HBVdb

Dataset for protein MHBs of genotype B

[Download (right click)] [Edit] [Sequences] [Repertoires]

2753 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


JQ429081_MHBs_P-B      VQWNSTTFHQTLQIDPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKT
KU964272_MHBs_P-B      -QWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964273_MHBs_P-B      -QWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964274_MHBs_P-B      -QWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964275_MHBs_P-B      -QWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964276_MHBs_P-B      -QWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964277_MHBs_P-B      -QWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964278_MHBs_P-B      -QWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964279_MHBs_P-B      -QWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964281_MHBs_P-B      -QWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964284_MHBs_P-B      -QWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964285_MHBs_P-B      -QWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964280_MHBs_P-B      -QWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964283_MHBs_P-B      -QWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964286_MHBs_P-B      -QWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
EU660232_MHBs_P-B      VRWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSISSKT
EU660233_MHBs_P-B      VRWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSISSKT
EU882003_MHBs_P-B      MQWNSTTFHKTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB048705_MHBs_P-B      MQWNSTAFHQALQ-DPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTKT
DQ993696_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB287323_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQSTASAISSTLSTT
KJ717801_MHBs_P-B      MQWNSTTFHQALL-DPRVRGLYFPAGGSSSGIVSPAQNTVSAISSILSKT
AB900095_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU939667_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQSTVSTISSILSKT
DQ463797_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
JN792895_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
AB073853_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSIFSKT
AB900096_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPAQTTVSAISSISSKT
JQ040157_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ032358_MHBs_P-B      MRWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB287327_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSNSSTT
EF494380_MHBs_P-B      MQWSSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ141631_MHBs_P-B      VQWNSTTFHKTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASPISSILSKT
MG571338_MHBs_P-B      IQWNSTTFQQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
X97850_MHBs_P-B        MQWNSTTFLQTLQ-DSRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KC793181_MHBs_P-B      MQWNSTTVHQTLQ-DPRDRALSLPAGGSSSGTVSPAQNTVSVISSILSKT
JN792897_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSILPKT
KC793188_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALDFPAGGSSSGKVSPAQNTVSXISSISSXT
JN604187_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562253_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
DQ993702_MHBs_P-B      MEWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB073824_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964265_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSTLSKT
KU964267_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSTLSKT
KU964271_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSTLSKT
JQ027315_MHBs_P-B      TQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY220698_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964257_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406251_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRTLYFPAGGSSSGTVSPAQNTVSAISSILSKT
JN827419_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ032353_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
AY220697_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG826153_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
KX276815_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
JQ341597_MHBs_P-B      MXWNSTXFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
JQ341599_MHBs_P-B      MXWNSTXFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
EU939675_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU939663_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
AB010290_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
MF674492_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYVPAGGSSSGTVSPAQNTASAISSTFSKT
KP406254_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406253_MHBs_P-B      MQWNSTTVHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406252_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406249_MHBs_P-B      MQWNSTTVHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406248_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406246_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406245_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406244_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ803820_MHBs_P-B      MRWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ717836_MHBs_P-B      MRWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JN604224_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
HM011503_MHBs_P-B      MXWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKT
FJ899791_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPAQNTVSAISSILSKT
FJ899790_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPAQNTVSAISSILSKT
EU939674_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPAQNTVSAISSILSKT
DQ993701_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY629635_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964268_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964266_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964264_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964263_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964262_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964261_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964260_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP659253_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
KP406250_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406161_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KJ803808_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ717820_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793182_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNSASAISSILSKT
JQ040128_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881904_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881824_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276827_MHBs_P-B      MQWNSTXFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KU964146_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFTAGGSSSGTVSPAQNTVSAISSTLSTT
KP406332_MHBs_P-B      MQWNSTTFHQTLQ-DPRARALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KJ803817_MHBs_P-B      VQWNSTTFHQALL-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ803775_MHBs_P-B      EQWNSTTFHQTLQ-DPRVRALNLPAGGSSSGTVSPAQNTVSAISSILSKT
KJ717831_MHBs_P-B      VQWNSTTFHQALL-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KF053182_MHBs_P-B      EQWNSTTFHQTLQ-DPRVRALNLPAGGSSSGTVSPAQNTVSAISSILSKT
KC793118_MHBs_P-B      XXWNSTTFXQTLQ-DPRVRTLYXPAGGSSSGTVSPAQNTVSXXSSXLSXT
KC792684_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKT
AB642093_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTVSAISSILSKT
AB010291_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
MG826152_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
MF674464_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQITASATSSTFSTT
KY881827_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY417926_MHBs_P-B      MQWNSTTFHQPLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSTT
KX276830_MHBs_P-B      MRWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSTLSKT
KX276791_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964270_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964269_MHBs_P-B      MQWNSITFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964259_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964256_MHBs_P-B      MQWNSATFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVFAISSILSKT
KU964255_MHBs_P-B      MQWNSATFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVFAISSILSKT
KU964248_MHBs_P-B      MQWNSATFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVFAISSILSKT
KU963854_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963827_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963826_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963825_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963824_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963823_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963822_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963821_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963820_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963819_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963818_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963817_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963815_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963814_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148349_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148343_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148342_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148340_MHBs_P-B      MQWNATTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KM875416_MHBs_P-B      MQWNSTTFHQNLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ843165_MHBs_P-B      VQWNSRTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KJ803773_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRAPNLPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173378_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KJ173376_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPVQNTVSAISSILSKT
KJ173375_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPVQNTVSAISSILSKT
KF053180_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRAPNLPAGGSSSGTVSPAQNTVSAISSILSKT
KC793189_MHBs_P-B      MQWNSTTFLQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSIXSXT
KC793077_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793032_MHBs_P-B      XXWNSTTFHQTLQ-DPXVRALYFPAGGSSSGTVSPAQXTVSAVSSILSTT
X98077_MHBs_P-B        MKWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
MG571352_MHBs_P-B      MQGNATTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSVISSTLSTT
MF674461_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTFSKT
MF674422_MHBs_P-B      MRWNSTTFHQTLQ-DPRIRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
LT992442_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSILSKT
KY881833_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSILSTT
KX276829_MHBs_P-B      MXWNSTXFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KU964141_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTT
KP659238_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
KP406243_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406242_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406241_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406240_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406238_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406236_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSRTVSPAQNTVSAISSILSKT
KP406235_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406234_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406233_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406232_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406231_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406230_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406229_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406228_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406227_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406226_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406225_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406224_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406223_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406222_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406221_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406220_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406165_MHBs_P-B      MKWNSPTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406163_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP148348_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ717797_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAKSSILSKT
KJ173402_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173401_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173368_MHBs_P-B      MQWNSTTFHQALL-DPRVRALYFPAGGSSSGTVTPAQNTVSAISSILSKT
KJ173360_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793126_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JN604311_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
HM011483_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571337_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MF674383_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTFSKT
KY881868_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSISGTVSPAQNTVSAISSILSKT
KY881867_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
KY881866_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881848_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KX276817_MHBs_P-B      VQWNXTTFHQTLQ-DPXXRALYLPAGGSSSGTVNPVQSTASSISSILSKT
KX276771_MHBs_P-B      MQWNSTTXHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILPKT
KP659251_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
KP406335_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406334_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406333_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYIPAGGSSSGTVSPAQNTVSAISSISSKT
KP406331_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406330_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406322_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406321_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406320_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406319_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406318_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406219_MHBs_P-B      VQWNFTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406217_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTN
KP406214_MHBs_P-B      VQWNFTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406210_MHBs_P-B      VQWNFTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406208_MHBs_P-B      VQWNFTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406203_MHBs_P-B      VQWNFTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406200_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTN
KP406199_MHBs_P-B      VQWNFTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406197_MHBs_P-B      VQWNFTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406195_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTN
KP406192_MHBs_P-B      VQWNFTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406189_MHBs_P-B      VQWNFTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406188_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTN
KP406187_MHBs_P-B      VQWNFTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP148581_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ803825_MHBs_P-B      MQWNSTTFHQTLL-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ803816_MHBs_P-B      MQWNSTTFHQALL-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSTT
KJ717843_MHBs_P-B      MQWNSTTFHQTLL-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ717829_MHBs_P-B      MQWNSTTFHQALL-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSTT
KC793194_MHBs_P-B      MQWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KC793163_MHBs_P-B      MQWNSTTFHHTLQ-DPRVRALYFPAGGSSSGTVSPAQTTVSAISSILSTT
KC793151_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALXFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793124_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLSAGGSSSGTVSPAQNTVSAISSILSKT
MG571364_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571362_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571360_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571355_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571349_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571333_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
MF674512_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MF674404_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSIFSKT
KY881838_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KY881800_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881785_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY470962_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRPLYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY470954_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276800_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276788_MHBs_P-B      MQWNSTTFHQTLQ-DPRIRALYFPAGGSSSGTVSPAQNTVSAISSISSTT
KU964293_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964167_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964162_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964155_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964120_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963979_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963968_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963963_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963962_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963955_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KU963948_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KT749820_MHBs_P-B      VQRNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSISSKT
KP148582_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148579_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148361_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148347_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148346_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148345_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148344_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148341_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148339_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148338_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148336_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148325_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148324_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148322_MHBs_P-B      MQWNTNTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KM875421_MHBs_P-B      MQWNSTTFQQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KM875420_MHBs_P-B      MQWNSTTFQQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KM875417_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KM392084_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KM213036_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KM213035_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSDISSILSTT
KJ717842_MHBs_P-B      MQGNSTTFHQTLL-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ717830_MHBs_P-B      MQWNSTTFHQALL-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173404_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173390_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173389_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173388_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173387_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173366_MHBs_P-B      MQWNSTTFHQTLQ-GPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173365_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173362_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPVGGSSSGTVSPAQNTVSAISSILSKT
KJ173361_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPVGGSSSGTVSPAQNTVSAISSILSKT
KJ173357_MHBs_P-B      MQWNSTTFHQVLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173356_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173355_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173353_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173341_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAPNTVSAISSILSKT
KC793185_MHBs_P-B      XQWNSTTFHQTLQ-DXRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KC793091_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793086_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRDLYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341567_MHBs_P-B      MXXNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571361_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
MG571326_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MF674465_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
MF674426_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881839_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881830_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276796_MHBs_P-B      MQWNSTTFHQTLQ-DPKXRALYIPAGGSSSGTVSPAQNTVSAISSILSTT
KU963977_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963976_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963970_MHBs_P-B      MRWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406237_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP148314_MHBs_P-B      VRWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ803801_MHBs_P-B      MQWNSTTFHQTLL-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ803756_MHBs_P-B      MRWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KJ717813_MHBs_P-B      MQWNSTTFHQTLL-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KF053163_MHBs_P-B      MRWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC793190_MHBs_P-B      MKWNSTTFHQTLQ-DPKVRALYFPVGGSSSGTVSPAQNTVSAISSILSKT
KC793154_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAXNTVSAISSTLSKT
KC793145_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793134_MHBs_P-B      XXWNSITFHQTLX-GPTVGALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KC793083_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881796_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964123_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP659249_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
