFIPPHGGLLGWNPQAQGILTTVPAAPPPASTNRQ
KC792730_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792684_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KX276797_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILATVPAAPPPASTNRQ
KC792885_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792840_LHBs_P-B      NWPDABKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC792808_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAXGILTTVPAAPPPASTNRQ
KC792777_LHBs_P-B      NWPEANKVGVGAFGPGFTPPHGGLLGWSPQALGILTXVPAAPPPASTNRQ
KC793173_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC793120_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPASTNRQ
KC793118_LHBs_P-B      NWPXANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
KC792761_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTXRQ
KC792718_LHBs_P-B      NWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPVAPPPASTNRQ
KC792683_LHBs_P-B      NWPDXNKVGVGAFGPGFIPPHGGLLGWSPQAQGIXTTVPAAPPPASTNRQ
KC793044_LHBs_P-B      NWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQ
                                                                   .     

JQ429081_LHBs_P-B      LG-RKPTPLSPPLKDTHPQAVQWNSTTFHQTLQIDPRVRALYLPAGGSSS
KX276774_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ801507_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KC793079_LHBs_P-B      SG-RXPTPXSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KC792688_LHBs_P-B      SGRRQPTPXSPPLRDTXXQTMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
EF494382_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMTFHQ-----TLQ-DPRVRALYFPAGGSSS
KC792693_LHBs_P-B      SG-RQPTPLXPPLRDTHPQAMQWNSTTXXXTLQ-BPRV-----PAGGSSS
EU882003_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHKTLQ-DPRVRALYFPAGGSSS
AB302095_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAVKWNSTTFHQTLQ-DPRVRALYLPAGGSSS
KJ717831_LHBs_P-B      SG-RQPTPISPPLRDSHPQAVQWNSTTFHQALL-DPRVRALYFPAGGSSS
KJ803817_LHBs_P-B      SG-RQPTPISPPLRDSHPQAVQWNSTTFHQALL-DPRVRALYFPAGGSSS
EU939633_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAVKWNSTTFHQTLQ-DPKVRALYFPAGGSSS
EU939634_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAVKWNSTTFHQTLQ-DPKVRALYFPAGGSSS
AB073844_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB900107_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB900112_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU487256_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFLQTLQ-DPRVRALYFPAGGSSS
AB014366_LHBs_P-B      SG-RQPTPLSPPLRDTHPQIMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AB073838_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB073856_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AB246343_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTIFHQTLQ-DPRVRALYFPAGGSSS
AB106884_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AB010290_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAVQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AB073854_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
EU439023_LHBs_P-B      SG-RQPTPISPPLRDTHPQAMQWNSTTFHQTPQ-DPRVRALYFPAGGSSS
DQ993702_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMEWNSTTFHQTLQ-DPKVRALYFPAGGSSS
AF121250_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB073858_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
FJ899787_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
EU522072_LHBs_P-B      SG-RQPTPLSPPLRNTHPQIMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AY206375_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AY596104_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AY206390_LHBs_P-B      SG-RQPTPLSPPLRETHPQAMQWNSTTFHQTLQ-DPKVRALYFPAGGSSS
FJ032349_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AY220697_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAIQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB073828_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ993697_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU451682_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
D50521_LHBs_P-B        SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
D50522_LHBs_P-B        SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
GU815642_LHBs_P-B      SG-RQPTPLSPTLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU434372_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB900098_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGFSS
EU939672_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
FJ899785_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
FJ899786_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
FJ899784_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
GU815620_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815621_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815617_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHKTLQ-DPRVRALYFPAGGSSS
GU815622_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHKTLQ-DPRVRALYFPAGGSSS
FJ562322_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU939637_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
DQ993687_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ904357_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AY596106_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU919173_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAIQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
FJ518812_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AY220698_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU158262_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPKVRALYFPAGGSSS
EU919172_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSPTFHQTLQ-DPKVRALYFPAGGSSS
FJ032352_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
FJ032353_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
FJ032354_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AY800389_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AY220703_LHBs_P-B      SG-RQPTPLSPPLRETHPQAMKWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AY220704_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMKWNSTTFHQTLQ-DPRVRALYLPAGGSSS
GU815710_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815625_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ377561_LHBs_P-B      SG-RQPTPVSPPLRDTHPQAMQWNSNTFHQTLQ-DPRVRALYFPAGGSSS
FJ562259_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHLTLQ-DPRVRALYFPAGGSSS
EU439022_LHBs_P-B      SG-RQPTPISPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU439020_LHBs_P-B      SG-RQPTPISPPLRDTHPQAMQWNSTAFHQTLQ-DPRVRALYFPAGGSSS