KP406218_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406215_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406213_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406211_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406209_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406207_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406206_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406205_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406204_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406202_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406201_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406198_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406196_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406193_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406191_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406186_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406185_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406184_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406183_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406181_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406180_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406178_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406177_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406176_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KM875427_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KM875426_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ803821_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KJ717837_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KJ173374_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793197_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNLAQNTVSAISSISSKT
KC793191_MHBs_P-B      MQWNSNTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793172_MHBs_P-B      IXWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
HM011477_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
X97851_MHBs_P-B        MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVYAISSILSKT
MK075117_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MH932712_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MH663473_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MH061283_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571374_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571373_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571371_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571369_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571368_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571367_MHBs_P-B      MQWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571365_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571356_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571354_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571350_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSXTVSPAQNTVSAISSILSKT
MG571347_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571346_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
MG571344_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
MG571342_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571340_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571328_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571322_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MF674485_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MF674450_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MF674449_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MF674427_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MF674391_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881779_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881778_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881761_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881760_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881759_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881757_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881756_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881753_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881752_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881747_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881746_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881745_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881741_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881740_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881735_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881734_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881733_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881732_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881731_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881730_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881729_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881728_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881727_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881726_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881725_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881724_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881723_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881722_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY881721_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KY470961_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY470960_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY470956_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY470953_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX765856_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276812_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276809_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSILSKT
KX276803_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276801_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276793_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276773_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964302_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964301_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964300_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964299_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964298_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964297_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964296_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964295_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964294_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964292_MHBs_P-B      MQWNSTTFHQTLQ-NPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964291_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964290_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964289_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964288_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964287_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964164_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964092_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964091_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964090_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964089_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964088_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964087_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964086_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964085_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964084_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964083_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964081_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964079_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963989_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963988_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963986_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963985_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963984_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963983_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963982_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963981_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963978_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963975_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963974_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963973_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963972_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963971_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963969_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963967_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963966_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963965_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963964_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963961_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963960_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963959_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963958_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963957_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963956_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963954_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963953_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963952_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963951_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963950_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963949_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963947_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963945_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963855_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963853_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963852_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963851_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963850_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963849_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963848_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963847_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963846_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963845_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963844_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963843_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963842_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963841_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963840_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963839_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963838_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963837_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963836_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963835_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963834_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963833_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963832_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963831_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963830_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963829_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963828_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963816_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963813_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963812_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963811_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963810_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963809_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963808_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963807_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963806_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963805_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963804_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963803_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963802_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963801_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963800_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963799_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406216_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406212_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSATSSISSTT
KP406194_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
KP406190_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSATSSISSTT
KP406182_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSATSSISSTT
KP406179_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSATSSISSTT
KP148366_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148365_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
KP148364_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148363_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148362_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148360_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148359_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148357_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISPISSKT
KP148356_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148335_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148334_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSILSKT
KP148333_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148332_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148331_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148329_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148328_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148327_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148326_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSILSKT
KP148323_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148321_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148320_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148319_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148318_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148317_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KM392083_MHBs_P-B      MQWNSSTFHQTIQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KM392072_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGASSSGTVSPAQNTVSAISSILSKT
KM359440_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ803764_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ803752_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ410517_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ410516_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAPNTVSAISSILSKT
KJ410507_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAPNTVSAISSILSKT
KJ410502_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ410500_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ410490_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173425_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173424_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173421_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173420_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173419_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173418_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173417_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173416_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173415_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173414_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173413_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173412_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173411_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173410_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173409_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173408_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173407_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173406_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173405_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173403_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173400_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173399_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173398_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173397_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173382_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173381_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173369_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173367_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173364_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173363_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173359_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173354_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173352_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173351_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173348_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173347_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173345_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173343_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173340_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173339_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KF053171_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793186_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793183_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793179_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793178_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793176_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793173_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSXX
KC793168_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793167_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793165_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793147_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793146_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC793144_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793135_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793131_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793125_MHBs_P-B      XXWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSXT
KC793121_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793117_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
KC793113_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKT
KC793105_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793102_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793101_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793096_MHBs_P-B      MQRNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793090_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSIXSKT
KC793089_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793085_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793084_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793082_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MK818223_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571351_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276804_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793116_MHBs_P-B      MXWNXTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTXSSXLXTT
KC793080_MHBs_P-B      MQWNSTTFHQTLQ-BPRVRALYFPAGGSSSETVSPAQNTVSAISSILXTT
KC792939_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276808_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276806_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793180_MHBs_P-B      IQXNSTTFHQTLQ-DPRVRXLYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793175_MHBs_P-B      XQWNSTTFHQTLQ-DPRVRALXFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793152_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793128_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSRTVSPAQNTVSAISSILSKT
KC793127_MHBs_P-B      MQWNSXTFHQTLQ-XPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
MG571358_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
MG571357_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
MG571341_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYIPAGGSSSGTVSPAQNTVSAISSILSKT
KX276811_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSTT
KX276777_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963987_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KM875418_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793140_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSKT
KC793114_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC793095_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALXLPAGGSSSGTVSPAQNTVSAXSSIXSKT
KC793087_MHBs_P-B      MXWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSXT
KC793081_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVNPAQNTVSAISSILSKT
KX276799_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276792_MHBs_P-B      MRWNXTTFHQTLQ-DPRVRALXFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276786_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKT
KC793164_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC793139_MHBs_P-B      MQWNSTTFHQTLX-DPRVRALYLPAGGSXSRTVSPAQNTVSAISSILSKX
KC793136_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQXTVSAISSILSKT
KC793111_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC793088_MHBs_P-B      MQWNSTTFHQTLQ-DPXVRALXXTAGGSSSGTVSPAQNTVFTISSILSKT
KX276797_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276795_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276794_MHBs_P-B      MXWNSTTFHKTLQ-DPRVRALYXPAGGSSSXTVSPAQNTVSAISSILSXT
KC793192_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276802_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276790_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276798_MHBs_P-B      XQWNSTTFHQTLQ-DPXVRALXFPAGGSSSGTVSPAQNTVSAISSILSXT
KC793148_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793075_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793161_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRAXYFPAGGSSSGTVSPAQNTVSAXSSILSKT
KP406323_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406324_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406325_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406326_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406327_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406328_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406329_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ463791_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQITASSISSILPKT
JN604130_MHBs_P-B      MQWNTTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ141654_MHBs_P-B      VQWNSTKFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASPISSILSKT
DQ141621_MHBs_P-B      VQWNSTTFHQTFQ-DPRVRGLYFPVGGSSSGTVSPAQNTVSAISSILSTT
DQ141641_MHBs_P-B      VKWNSPTFHQTLQ-DPRVKALYFPAGGSSSGIVNPVQNTASSISSISSKT
KJ717840_MHBs_P-B      MRWNSTTFHQTLL-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KJ803824_MHBs_P-B      MRWNSTTFHQTLL-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
FJ562260_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSPXSSTLSTT
KJ717835_MHBs_P-B      MQWNSTKFHQALL-DPRVRGLYFPAGGSSSGTVNPVQNTVSSISSILSKT
KJ803819_MHBs_P-B      MQWNSTKFHQALL-DPRVRGLYFPAGGSSSGTVNPVQNTVSSISSILSKT
KJ717798_MHBs_P-B      MQWNSTTFHQTLL-DPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKT
JQ027325_MHBs_P-B      IQWNSTTFHXTLQ-DPRVRALYLPAGGSSSGTVSPAQXTVSATSSILSKT
KP406173_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KP406172_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KP406171_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KP406167_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KX276828_MHBs_P-B      MQWNSTKFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSISSKT
KC792920_MHBs_P-B      MQWNSTTFLQTLQ-DPRVRALYFPAGGSSSGTVXPAQNTVSXXSSILSXT
KC792963_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSETVSPAQNTVSAISSILSKT
KP148419_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148426_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSISSKT
KP148427_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148430_MHBs_P-B      MHWNSTKFQQTLQ-DLRVRALYFPAGGSSSGTVNPVQNTASSISSFLSKT
KP148439_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148438_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYPPAGGSSSGTVNPVQNTASSISSILSKT
KP148414_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148409_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYFPAGGSSSGTVNPIQNTASSISSILSKT
KP148406_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148405_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148411_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148413_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148415_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148420_MHBs_P-B      MHWNSTKFQRTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148423_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148425_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148429_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148416_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148437_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148424_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148435_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148440_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148407_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148433_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148410_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148418_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148432_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
GQ924621_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
JN604123_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNTVHNTASSISSILSTT
KY881955_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASAISSILSKT
KY881954_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASAISSILSKT
KY881944_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASAISSILSKT
KY881945_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASAISSILSKT
KY881946_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASAISSILSKT
KY881947_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASAISSILSKT
KY881948_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASAISSILSKT
KY881949_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASAISSILSKT
KY881950_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASAISSILSKT
KY881951_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASAISSILSKT
KY881952_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASAISSILSKT
KY881956_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASAISSILSKT
KY881957_MHBs_P-B      MHWTSTKFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASAISSILSKT
KY881958_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASAISSILSKT
KY881953_MHBs_P-B      MHWNSTKFQQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASAISSILSTT
DQ141647_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGQVNPVQTTASSISSILSKT
DQ141651_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGQVNPVQTTASSISSILSKT
KX276996_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSTT
EU660230_MHBs_P-B      VRWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSISSTT
EU660231_MHBs_P-B      VRWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSISSTT
DQ141639_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
AB219429_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
FJ023638_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
EU330995_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
FJ023637_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTLNPVQNTASSISSILSKT
GQ358148_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
EU330989_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
EU330990_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
EU330994_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
EU330996_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
EU330997_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
EU330998_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
EU330999_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
EU331000_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
EU331001_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
GQ924635_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSILSILSKT
GQ358149_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
GQ358151_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
GQ358152_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
GQ358150_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
HM011487_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSTSSKT
DQ141634_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASTISSILSKT
DQ141637_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AY800391_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQSTASSKSSISSKT
AY800392_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQSTASSKSSISSKT
AB713528_MHBs_P-B      MQWNSPKFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
DQ141635_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
DQ141636_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AB713529_MHBs_P-B      MQWNSTTFHQNLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AB713530_MHBs_P-B      MQWNSTTFHQNLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AB033554_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSTT
AB493835_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
DQ141644_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
DQ141642_MHBs_P-B      MQWNSSTFHQTLQ-DPVVRALYLPVGGSSSGTVNPVQNTASSISSILSKT
DQ141629_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSLGTVNPVQNTASSISSILSKT
DQ141624_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AB713527_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKI
DQ141622_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVNPVQNTVSSISSILSKT
EF473971_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKT
EF473972_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVNPVQNTVSSISSILSKT
AB033555_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AB219430_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AB493827_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AB713531_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AB976562_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AP011085_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
DQ141623_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVNPVQNTASSISSILSKT
DQ141627_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
DQ141630_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
DQ141632_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
DQ141633_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKT
DQ141645_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
DQ141646_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKT
GQ358136_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
DQ141628_MHBs_P-B      VRWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
GQ924656_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTANPVQNTASSISSILSKT
AB219427_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AB219426_MHBs_P-B      MRWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
JN604141_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
GQ358143_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
GQ358140_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
GQ358137_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISTILSKT
DQ141650_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
EF473976_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
AP011091_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
AP011092_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
AP011088_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
AP011090_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
DQ141648_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
DQ141649_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
DQ141652_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
DQ141653_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
EF473977_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
GQ358138_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
GQ358139_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
GQ358141_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
GQ358142_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
HQ700549_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQTTASSISSILSKT
JQ341590_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVPTTASSISSILSKT
GQ924624_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AP011096_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
AP011094_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKT
AP011093_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSISSKT
AP011089_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQSTASSISSILSKT
AB493833_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASPISSILSKT
JN792896_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
GQ924645_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSTSSILSKT
DQ141655_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSRSGTVNPVQNTASSISSTLSKT
GQ358144_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSRSGTVNPVQNTASSISSTLSKT
AB241117_MHBs_P-B      TQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AB219428_MHBs_C-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AP011086_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AP011087_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AP011095_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
GQ924640_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
GQ924651_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
GQ924654_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KC774418_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQSTASSISSILSKT
GQ358145_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSTLSKT
GQ358146_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSGSGTVNPVQNTASSISSTLSKT
GQ358147_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNIASSISSTLSKT
KP148398_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGPSSGTVNPVQNTASSISSILSKT
KP148391_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148387_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGPSSGTVNPVQNTASSISSILSKT
KP148380_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148376_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148373_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148371_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
HM011496_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTANPVQNTASSISSILSTT
HM011467_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKT
JQ027334_MHBs_P-B      VXWNSTXFHQTLQ-DPRVRALYLPAGGSSSGTVNPVPNTASSISSILSKT
KP148403_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148401_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148399_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148397_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148396_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148395_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148394_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVNPVQNTASSISSILSKT
KP148392_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148390_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148389_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148388_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148386_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148385_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148384_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148382_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148379_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148378_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148374_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148372_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148370_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP148368_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
HM011499_MHBs_P-B      XXWNSXTFHHTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKT
HM011469_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KX276822_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
JQ027311_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSIXSKT
JQ341554_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
GQ924630_MHBs_P-B      MRWNSTTFHQTLQ-DPRVRHLYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ463795_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQITASSISSILPKT
AB642101_MHBs_P-B      MRWNSITFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924641_MHBs_P-B      VKWNSPTFHQTLQ-DPRVRALYLPAGGSSSGTVIPVQSTVSPISSILSKT
KC792847_MHBs_P-B      MQWNSTPFHQTRQ-ETPVRASHLPAGGSSSGTVSPAQNTVSAISSILSKT
HM011492_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
FJ386608_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU881997_MHBs_P-B      MQWNSTAFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU939637_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
AB931169_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ904357_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSPISSILSKT
AY596103_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
AB073839_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKI
AB073837_MHBs_P-B      IHWKPPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793092_MHBs_P-B      MQWHLTTFYQTLQ-ETSVRALNSPAGGSSSGTVSPAQNTVFAISSILSKT
HM153811_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRTLYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU939670_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYIPAGGSSSGTVSPAQNTVSAISSILSKT
EU139543_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406247_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ027312_MHBs_P-B      MQWNXTTFHQTLQ-DPRVRALYLPAGGSSSXTVSPAQNTVSAISSILSKT
AY217355_MHBs_P-B      MQWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB900110_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792915_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKI
HM011470_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALHVPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386655_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU939671_MHBs_P-B      VQWNSTTFLQTLQ-DPRVRALYLPAGGSSSGTVSPAPNTVSAISSILSKT
EU939669_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
EU564822_MHBs_P-B      MQWNATTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSTT
EU547563_MHBs_P-B      MQWNATTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ281243_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377558_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY518556_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKI
KC793104_MHBs_P-B      MQWNSITFLNTLQ-TPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
JX504543_MHBs_P-B      MQGISITFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
JX504531_MHBs_P-B      VKWNPTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
JQ040138_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKT
JN604124_MHBs_P-B      MQWNSTAFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ899779_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
AY206383_MHBs_P-B      MQWNSTTFHHTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562224_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792878_MHBs_P-B      MQWNXTTFLQTLH-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSRT
KC792810_MHBs_P-B      IRWXNPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792678_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792648_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ801474_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSATSSILSKT
JQ040171_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKI
HM011504_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSKT
KC792805_MHBs_P-B      MQWNSTXFHQTLQ-DPRVRALYFXAGGSSSGTVSPAQNTVSAISSILSKT
KC792812_MHBs_P-B      MQWNSTXFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793016_MHBs_P-B      IQWNATTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793005_MHBs_P-B      MQWNTTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792837_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTT
JQ341582_MHBs_P-B      MXWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAPNTVSAISSIXSKT
JQ341572_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSILSKT
JQ341563_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ281206_MHBs_P-B      MXWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSIXSKT
KJ803768_MHBs_P-B      MQWNSTTFLQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KF053174_MHBs_P-B      MQWNSTTFLQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KC792903_MHBs_P-B      MQWNSTSFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSISSKT
KC792825_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSANSSILSKT
JQ341552_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPALNTVSAISSILSKT
JQ040170_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792981_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792861_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
KC792787_MHBs_P-B      MQWNTTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAXNTVSAISSILSXT
KC792760_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSXTVSPAQNTVSAISSILSXI
JQ341592_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341569_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSXT
JQ341562_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSTT
JQ341558_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ040173_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ040125_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JN604134_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JN406371_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JF899335_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JF412801_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
HM011480_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341550_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
HM011494_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSXT
JQ341553_MHBs_P-B      MXWNSSTFHQTLQ-BPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792854_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341551_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792749_MHBs_P-B      MQWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793138_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKT
KC793006_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792944_MHBs_P-B      MRWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
KC792924_MHBs_P-B      MQWNSTTFHHTLQ-DXRVRALYFPAGGSSSGTVSPAQNTVSATSSNSSTT
KC792765_MHBs_P-B      MQXNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTVSAISSILSKT
JQ341600_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341556_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341559_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792773_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406314_MHBs_P-B      MQWNATTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406312_MHBs_P-B      MQWNATTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406305_MHBs_P-B      MQWNATTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406283_MHBs_P-B      IQWXXXXXXXXXX-XXXXRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KC792997_MHBs_P-B      MQWNXTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSISSKT
KC793160_MHBs_P-B      MQWNTTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KC792885_MHBs_P-B      XQXNSTTFHQTLQ-DPRVRALYFPAGGSSSXTVSPAQNTVSXISSILSKT
JQ040147_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JN604127_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792960_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792802_MHBs_P-B      MQWNXTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341581_MHBs_P-B      XQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSKT
KC792882_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792727_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
HM011482_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276813_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSXXSXT
KC792758_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPXGGSSSXTASPAQNTVSAISSXLSXT
HM011478_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792744_MHBs_P-B      MQWNXTTFHQTLQ-DPRVRALYFPAGGSSSGTVSXAQNTVSAISSXLSXT
EU939634_MHBs_P-B      VKWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB117759_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
DQ993686_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
DQ993682_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
AB073835_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVNPAQNTASAISSTFSKT
DQ993680_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVNPAQNTASAISSTFSKT
DQ993681_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVNPAQNTASAISSTFSKT
DQ993683_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVNPAQNTASAISSTFSKT
DQ993685_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVNPAQNTASAISSTFSKT
AB212626_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGIVSPAQNTASAISSTFSKT
JQ281224_MHBs_P-B      MQWNTTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKI
JN604219_MHBs_P-B      XQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQTTAFAISSTFSKT
AB031267_MHBs_P-B      MQWNSATFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTASPISSTFSTT
GQ924626_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281141_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKI
AB205122_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTASAISSTFSKT
JN604212_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
FJ023635_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFLKT
AY517489_MHBs_P-B      MQWNPTTFHQTLQ-DPKVRALYFPAGSSSSGTVSPAQNTASAISSTFSKT
AY033073_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
AB115551_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
AB231909_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
AY517619_MHBs_P-B      MQWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
FJ023632_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSTT
FJ023634_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
FJ349236_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JN604125_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JN604143_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JN604154_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JN604284_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
HQ700546_MHBs_P-B      MQWNSTNFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
AY033072_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
FJ023633_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JN604223_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JN604119_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281143_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281140_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281139_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JN604234_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSASAISSTFSKT
JQ281137_MHBs_P-B      VQWNSKTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281138_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707747_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281190_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTFSKT
JQ281157_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVTPAQNTASAISSTFSKT
JQ281132_MHBs_P-B      IQWHTPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTFSKT
JN604138_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JN604132_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSIFSKT
DQ993684_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF621878_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281185_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTASVISSTFSKT
AB212625_MHBs_P-B      MQWNSTAFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707767_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707749_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707734_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707737_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707738_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707739_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707742_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707743_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707744_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707745_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707746_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707750_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707753_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707755_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707758_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707759_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707762_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707763_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707765_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707766_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707740_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281258_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQTTASAISSTFSXT
AB368295_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ707735_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
AB100695_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281170_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQXTASAISSTFLKT
JQ281160_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674505_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674447_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674440_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSTT
MF674432_MHBs_P-B      MQWNSTTFHQTLQ-DPRVTALHYPAGGSSSETVSPAQNTASAISSTFSKT
JQ281234_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSLGTVSPAQNTASAISSTFSKT
JQ281229_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281217_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTFSKT
JQ281216_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTFSKT
JQ281213_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTFSKT
JQ281204_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQHTASAISSTFSKT
JQ281203_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281150_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281171_MHBs_P-B      MQWNSTTFHXTLQ-DPRVRALYXPAGGSSSGTVSPAQNTASAISSTFSKT
MF674416_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSLGTVSPAQNTASAISSTFSKT
MF674406_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ341601_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSIFSKT
JQ341585_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281238_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281231_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281202_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281153_MHBs_P-B      MQWNSTNFHQILQ-EPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674515_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674513_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674511_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674500_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674498_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674496_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASPISSTFSKT
MF674493_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674487_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674477_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674476_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674469_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674466_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTASAISSTFSKT
MF674455_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674452_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674451_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674446_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674439_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674438_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674437_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674431_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674414_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674413_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674405_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674400_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674395_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674394_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674393_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674389_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ341603_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSXTVSPAQNTASAISSTFSKT
JQ341596_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281253_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281246_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281245_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281237_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281235_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281228_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281227_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281226_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSXTVSPAQNTASAISSTFSKT
JQ281225_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281223_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281220_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281215_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281212_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281211_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281210_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281208_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281200_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281199_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281197_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281194_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281192_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281186_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281184_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281178_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281168_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281159_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSTT
JQ281154_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674460_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASTISSTFSKT
MF674407_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281240_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSXTVSPAQNTASAISSTFSKT
JQ281196_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRXLYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281149_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674509_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSASAISSTFSKT
MF674497_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674490_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674488_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674470_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674453_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674410_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674397_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674384_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674382_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ341588_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281257_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281209_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281187_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281180_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281179_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281176_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281172_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281166_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281165_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281151_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281144_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281147_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSGSGTVSPAQNTASAISSTFSKT
MF674508_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTASAISSTFSKT
JQ707764_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281131_MHBs_P-B      IQWNSKTFHQTLQ-DPRVRALYSPAGGSSLGTVSPAQNTASAISSTFSKT
JN604244_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAPNTASAISSTFSTT
MF674462_MHBs_P-B      MRWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
FJ023636_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
DQ993687_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAXXTASAISXTFXKT
MF674424_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGFSSGTVSPAQNTASAISSTFSKT
MF674415_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQTTASAISSTFSTT
MF674396_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASPISSTFSKT
JQ281148_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAXSSTFSKT
JQ281129_MHBs_P-B      MQWNSXTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTXSKT
MF674491_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674478_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674473_MHBs_P-B      MQWNSTTFHQTLQ-DTRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281252_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281221_MHBs_P-B      IQWNSPTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281158_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTASAISSTFSKT
JN604221_MHBs_P-B      XQWNSTTXHQTLQ-DPXVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ341605_MHBs_P-B      MQWNSXTFLQTLQ-DPRVRALYFPAGGSSSGTVSPAQITASAISSTFSKT
JQ281256_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281242_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281193_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281188_MHBs_P-B      MQWNSTNFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAIXSTFSKT
JQ281164_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGXVSPAQNTASAISSTFSKT
JN604253_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JN604213_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSTT
MF674495_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTASAISSTFSKT
MF674483_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674482_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIASPAQNTASAISSTFSKT
MF674481_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674459_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674456_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNPASAISSTFSKT
MF674423_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTASAISSTFSKT
MF674420_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTASAISSTFSKT
MF674419_MHBs_P-B      VRWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSRT
MF674409_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTASAISSTFSKT
MF674387_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTASAISSTFSKT
MF674385_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASATSSTFSKT
KU234318_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ341589_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281255_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281254_MHBs_P-B      MQWNTTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281249_MHBs_P-B      MQWNTTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281189_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTASAISSTFSKT
JQ281181_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTASAISSTFSKT
JQ281167_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTASAISSTFSKT
JQ281134_MHBs_P-B      MQWNXTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281214_MHBs_P-B      XQWNXXTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ341604_MHBs_P-B      XXWNXXTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ341608_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674436_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSTT
MF674401_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281236_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674510_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674507_MHBs_P-B      MRWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674499_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674445_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674443_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674441_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674434_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
MF674433_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKI
MF674421_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASSISSTFSKT
MF674392_MHBs_P-B      MRWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSTT
JQ281244_MHBs_P-B      MXWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAXNTASAISSTFSKT
JQ281248_MHBs_P-B      MXWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281239_MHBs_P-B      MQWNSTTFLQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTXSXI
KX765841_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ341580_MHBs_P-B      MQWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281241_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281230_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281218_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASXISSTFSKT
JQ281195_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281133_MHBs_P-B      MQWNSTTFXQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSXT
JQ281163_MHBs_P-B      MQWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281161_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281207_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281222_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNIASAISSTFSKT
JQ281152_MHBs_P-B      MXWNSTTXHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
JQ281205_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTASAISSTFSKT
KJ717808_MHBs_P-B      MQWNSTTVHQTLL-DPRVRALYFPAGGSSSGIVSPAQNTVSAISSTLSKT
KJ803797_MHBs_P-B      MQWNSTTVHQTLL-DPRVRALYFPAGGSSSGIVSPAQNTVSAISSTLSKT
KJ717805_MHBs_P-B      MQWNSTTVHQALL-DPRVRALYFPAGGSSSGIVSPAQNTVSAISSTLSKT
KJ717806_MHBs_P-B      MQWNSTTVHQAML-DPRVRALYFPAGGSSSGIVSPAQNTVSAISSTLSKT
KJ803795_MHBs_P-B      MQWNSTTVHQAML-DPRVRALYFPAGGSSSGIVSPAQNTVSAISSTLSKT
KF053194_MHBs_P-B      MQWNSTTVHQALL-DPRVRALYFPAGGSSSGIVSPAQNTVSAISSTLSKT
KJ803781_MHBs_P-B      MQWNSTTVHQALL-DPRVRALYFPAGGSSSGIVSPAQNTVSAISSTLSKT
D50521_MHBs_P-B        MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSTISSILSKT
AB287326_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
D50522_MHBs_P-B        MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSTISSILSKT
EU796068_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
AB073852_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTTSSILSKT
AF121243_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
AF121244_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
AF121245_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
AF121246_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
GQ377519_MHBs_P-B      MQWNSSTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
GQ924627_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
AB073848_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
AB205121_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
EU306699_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY206373_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSPISSILSKT
FJ032349_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKI
FJ386675_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKI
DQ995801_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
AY596111_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386636_MHBs_P-B      MQWNSANFHQTLQ-DPRVRALYFPAGGSSLGTVSPAQNTVSAISSILSKT
DQ141618_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EF473974_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815635_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924606_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377567_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ899787_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562316_MHBs_P-B      MQWNSTTFHQSLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY220704_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYLPAGGSSSEIVSPAQNTVSAISSILSKT
GU815565_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGPSSGTVSPAQNTVSAISSILSKT
GU815567_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGPSSGTVSPAQNTVSAISSILSKT
GU815576_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGPSSGTVSPAQNTVSAISSILSKT
AB073828_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ993697_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ993698_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ993699_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU939672_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
FJ899784_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
FJ899785_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
FJ899786_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
GU815657_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815656_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815644_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815643_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815639_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815619_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRTLYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ475340_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562259_MHBs_P-B      MQWNSTTFHLTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ518812_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386676_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386600_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
EU564824_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU439020_MHBs_P-B      MQWNSTAFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562254_MHBs_P-B      MQWNSTAFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306711_MHBs_P-B      MQWNSITFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ993709_MHBs_P-B      MQWNSTTFHQTLQ-DPKVKALYFPAGGSSSGTVSPAQNTVSPISSILSKT
DQ993700_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ448625_MHBs_P-B      MQWNFTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY220703_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYLPAGGSSSEIVSPAQNTVSAISSILSKT
AY167100_MHBs_P-B      MHWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAPNTVSAISSILSKT
GU815560_MHBs_P-B      MQWNSTNFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377639_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSAISSILSKT
GQ377537_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU570075_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
AY167102_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
AF121248_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306680_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306679_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AF100309_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPALNTVSAISSILSKT
AB073822_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB073826_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB073827_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB073834_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB073836_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815677_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815676_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815675_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815674_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815673_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815672_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815669_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815668_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815667_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815666_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815665_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815664_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815663_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815662_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815661_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815660_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815659_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815658_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815654_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815653_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815652_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815651_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815650_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815649_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815648_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815647_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815646_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815645_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815642_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815641_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815640_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815638_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815637_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815636_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815632_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815631_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815630_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815629_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815628_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815627_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815626_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVFAISSILSKT
GU815625_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815624_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815623_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815622_MHBs_P-B      MQWNSTTFHKTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815621_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815620_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815618_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815617_MHBs_P-B      MQWNSTTFHKTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815571_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815569_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815568_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815566_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815564_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815561_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815559_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815556_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815555_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815554_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815553_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815552_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815551_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815549_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU434373_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU434372_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924653_MHBs_P-B      MQWNSNTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924632_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924611_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924610_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924608_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924605_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924603_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377643_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377641_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377638_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSIFSKT
GQ377625_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377612_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377588_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377569_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377568_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377566_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377547_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377542_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ787444_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562322_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
FJ386684_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386683_MHBs_P-B      MQWTSTTVHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386681_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386668_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386666_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386660_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386615_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386584_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386583_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386582_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ032354_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
FJ032352_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
EU570071_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU570070_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU439023_MHBs_P-B      MQWNSTTFHQTPQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU439022_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU439021_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
EU439018_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU350409_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306712_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306710_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSNSGTVSPAQNTVSAISSILSKT
EU306708_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306707_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTASPAQNTVSAISSILSKT
EU306706_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306705_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306704_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
EU306703_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306702_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306701_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306700_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ993708_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ993706_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
DQ993704_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
DQ993703_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ448628_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ448627_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ448626_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ448624_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
DQ448623_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ448621_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ448619_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ141620_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY766463_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY293309_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY167097_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AF479684_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AF282918_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVYAISSILSKT
AF121249_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AF100308_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB471855_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB471854_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB300364_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB287328_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB246339_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB073840_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISXILSKT
AB195933_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU939638_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306681_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306678_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386654_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562289_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562231_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AF121247_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562222_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB287329_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AF121250_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
AY206375_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
EU564823_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU522072_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTVSAISSILSKT
EU522074_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTVSAISSILSKT
DQ141616_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVIPAQNTVSAISSILSKT
DQ141617_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVIPAQNTVSAISSILSKT
EF473975_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVIPAQNTVSAISSILSKT
EU305547_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSGSGTVSPAQNTVSAISSILSKT
FJ386658_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU305548_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY217368_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNIVSAISSILSKT
D00330_MHBs_P-B        MQWNSTTFHQTLQ-DPGVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386610_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815550_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562257_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562236_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU939666_MHBs_P-B      MQWNSTTFHQTLQ-DLRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
AY167093_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
AF282917_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377610_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB073829_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU595031_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY800389_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
GU815578_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815577_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
GU815575_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815574_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
GU815572_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815570_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815563_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815562_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815558_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815557_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815548_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924648_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
GQ377629_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377622_MHBs_P-B      MQWNSNTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377525_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562234_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
FJ562219_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY596105_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
AB073833_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY167098_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSTT
AB195934_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB195935_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ995804_MHBs_P-B      TQWNSTKFHQTLQ-DPRVRALYIPAGGSSSGTVSPAQNTVSAISSILSKT
DQ463787_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQITASSISSILPKT
DQ463802_MHBs_P-B      MQWNSTTFHQTLQ-DSTVRTLNLPAGGSSSGTVNPAQITASSISSILPKT
JN792894_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQITASSISSILPKT
DQ463799_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQITASSISSILPKT
DQ463793_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQITASPISSILPKT
DQ463801_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQITASPISSILPKT
JN792893_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQITASPISSILPKT
DQ463800_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQITASSISSILPKT
JN792898_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQITASSISSILPKT
DQ463792_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQITASSISSILPKT
DQ463796_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPAQITASSISSILPKT
DQ463788_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQITASSISSILPKT
DQ463790_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPAQITASSISSILPKT
DQ463798_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQITASSISSILPKT
JN792899_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQITASSISSILPKT
JN792900_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQITASSISSILPKT
DQ995802_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AF121251_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
FJ023631_MHBs_P-B      MQWNSTTFHRALQ-TPKVRALYFPAGGSSSGTVSPAQNTVSPISSNSSTT
AB900098_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGFSSGTVSPAQNTVSTISSISSKT
AB246343_MHBs_P-B      MQWNSTIFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
HM011471_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU357842_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB073857_MHBs_P-B      MQWNSTNFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSAISSILSKT
AB302095_MHBs_P-B      VKWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
EU939633_MHBs_P-B      VKWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
HM011476_MHBs_P-B      MQWNSTTFHQTIQ-DPRVRALYFPAGGSSSGTVSPAQSTVSPTSSILPKT
GU815773_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGPSSGTVSPAQNTVSAISSILSKT
GU815776_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGPSSGTVSPAQNTVSAISSILSKT
EU919172_MHBs_P-B      MQWNSPTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB555499_MHBs_P-B      MQWNSTTFHHSPH-GPRVRALYFPAGGSSSGTVSPAQITVSAISSILSKT
KC792881_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924647_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU939661_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
EU919173_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ032342_MHBs_P-B      TQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTLSPAQNTVSTTSSISSKT
FJ032344_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
AB073854_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
AB900107_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU882004_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU564826_MHBs_P-B      MQWNSTTFHKTLQ-DPRVRALNFPAGGSSSGTVSPAQNTVSAISSILSKT
AB073849_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KC793017_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXXKT
KC792998_MHBs_P-B      MQWNYTNFHRTLQ-NPRVRALYFPAGGSSSETVSPAQNTVLPTSSILSTT
KC792777_MHBs_P-B      MQWNXTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSTT
GU815783_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815772_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562312_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
EU487257_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
AJ627225_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB900097_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
AB362933_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
AB073821_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792953_MHBs_P-B      MQWNSTTFHQTLQ-NPKVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KC774412_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JN604149_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
EU939635_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EF134945_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB073838_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KY881787_MHBs_P-B      MQWNSTTFHQTLQ-DPRVGALYFPAGGSSSGIVSPAQNTVSPISSILSKT
KC792688_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSVXSSTLSTT
JX026883_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
JQ429082_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTVSSISSILSKT
JQ281156_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815722_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815587_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815581_MHBs_P-B      MQWNSTTFHQTLQ-DSRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924644_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562321_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386680_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU939673_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU939664_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSTLSKT
AB900106_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB900105_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSETVSPAQNTVSAISSILSTT
AB900104_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTVSAISSILSKT
AB073844_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTASPAQNTVSAISSILSKT
KC792709_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792683_MHBs_P-B      VXWNSXTFLQTLQ-DPRVRALXXPAGGSSSGTVSPAQXTVSTISSIXSXT
KC792660_MHBs_P-B      MQWNTTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSISSTT
JQ281247_MHBs_P-B      MQWNTTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815782_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815781_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815777_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815775_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815774_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815756_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815713_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815711_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU451682_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386682_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306709_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EF494381_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSTT
EF134946_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ993710_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY217358_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY217357_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY217356_MHBs_P-B      MQWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY167101_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB900108_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTASPAQNTVSAISSILSKT
AB900102_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB246340_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB073845_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSPISSILSKT
KY881893_MHBs_P-B      QTLHSTTFHQTLQ-DPRVRDLYFPAGGSSSGTVSPAQNTVSAISSILSTT
KP659223_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGAVNPAQNTASSISSILSKT
KJ717796_MHBs_P-B      MQWNSTTFHQALL-DPRVRALYFPAGGSSSGTVSPAQNTVSPISSILSKT
KJ173298_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYLPAGGSSSGTVSPAQTTVSAISSISSKT
KJ173297_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQTTVSAISSILSKT
KC792897_MHBs_P-B      IQWNTTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KC792788_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774367_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX870001_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSETVSPVQNTVSAISSILSKT
HM011474_MHBs_P-B      IRWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
HM011466_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSXTVSPAQNTVSAXSSILSTT
GU815780_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
GU815681_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815584_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
D23679_MHBs_P-B        VQWNSATFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY217359_MHBs_P-B      MQWNSTTFHQTLQ-DPRVGALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY206390_MHBs_P-B      MQWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB900112_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAXSSILSKT
AB205120_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792741_MHBs_P-B      XXWNTTTFHQTLQ-DXRVRALYFPAGGSSSXTVSPAQNTVSAISSILSKT
KC792733_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSTLSTT
KC774362_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX504533_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYIPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341549_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ281177_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JN604146_MHBs_P-B      MQWNSTTFHHTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JN604122_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815779_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
GU815771_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815770_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRAPYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815769_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815768_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815767_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815766_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815765_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815764_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815762_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815761_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815760_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815759_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815757_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815755_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815754_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815753_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815752_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815751_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815750_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815749_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815748_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815747_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815746_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815745_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815744_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815743_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815742_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815740_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815739_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815738_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815737_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815736_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815735_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815734_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