EF473973_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ993700_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB246340_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815627_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815628_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815629_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815630_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815631_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815635_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815636_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815637_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815638_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815641_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815643_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815644_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815645_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ993701_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JN827419_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
FJ386675_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
GU332695_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
EU439018_LHBs_P-B      SG-RQPTPISPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU939636_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
FJ386658_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ377566_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ377568_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ377582_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ377610_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU434373_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU939666_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DLRVRALYLPAGGSSS
EU939665_LHBs_P-B      PG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
EU919175_LHBs_P-B      SG-RQPTPLSPPIRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
EU919176_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AY163869_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHKTLQ-DPRVRALYLPAGGSSS
AY163870_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHKTLQ-DPRVRALYLPAGGSSS
EU939559_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
FJ562240_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AY217357_LHBs_P-B      SG-RQPTPLSPPLRETHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AY217358_LHBs_P-B      SG-RQPTPLSPPLRETHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU796066_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU939673_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
FJ562296_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815707_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815706_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ377567_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ475340_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
FJ562219_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
FJ562236_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815701_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GU815702_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AY800391_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AY800392_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
HM011487_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KJ717840_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMRWNSTTFHQTLL-DPRVRALYFPAGGSSS
KJ803824_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMRWNSTTFHQTLL-DPRVRALYFPAGGSSS
GQ924617_LHBs_P-B      LG-RKPTPLSPPLRDSHPQAMQWNSAKFHQTLQ-DTRVRALYFPAGGSSS
AB713528_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSPKFHQTLQ-DPRVRALYFPAGGSSS
JN604141_LHBs_P-B      VA-RPPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
HM011496_LHBs_P-B      VG-RPPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
HM011492_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KX276962_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EF473972_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KX276970_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KX276830_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMRWNSPTFHQTLQ-DPRVRALYFPAGGSSS
KP148420_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMHWNSTKFQRTLQ-DPRVRALYFPAGGSSS
KP148391_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
LC349875_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KX276825_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ341607_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAXQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KX765854_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFLQTLQ-DPRVRALYFPAGGSSS
KP148439_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMHWNSTKFQQTLQ-DPRVRALYFPAGGSSS
KP148432_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMHWNSTKFHQTLQ-DPRVRALYFPAGGSSS
KP148424_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMHWNSTKFHQTLQ-DPRVRALYFPAGGSSS
KP148418_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMHWNSTKFHQTLQ-DPRVRALYFPAGGSSS
KP148398_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGPSS
KP148387_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGPSS
KP148373_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
HQ700548_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTXFHQTLQ-DSRVRALYFPAGGSSS
KP148367_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ341590_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
HQ700549_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KJ803787_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
LC349873_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
LC349872_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTKFHQTLQ-DPRVRALYFPAGGSSS
KP148403_LHBs_P-B      LG-RQPTSLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148401_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148399_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148394_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148386_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148385_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148382_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148378_LHBs_P-B      LG-RQPTPLSPPLGDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148377_LHBs_P-B      LG-RPPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148374_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148368_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KC774418_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148451_LHBs_P-B      LG-RQPTPLFPPLRGTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148369_LHBs_P-B      LG-RQPTPLFPPLRGTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ429082_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
KP148380_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148376_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