GU815733_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815732_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815731_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815730_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815729_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815728_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815727_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815726_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815725_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815724_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815721_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815720_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815719_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815718_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815717_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815716_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815715_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815712_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815710_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815709_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815708_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815707_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815706_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815705_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815704_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815703_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815702_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815701_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815700_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815699_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815698_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815697_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815696_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815695_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815694_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815693_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815692_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815691_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815689_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815688_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815687_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815686_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815685_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815684_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815683_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815680_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815679_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815614_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815613_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815612_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815610_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815609_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815608_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815607_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815606_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815605_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815604_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815603_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815602_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815601_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815600_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815599_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815598_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815597_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815596_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815595_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815594_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815593_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815591_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815590_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815589_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815588_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815586_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815585_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815583_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815579_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924634_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924631_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924607_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU939677_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU919176_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
EU919175_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
EU919171_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
EU882002_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU796066_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU522067_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306698_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306697_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306696_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU306695_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EF473973_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAPNTVSAISSILSKT
DQ448622_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ448620_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ377158_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ141619_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
D23678_MHBs_P-B        MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
D00329_MHBs_P-B        MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY596112_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY596110_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY596109_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY596106_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY596104_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY596102_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY217360_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881910_MHBs_P-B      VQWNSTAFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KY881908_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRDLYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881906_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRDLYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881899_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLSAGGSSSGTVSPAQNTVSAISSILSTT
KY881863_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALCLPAGGSSSGTVSPAQNTVSAISSILSTT
KY881858_MHBs_P-B      VQWNSTAFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KY881857_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881799_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSSISSILSKT
KC792975_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774416_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774410_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
KC774404_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
KC774402_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774396_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774380_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSPISSILSKT
KC774375_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSVISSILSKT
KC774370_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774368_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC510653_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
KC510646_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX661483_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX429910_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX026886_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815778_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
FJ386634_MHBs_P-B      MQWNSTTFHQTLQ-NPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU158263_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ141615_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAPNTVSAISSILSKT
AY217362_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYVPAGGSSSGTVSPAQNTVSAISSILSKT
KY881909_MHBs_P-B      VQWNSTNFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KJ173342_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
KC793009_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSIXSKT
KC792947_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792820_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSLGTVSPAQNTVSTISSILSKT
KC792798_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792754_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792724_MHBs_P-B      IQWNSTTFHXTLQ-DPRVRALYXPAGGSSSGTVXPAQNTVSAISSILSKT
KC792692_MHBs_P-B      MQWNSTTFHQTLQ-DXRVRALYLPAGGSNSGTVSPAQNTVSAISSILSKT
KC774369_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAPNTVSAISSILSKT
KC510658_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MK052965_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
MK052964_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
MK052962_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KJ173372_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
KJ173371_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
KC793106_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSSLSKT
KC792821_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYVPAGGSSSGTVSPAQNTVSAISSILSKT
KC792729_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KC792671_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAVSSILSKT
KC792661_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792657_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881914_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
KY881913_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
KY881912_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
KY881911_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881905_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881903_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881902_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881901_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881900_MHBs_P-B      LQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881898_MHBs_P-B      FQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881897_MHBs_P-B      FQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881896_MHBs_P-B      YQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
KY881895_MHBs_P-B      FQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881894_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881862_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881861_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881860_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
KY881859_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881855_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
KY881854_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881852_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881846_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY881844_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC793177_MHBs_P-B      MQWNATTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSPISSISSKT
KC792937_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792931_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSHISSSSSKT
KC792896_MHBs_P-B      XRWNSTTFHQTLQ-DPRVRALYFPAGGSSSXTVSPAQNTVSAXSSILSKT
KC792860_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSRTVSPAQNTVSAISSILSKT
KC792811_MHBs_P-B      MXWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KC792764_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSLAQNTVSAISSILSTT
KC792763_MHBs_P-B      XQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792755_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KC792748_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSXXSXT
KC792698_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792674_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792667_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792663_MHBs_P-B      MXWNXTTXHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC774419_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774417_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774415_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KC774411_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774409_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774408_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774407_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774406_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774403_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774401_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774400_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774399_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774398_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774395_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774392_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774391_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774390_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774385_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774384_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774383_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774382_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774381_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774379_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774378_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774377_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774374_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774373_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774372_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774371_MHBs_P-B      MQWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774366_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774365_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774363_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC510652_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC510650_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC510649_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC510647_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC510641_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX661484_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX661481_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX661470_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
JX429901_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ801524_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ801514_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ801494_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSRTVSPAQNTVSAISSILSKT
JQ341609_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
HM011473_MHBs_P-B      MQWNXTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571327_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSPISSILSKT
MF674480_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MF674479_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTASAISSTFSKT
LC279273_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
LC279272_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
LC279271_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
LC279270_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
LC279269_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
LC279268_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
KY881847_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KR232337_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTLSPAQNTVSTISSILSKT
KC793150_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
KC792967_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KC792964_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALXLPAGGSSSGTVSPAQNTVSAISSILSTT
KC792807_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
KC792789_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792772_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792768_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792731_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792711_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792685_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ801506_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAPNTVSAISSILSKT
KP659220_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGAVNPAQNTASSISSILSKT
KC793078_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSNLSTT
KC793048_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSXTVSPAQNTVSAISSILSKT
KC793004_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
KC792835_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSXLSKT
KC792761_MHBs_P-B      MQWNXTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792701_MHBs_P-B      MQWNSTTXHQTLQ-DPRVRALXXPAGGSSSGTVSPAQNTVSAISSILXKT
KC792650_MHBs_P-B      MQWNSTTFHQTLQ-BPXVRALYFPAGGSSSGTVSPAQNTVSAISSILSXT
JQ341598_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY167094_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881907_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792987_MHBs_P-B      MQXNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNXVSAXSSILXXT
KC792949_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792890_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792845_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAXSSXXSXT
KC792840_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSXTVSPAQNTVSAISSILSXX
KC792767_MHBs_P-B      MQWNSTTFHQTLQ-DPXVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KC792686_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792676_MHBs_P-B      XQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNXVSXXSSXSXTT
KC792791_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792677_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793072_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KC793137_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793045_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792796_MHBs_P-B      XQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSXT
KC792665_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAPNTVSAISSILSKT
KC792649_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341595_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSXT
KX276807_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSXLSKT
KX276962_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASAISSILSKT
KF053191_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASPISSILSKT
KJ803786_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASPISSILSKT
JF436921_MHBs_P-B      IQWNYTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAPNTVSAISSILSTT
GQ924617_MHBs_P-B      MQWNSAKFHQTLQ-DTRVRALYFPAGGSSSGIVNPVQNTASPISSILSKT
DQ141626_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALFLPVGGSSSGTVNPVQNTASSTSSTFSKT
AB287325_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
EU579441_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386656_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
EU589335_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924639_MHBs_P-B      MQWNSTTFLQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKT
GQ924638_MHBs_P-B      MQWNSTTFLLTLQ-DHRVRDLYFPAGGSSSGTVNPVQNTVSSISSILSKT
DQ141643_MHBs_P-B      MQWNSTTFHKTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AY163869_MHBs_P-B      MQWNSTTFHKTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
AY163870_MHBs_P-B      MQWNSTTFHKTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
AB073851_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
JN792901_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
JN792902_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
AB302942_MHBs_P-B      IQWNSTTFHQTLH-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB302943_MHBs_P-B      IQWNSTTFHQTLH-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB302944_MHBs_P-B      IQWNSTTFHQTLH-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB302945_MHBs_P-B      IQWNSTTFHQTLH-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377606_MHBs_P-B      IQRNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ141638_MHBs_P-B      MQWNSTTFHQTLQ-DSRVRALYFPAGGSSSGTVNPVQNTASPISSILSRT
GQ377644_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386648_MHBs_P-B      MQWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
DQ993705_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRDLYFPAGGSSSGTVSPAQNTVSAISSILSTT
JQ027330_MHBs_P-B      MQWNSTTXHQTLQ-DPRVRAXNFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ027331_MHBs_P-B      MQWNSTTXHQTLQ-DPRVRAXNFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ787475_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSTT
EU939678_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSIFSTT
EU487256_MHBs_P-B      MQWNSTTFLQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP659248_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
KP659239_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQITASSILSILPKT
JQ341560_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
GQ924637_MHBs_P-B      MQWNSTKFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASPISSILSKT
FJ386669_MHBs_P-B      MTRNSTTFHQTLQ-DPRVRALYFPVGGSSSGTVSPAQNTVSAISSILSKT
AB900103_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB300371_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTVSTTSSILSTT
AB073847_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
AB287314_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGAVNPAQNTASSISSILSKT
AB287315_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGAVNPAQNTASSISSILSKT
AB287319_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGAVNPAQNTASSISSILSKT
AB287317_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGAVNPAQNTASSISSILSKT
KY881849_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQTTVSPTSSILSKT
KX276820_MHBs_P-B      XKWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
GQ924625_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AB931168_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB287322_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
AB287321_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSLGTVNPAQNTASSISSILSKT
AB287320_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSTT
AB073855_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSPISSILSKT
AB073842_MHBs_P-B      IQWNSTIFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571376_MHBs_P-B      MQRNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ717841_MHBs_P-B      MQWNSTTFHQALL-DPRVRALYFTVGGSSSGTVNPVQNTASSISSILSKT
GU332695_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
GQ924628_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