M54923_LHBs_P-B        LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148397_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148396_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148395_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148392_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148390_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148389_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148388_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148384_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148383_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148379_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148375_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148372_LHBs_P-B      LR-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148371_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148370_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ027311_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KX276815_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
HM011469_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KX276822_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JN792901_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAVQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JN792902_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAVQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KJ717843_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLL-DPRVRALYFPAGGSSS
KJ803825_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLL-DPRVRALYFPAGGSSS
GQ358144_LHBs_P-B      VG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSRS
KP148458_LHBs_P-B      VG-RQPTPLSQPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148455_LHBs_P-B      VG-RQPTPLSQPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148456_LHBs_P-B      VG-RQPTPLSQPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148459_LHBs_P-B      VG-RQPTPLSQPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148461_LHBs_P-B      VG-RQPTPLSQPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KP148452_LHBs_P-B      VG-RQPTPLSQPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB493833_LHBs_P-B      LG-RKPTPLSPPLRDTHPQTMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AB287325_LHBs_P-B      VG-RLPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB287320_LHBs_P-B      VG-RRPTPISPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB287316_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
GQ924638_LHBs_P-B      VG-RKPTPLSPPLRDTHPQAMQWNSTTFLLTLQ-DHRVRDLYFPAGGSSS
GQ924639_LHBs_P-B      VG-RKPTPLSPPLRDTHPQAMQWNSTTFLQTLQ-DPRVRALYFPAGGSSS
KF053191_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
KJ803786_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ924621_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EF473976_LHBs_P-B      LG-RKPTPLSPPLKDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ463801_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAVQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JN792893_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAVQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ463793_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAVQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JN792894_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAVQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU330994_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AP011095_LHBs_P-B      LG-RQPTPLSPPLRDSHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB241117_LHBs_P-B      VA-RPPTPLSPPLRDTHPQATQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB219426_LHBs_P-B      VA-RPPTPLSPPLRDTHPQAMRWNSPTFHQTLQ-DPRVRALYFPAGGSSS
AB287314_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AB287315_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
GQ924637_LHBs_P-B      VG-RKPTPLTPPLRDTHPLAMQWNSTKFHQTLQ-DPRVRALYFPAGGSSS
DQ463789_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB287319_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ463797_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JN792895_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ463791_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ463798_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JN792899_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JN792896_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ463802_LHBs_P-B      VG-RQPTPLSPPLRDSHPQAMQWNSTTFHQTLQ-DSTVRTLNLPAGGSSS
DQ463796_LHBs_P-B      VG-RQPTPISPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AB287317_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB287322_LHBs_P-B      VG-RLPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ463788_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JN792900_LHBs_P-B      VG-RQPTPLSPPIRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JN792898_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JN792897_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ463800_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ463799_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ463790_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
DQ463792_LHBs_P-B      VG-RQPTPISPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AP011096_LHBs_P-B      LG-RQPTPLSPPLRDSHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ358148_LHBs_P-B      LG-RHPTPLSPPLRDSHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ358149_LHBs_P-B      LG-RQPTPLSPPLRDSHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ358152_LHBs_P-B      LG-RQPTPLSPPLRDSHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ358150_LHBs_P-B      LG-RQPTPLSPPLRDSHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ358151_LHBs_P-B      LG-RQPTPLSPPLRDSHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ358147_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB713529_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQNLQ-DPRVRALYFPAGGSSS
AB493827_LHBs_P-B      VG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB033554_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
D00331_LHBs_C-B        LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU330989_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU330990_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
FJ023637_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU330998_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU330999_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
FJ023638_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU331000_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU331001_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU330995_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU330996_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU330997_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ924624_LHBs_P-B      VA-RPPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ358146_LHBs_P-B      LG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSGS
EF473977_LHBs_P-B      VG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB713527_LHBs_P-B      VG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB033555_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ358143_LHBs_P-B      VG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ358140_LHBs_P-B      VG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ358142_LHBs_P-B      VG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AP011088_LHBs_P-B      VG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ358145_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AP011086_LHBs_P-B      VG-RPPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB219428_LHBs_C-B      VA-RPPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AP011087_LHBs_P-B      VG-RPPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ924651_LHBs_P-B      VG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ924654_LHBs_P-B      VG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB976562_LHBs_P-B      VG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB219427_LHBs_P-B      VA-RPPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB219429_LHBs_P-B      VA-RPPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ924625_LHBs_P-B      VG-RKPTPLSPPLRDTHPQAIQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AP011089_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB219430_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ924628_LHBs_P-B      VG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ358137_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB493835_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AP011085_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AP011090_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AP011091_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AP011092_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EF473971_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ924640_LHBs_P-B      LG-RPPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ358141_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ358136_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ358138_LHBs_P-B      LG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB642101_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMRWNSITFHQTLQ-DPKVRALYFPAGGSSS
KJ717806_LHBs_P-B      LG-RQPTPISPPLRDSHPQAMQWNSTTVHQAML-DPRVRALYFPAGGSSS
KJ803795_LHBs_P-B      LG-RQPTPISPPLRDSHPQAMQWNSTTVHQAML-DPRVRALYFPAGGSSS
FJ032342_LHBs_P-B      LG-RQPTPVTPPLRDTHPQATQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707734_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707735_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707737_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707738_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707742_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707743_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707744_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707745_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707746_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707747_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707749_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707750_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707753_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707758_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707759_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707763_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707764_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707765_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707766_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JQ707767_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB555499_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHHSPH-GPRVRALYFPAGGSSS
DQ463787_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ463795_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
JN604130_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNTTTFHQTLQ-DPRVRALYFPAGGSSS
EU939670_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAVQWNSTTFHQTLQ-DPRVRALYIPAGGSSS
DQ993696_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ924645_LHBs_P-B      VA-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU939635_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ995804_LHBs_P-B      SG-RQPTPLSPPLRDTHPQATQWNSTKFHQTLQ-DPRVRALYIPAGGSSS
AP011094_LHBs_P-B      LG-RQPTPLSPPLRDSHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AB073851_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
JF436921_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAIQWNYTTFHQTLQ-DPKVRALYFPAGGSSS
DQ995802_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AY206373_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAVQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB300371_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
EU939674_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
FJ899790_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
FJ899791_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
JN604123_LHBs_P-B      VG-RKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ993684_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AY206383_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHHTLQ-DPRVRALYFPAGGSSS
AB073823_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPKVRALYFPAGGSSS
KC792671_LHBs_P-B      SG-RQPTPISPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
GQ924656_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ924641_LHBs_P-B      VG-RKPTPISPPLRDTHPQAVKWNSPTFHQTLQ-DPRVRALYLPAGGSSS
GQ377644_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
GQ377622_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSNTFHQTLQ-DPRVRALYFPAGGSSS
FJ386600_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
EU570075_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAIQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
EF494381_LHBs_P-B      SG-RQPTPVSPPLRETHPQVIQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB900096_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AB287318_LHBs_P-B      VG-RQPTPLSPPLRDTHPQAIQWNSPTFHQTLQ-HPRVRALYFPAGGSSS
AB073847_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
HM011476_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAMQWNSTTFHQTIQ-DPRVRALYFPAGGSSS
GQ377606_LHBs_P-B      SG-RQPTPLTPPLRDTHPQAIQRNSTTFHQTLQ-DPRVRALYFPAGGSSS
FJ787477_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AY167100_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMHWNSTTFHQTLQ-DPRVRALYLPAGGSSS
AB287323_LHBs_P-B      VG-RLPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB073853_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AB117759_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
DQ993686_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ-DPRVRALYFPAGGSSS
AY217355_LHBs_P-B      SG-RQPTPLSPPLRDTHPQVMQWNSPTFHQTLQ-DPRVRALYFPAGGSSS
AY217356_LHBs_P-B      SG-RQPTPLSPPLRDTHPQAMQWNSPTFHQTLQ-DPRVRALYFPAGG