FJ787477_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
FJ386688_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
EU881998_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB365445_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB073858_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
AB073841_MHBs_P-B      MQWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSPISSILSKT
AB073823_MHBs_P-B      MQWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB073850_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562240_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341555_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB073825_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
AB675676_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571353_MHBs_P-B      MQRNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
LC349874_MHBs_P-B      VKWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KY881869_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQTTVSPTSSILSKT
KY881794_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSPISSILSKT
KP148452_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKT
KP148455_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKT
KP148456_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKT
KP148458_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKT
KP148459_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKT
KP148461_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKT
KC792918_MHBs_P-B      MQWNYATFHQTLQ-VHTVKGLNLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792737_MHBs_P-B      MQWNTTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSIFSKT
GQ924646_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSTLSTT
FJ562311_MHBs_P-B      MQWNSTTFXQTLQ-BPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU158262_MHBs_P-B      MQWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
DQ463794_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
DQ463789_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
DQ141640_MHBs_P-B      MQWNSTTFHQTLQ-DSRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
AF461360_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSTT
AB287316_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGAVNPAQNTASSISSILSKT
AB246342_MHBs_P-B      MQWNSTIFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB246341_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB205119_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB073843_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTASPAQNTVSAISSILSKT
AB010292_MHBs_P-B      IQWNATTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
AB010289_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB073830_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571331_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881841_MHBs_P-B      MQRNSTTFHQTLQ-GPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276821_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASPISSILSKT
KC793061_MHBs_P-B      XQWNSTTFHQTLQ-DPRVRALYVPAGGSSSGTVSPAPNTVSPISSILSKT
KC792966_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTXXPAQNTVSAISSILSKT
JQ341587_MHBs_P-B      VQWNSTTFHQTLQ-BPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKI
JQ341576_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
HQ700548_MHBs_P-B      MQWNSTXFHQTLQ-DSRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
GU815633_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377561_MHBs_P-B      MQWNSNTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562303_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562246_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ032357_MHBs_P-B      MRWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU939639_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
EU939636_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
EU796067_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILLET
D00331_MHBs_C-B        MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSTT
AF279464_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB900111_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSTT
AB828708_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSATSSILSKT
AB073856_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGIVSPAQNTVSAISSILSTT
KX276770_MHBs_P-B      MQWNSTTFHQTLQ-DPRGRAVDFPAGGSSSGTVSPAQNTVSAISSILSRT
KU964166_MHBs_P-B      VQWNSTTFLQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP148457_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKT
KC793038_MHBs_P-B      AQWNSTTVNQTLQ-XPRVRAQNXPAGGSSSGTVSPAQNTVSAISLILSKI
KC793028_MHBs_P-B      MRWNSPTFHKTLQ-DPRVRALYFPAGGSSSGTVNPAQNSVSTTLLTSSTT
KC792770_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYSPAGGSSSGTVSPAQNTVSXXSSILSKT
KC792745_MHBs_P-B      VKWNSTTFHQTLQ-NPRVRALYXPAGGSSSXTVSPAQNTVSAISSISSTT
KC792712_MHBs_P-B      MKWNSPTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KC792703_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSKT
KC774376_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377587_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GQ377582_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562296_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ562237_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU939559_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
AB555498_MHBs_P-B      MQWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
AB073832_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571370_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KP406279_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792694_MHBs_P-B      MQWNXTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792785_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
LC349872_MHBs_P-B      MQWNSTKFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KY881865_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQTTVSSISSILSKT
KY881850_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSPISSILSKT
KY881780_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSPISSILSKT
KX765854_MHBs_P-B      MQWNSTTFLQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KU964156_MHBs_P-B      MQWNSTTFLQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964118_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP659252_MHBs_P-B      MQWNSTSFHPTLQ-DPRVRALYLPAGGSSSGTVNPAQNTASSISSILSKT
KP659244_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KP406166_MHBs_P-B      MKWNFPTFHQTLQ-DPRVRALNFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792957_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KC792715_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYLPAGGSSSETVSPAQNTVSAISSILSKT
KC792699_MHBs_P-B      XXWNSTTFQQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792652_MHBs_P-B      MQWNSTNFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX869998_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKI
JX429897_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
HM011490_MHBs_P-B      XQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKT
GU815723_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AY167089_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AP011084_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSRTVSPAQNTVSAISSILSKT
AB642094_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB106884_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGIVSPAQNTVSTISSILSTT
AB073846_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
LC349875_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KY881864_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQTTVSPTSSILSKT
KY881853_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQTTVSPTSSILSKT
KY881843_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881835_MHBs_P-B      MQWNSTTLHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881821_MHBs_P-B      MQWNSTTFNQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KY881808_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSSISSILSKT
KY470841_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRPLYFPAGGSSSGTVTPAQNTVSAISSILSKT
KX276825_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KU964394_MHBs_P-B      MQWNSATFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
KU964249_MHBs_P-B      MQWNSATFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
KU964247_MHBs_P-B      MQWNSATFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
KU964246_MHBs_P-B      MQWNSATFHQTLQ-DPRVRALYLPAGGSSSETVSPAQNTVSAISSILSKT
KU964153_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP659235_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
KP659234_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
KP406239_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNSVSAISSILLKT
KP148377_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTTSSISSILSKT
KJ803805_MHBs_P-B      MQWNSTTFHQALL-DPRVRALYLPAGGSSSGTVSPAQNTVSPISSILSKT
KJ803758_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSTT
KJ803755_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSTT
KJ717818_MHBs_P-B      MQWNSTTFHQTLL-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KJ717817_MHBs_P-B      MQWNSTTFHQALL-DPRVRALYLPAGGSSSGTVSPAQNTVSPISSILSKT
KJ173379_MHBs_P-B      MQWNSTTFHQALQ-DPRVRALYFPAGGSSSGTVNPAQNTVSAISSILSKT
KF053165_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSTT
KF053162_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSTT
KC793159_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793036_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793025_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTVSAISSISSKT
KC792982_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSKT
KC792969_MHBs_P-B      IQWNTTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KC792943_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALNFPAGGSSSETVSPAQNTVSAISSILSTT
KC792842_MHBs_P-B      VQWNSTTFHQTLQ-DTKVRALYLPAGGSSSGTVSPAQNTVSAISSILSXT
KC792752_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGSSSGAVSPAQNTVSAISSILSKT
KC792726_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792722_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KC774397_MHBs_P-B      MKWNSPTFHQTLQ-DPRVRALYHPAGGSSSETVSPAQNTVSAISSILSKT
JQ412092_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRVLYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341607_MHBs_P-B      XQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKT
JQ027316_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
HM011475_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSXTVSPAQNTVSAISSILSKT
GU815678_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
GU815670_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU939676_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAPNTVSAISSILSKT
DQ993707_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTT
AY206391_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYPPAGGSSSGTVSPAQNTVSAISSISSKT
AB287318_MHBs_P-B      IQWNSPTFHQTLQ-HPRVRALYFPAGGSSSGAVNPAQNTASSISSILSKT
MG571372_MHBs_P-B      IQWTSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571348_MHBs_P-B      MQWNSTTFHQTLQ-NPKVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881783_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPVQNTVSPISSILSRT
KX276814_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVNPVQNTASSISSILSKT
KX276782_MHBs_P-B      MQWNSTTFHKTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KU964154_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP659254_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
KP659240_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
KJ173384_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSTISSILSKT
KJ173383_MHBs_P-B      MHWNSTKFHQTLQ-DPRVRALYFPAGGSSSEIVSPAQNTVSTISSILSKT
KC793063_MHBs_P-B      MKWNSTTFHQTLQ-DPRIRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC793012_MHBs_P-B      MXWNXTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSXISSILSKT
KC792959_MHBs_P-B      MQWNSTTFHQTLQ-DPRIRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792958_MHBs_P-B      VQWNSTTFHQTLQ-DTRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KC792935_MHBs_P-B      MQWNSTTFLQTLQ-DPRVRTLYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792883_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQTTVSAISSILSKT
KC792794_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792720_MHBs_P-B      MQWNSXTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792719_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792681_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC510656_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
KC510654_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX429911_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX026879_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ801512_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ801485_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341573_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341570_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSNSGTVSPAQTTVSAISSILSKT
JQ341565_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
FJ386642_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
EU939665_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSXISSILXKT
AB073831_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571321_MHBs_P-B      MRWNSTTFHQTLQ-NPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
LC349879_MHBs_P-B      VKWNSTTFHQTLQ-DPRVRALYSPAGGSSSGTVNPVQNTASTISSILSKT
LC349877_MHBs_P-B      MQWNSATFHQTLQ-DPRVRALYLPAGGSSSGAVSPVQNTASSISSILSKT
LC349869_MHBs_P-B      VKWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KY881842_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881826_MHBs_P-B      RQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881825_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KY881801_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSPISSILSKT
KY881798_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSPISSILSKT
KY881795_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSPISSILSKT
KY881793_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSPISSILSKT
KY881791_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSPISLILSKT
KY881790_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSPISSILSKT
KY881788_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSPISSILSKT
KY881782_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSPISSILSKT
KY629636_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAPNTVSAISSILSKT
KX276970_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSTT
KU964168_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964161_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964157_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP659219_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGAVNPAQNTASSISSILSKT
KP406298_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406277_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYVPAGGSSSGTVSPAQNTVSAISSILSKT
KP406272_MHBs_P-B      VQWNSITFLQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KP406265_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KP148451_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTTSSISSILSKT
KP148375_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTTSSISSILSKT
KP148369_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTTSSISSILSKT
KP148367_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KJ803796_MHBs_P-B      MQWNSTTVHQTLL-DPRVRALYFPAGGSSSGTVNPVQNTASPISSILSKT
KJ803784_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKT
KJ717807_MHBs_P-B      MQWNSTTVHQTLL-DPRVRALYFPAGGSSSGTVNPVQNTASPISSILSKT
KF053190_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKT
KC793115_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793056_MHBs_P-B      MKWNSTTSHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
KC793044_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGFSSGTVSPAQNTVSAISSILSKT
KC793041_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGAVSPAQNTVSAISSISSKT
KC792916_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792910_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSLGTVSPAQNTVSAISSILSKT
KC792889_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792887_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSETVSPAQNTVSAISSILSKT
KC792851_MHBs_P-B      MKWNSTTFHKTLQ-DPRVRALYIPAGGSSSGTLSPAQNTVSAISSILSKT
KC792844_MHBs_P-B      XQWNSTTFHQTLQ-DSRVRALYFPAGGSSSGTVSPAQNTVSAISSILSXT
KC792841_MHBs_P-B      MQWNSTTFHQTLQ-DPXVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KC792813_MHBs_P-B      MQWNSNTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792800_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792780_MHBs_P-B      XQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTVSVISSILSKT
KC792736_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KC792697_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792689_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792668_MHBs_P-B      MQWNSTNFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTVSAISSILSKT
KC774413_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX504538_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX504532_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPALNTVSAISSILSKT
JX429908_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX429902_MHBs_P-B      MRWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX026881_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
JQ341568_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
HM011484_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
AB014366_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGIVSPAQNTVSAISSILSTT
KC792662_MHBs_P-B      IKWNSXTFHQTLQ-DPKVRXLYXPAGGSSSGTVSPAQNTVSAISSILSKT
KC792664_MHBs_P-B      IKWNSPTFHKTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
MF674503_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
LC349871_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQSTASSISSILSKT
LC349870_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KY881837_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881836_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881834_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881831_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881829_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881828_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881823_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881822_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY881820_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSILSKT
KY881797_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSSISSILSKT
KY881789_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSPISSILSKT
KY881786_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSSISSILSKT
KY881784_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSSISSILSKT
KY881781_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSSISSILSKT
KY470837_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVTPAQNTVSAISSILSKT
KY470834_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVTPAQNTVSAISSILSKT
KX276818_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KX276784_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KU964254_MHBs_P-B      MQWNSATFHQTLQ-DPRVRALYLPAGGSSSETVSPAQNTVSAISSILSKT
KU964253_MHBs_P-B      MQWNSATFHQTLQ-DPRVRALYLPAGGSSSETVSPAQNTVSAISSILSKT
KU964252_MHBs_P-B      MQWNSATFHQTLQ-DPRVRALYLPAGGSSSETVSPAQNTVSAISSILSKT
KU964251_MHBs_P-B      MQWNSATFHQTLQ-DPRVRALYLPAGGSSSETVSPAQNTVSAISSILSKT
KU964250_MHBs_P-B      MQWNSATFHQTLQ-DPRVRALYLPAGGSSSETVSPAQNTVSAISSILSKT
KU964244_MHBs_P-B      MQWNSATFHQTLQ-DPRVRALYLPAGGSSSETVSPAQNTVSAISSILSKT
KU964110_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964109_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964108_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964106_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALNFPAGGSSSGTVIPAQNTVSAISSILSKT
KU964105_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALNFPAGGSSSGTVIPAQNTVSAISSILSKT
KU964100_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALNFPAGGSSSGTVIPAQNTVSAISSILSKT
KU964099_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALNFPAGGSSSGTVIPAQNTVSAISSILSKT
KU964097_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALNFPAGGSSSGTVIPAQNTVSAISSILSKT
KU964096_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVIPAQNTVSAISSILSKT
KU964095_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALNFPAGGSSSGTVIPAQNTVSAISSILSKT
KU964093_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALNFPAGGSSSGTVIPAQNTVSAISSILSKT
KP659247_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
KP659246_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
KP659245_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
KP659237_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
KP659224_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGAVNPAQNTASSISSILSKT
KP406257_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KP148383_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KM213034_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSPISSISSKT
KJ803789_MHBs_P-B      MQWNSTTFHQALL-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KJ717795_MHBs_P-B      MQWNSTTFHQALL-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KJ173423_MHBs_P-B      MQWNSTAFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKI
KJ173422_MHBs_P-B      MQWNSTAFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKI
KC793156_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPAQNTVSAISSILSTT
KC793073_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793064_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC793059_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTASPAQNTVSAISSILSKT
KC793057_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793054_MHBs_P-B      VQWNSTTFHKTLQ-DPRVRALYLPAGGSSSETVSPAQNTVSAISSILSKT
KC793047_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKT
KC793031_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRTLYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793021_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792938_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQTTVSAISSILSKT
KC792934_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRDLYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792919_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792913_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792901_MHBs_P-B      IQWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KC792877_MHBs_P-B      XQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVXPAQNTVSAISSISSKT
KC792875_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
KC792870_MHBs_P-B      XKWNSXTCHQTLQ-BPRVRALXLPAGGSSSGTVSPAQNTXSPISSXXSKT
KC792850_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792849_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KC792848_MHBs_P-B      VXWNSTTFHQTLQ-DPRVKALYLPAGGSSXGTVSPAQNTVSXISSISSKT
KC792822_MHBs_P-B      XQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
KC792750_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792743_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792742_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792728_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSSLSTT
KC792718_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGFSSGTVSPAQNTVSAISSXXSTT
KC792717_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSILSKT
KC792702_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774405_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPARNTVSAISSILSKT
KC774388_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ801479_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341579_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341571_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KY470838_MHBs_P-B      MQWNPTTFHQTLQ-DPRVRALYFPAGGSSSGTVTPAQNTVSAISSILSKT
KY470830_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALCFPAGGSSSGTVTPAQNTVSAISSILSKT
KX276824_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KX276823_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
KX276772_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSXT
KU964397_MHBs_P-B      MQWNSTTFHQNLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSTLSKT
KU964395_MHBs_P-B      MQWNSTTFHQNLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSTLSKT
KU964393_MHBs_P-B      MQWNSTTFHQNLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSTLSKT
KU964391_MHBs_P-B      MQWNSTTFHQNLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSTLSKT
KU964388_MHBs_P-B      MQWNSTTFHQNLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSTLSKT
KU964385_MHBs_P-B      MQWNSTTFHQNLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSTLSKT
KU964384_MHBs_P-B      MQWNSTTFHQNLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSTLSKT
KU964383_MHBs_P-B      MQWNSTTFHQNLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSTLSKT
KU964382_MHBs_P-B      MQWNSTTFHQNLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSTLSKT
KU964381_MHBs_P-B      MQWNSTTFHQNLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSTLSKT
KU964245_MHBs_P-B      MQWNSTTFHQTLH-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964165_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964163_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964160_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964159_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964158_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964149_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTT
KU964143_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTT
KU964139_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTT
KU964122_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964121_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964119_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964116_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964115_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KU964114_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964113_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964112_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964111_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963946_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP659255_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASPISSILSKT
KP659250_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTASSISSILSKT
KP406302_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406301_MHBs_P-B      MQWNSTTFHQNLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406297_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406295_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406278_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KP406275_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KP406258_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173386_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793193_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793058_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793029_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTASPAQNTVSAISSILSKT
KC793020_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793014_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALXFPAGGSSSGTVXPAQNTVSAISSILSKT
KC792991_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSXT
KC792956_MHBs_P-B      XKWNSTTFHQTLQ-DPXVRALYFPAGGSSSGTVSPAPNTVSAISSISSKT
KC792955_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792952_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792933_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKT
KC792908_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792898_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792888_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792852_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792843_MHBs_P-B      MQWNTTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792836_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792829_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRTLYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792827_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792797_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792795_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKT
KC792784_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792783_MHBs_P-B      MRWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
KC792766_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792756_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792747_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792735_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792714_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792705_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSXXSKT
KC792696_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792687_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792666_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792654_MHBs_P-B      MQWNSTTXHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774394_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774393_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774389_MHBs_P-B      MQWNSTTFHKTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774387_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC774386_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC510659_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC510657_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC510655_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC510651_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC510648_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC510644_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC510643_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC510642_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC492739_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX978431_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX869999_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX661482_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX661480_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
JX661479_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX661478_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX661477_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX661476_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX661475_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX661474_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX661473_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX661472_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX661471_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
JX507215_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX507213_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX507210_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX429900_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JX429899_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ801516_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ801507_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ801471_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ688405_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ412090_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341594_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSIXSKT
JQ341593_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341584_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341583_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341578_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNSVSAISSILSKT
JQ341575_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341574_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341564_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571339_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
M54923_MHBs_P-B        MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKT
LC349878_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKT
LC349873_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKT
LC349868_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVNPVQNTASSISSILSKT
KX276819_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQSTASAISSIXSKT
KU964258_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964132_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964082_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964080_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406285_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406280_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KP406276_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KP406274_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KP406270_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KP406268_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KP406264_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406263_MHBs_P-B      VQWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KP406255_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KJ803787_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKT
KJ717792_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKT
KC793166_MHBs_P-B      XQWNSTTFLQTLQ-DPRVRALYFPAGGSSSGTVSPAQXTVSATSSILSKT
KC793155_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKT
KC793153_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793070_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC793067_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRGLYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793055_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC793053_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
KC793043_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSETVSPAQNTVSAISSILSKT
KC793033_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSALSKT
KC793011_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793000_MHBs_P-B      MQWNXTTFLQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792994_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792990_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792980_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792978_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
KC792977_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSKT
KC792932_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KC792912_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792907_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792906_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792905_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAXSSIXSKT
KC792895_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792894_MHBs_P-B      MQXNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792893_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPVGGSSSGTVSPAQNTVSAISSILSKT
KC792892_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792884_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792874_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792872_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792869_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792865_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792864_MHBs_P-B      XQWNSTTFHQTLQ-DPRVRAXYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792858_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792856_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792838_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792832_MHBs_P-B      MQWNSTTFHQTLQ-DPXVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KC792828_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792823_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792804_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKX
KC792738_MHBs_P-B      MQWNXTXFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKT
KC792725_MHBs_P-B      MQWNXTTXHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKT
KC792651_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGPVSPAQNTVSAISSILSKT
KC792659_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSKT
KX276785_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAPNTVSAISSILSTT
MG571336_MHBs_P-B      IQWNSPTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSISSKT
MG571329_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571323_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQXTVSAISSILSKT
MG372436_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTLNPAQNTVSAISSILSTT
MF674506_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSILSKT
KY470840_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVTPAQNTVSAISSILSKT
KY470832_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVTPAQNTVSAISSILSKT
KU964152_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTT
KU964151_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTT
KU964150_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTT
KU964148_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTT
KU964147_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTT
KU964145_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTT
KU964144_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTT
KU964142_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTT
KU964140_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTT
KU964138_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSTT
KU964136_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964131_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQSTVSAISSILSKT
KU964107_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVIPAQNTVSAISSILSKT
KU964104_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVIPAQNTVSAISSILSKT
KU964103_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVIPAQNTVSAISSILSKT
KU964102_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVIPAQNTVSAISSILSKT
KU964101_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVIPAQNTVSAISSILSKT
KU964094_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVIPAQNTVSAISSILSKT
KR152339_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406311_MHBs_P-B      LQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSTT
KP406294_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406289_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406287_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406286_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406284_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406281_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406273_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406271_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP148330_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KM213032_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ803783_MHBs_P-B      MQWNSTTVHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSAISSTLSKT
KJ173385_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ173377_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KF053189_MHBs_P-B      MQWNSTTVHQTLQ-DPRVRALYFPAGGSSSGIVSPAQNTVSAISSTLSKT
KC793196_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSATSSILLKT
KC793122_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793120_MHBs_P-B      XQWNSTTFHQTLQ-DXRVRAXYFPAGGSSSGTVSPAQNTVSAISSISSXT
KC793099_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC793098_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793094_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KC793079_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793069_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVNPAQNTVSAISSILSRT
KC793062_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793052_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793027_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC793023_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC793018_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793013_MHBs_P-B      MQWNSTTFLQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793010_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793007_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KC793001_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792996_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792993_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792985_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792984_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792976_MHBs_P-B      MKWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNSVSAISSILSKT
KC792973_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792972_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792948_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KC792936_MHBs_P-B      XQWNXTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSXT
KC792930_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSILSTT
KC792928_MHBs_P-B      MQWNSSTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792917_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTT
KC792909_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792899_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792879_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRTLYFPAGGSSSRTVSPAQNTVSAISSILSKT
KC792871_MHBs_P-B      MQWNSXTFHQXLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792839_MHBs_P-B      MQWNSTTFHKTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792824_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792815_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSXTVSPAQNTVSAISSILSKT
KC792809_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792778_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341591_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341577_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341557_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSXTVSPAQNTVSAISSILSKT
KC792675_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSXTVSPAQNTVSXXXXXSSXT
KC792769_MHBs_P-B      MQWNSTTFLQTLX-DPRVRALYLPAGGSXSGTVSPAQNTVSAISSXFSXT
MG571325_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KY470839_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVTPAQNTVSAISSILSKT
KY470836_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVTPAQNTVSAISSILSKT
KY470835_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVTPAQNTVSAISSILSKT
KY470833_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVTPAQNTVSAVSSILSKT
KX276810_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KX276781_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964135_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964134_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964133_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964130_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964129_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964128_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964127_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964126_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964125_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU964124_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KU963980_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KP406317_MHBs_P-B      MQWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406316_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KP406315_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KP406313_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KP406310_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KP406309_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KP406308_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KP406307_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KP406306_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KP406304_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKT
KP406303_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406300_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406299_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406296_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406293_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406292_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406291_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406290_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVLAISSISSKT
KP406288_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVLAISSISSKT
KP406282_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KP406269_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406266_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP406262_MHBs_P-B      VQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKT
KP406260_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KP036970_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KJ803763_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSQT
KJ790200_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGIVSPAQNTVSAISSILSTT
KF053192_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSQT
KC793198_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793174_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793157_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793132_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSIXSKX
KC793049_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793022_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSXT
KC793002_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSXGTVSPAQNTVSAISSILSKT
KC792971_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792954_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTT
KC792945_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792925_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792900_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792867_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKT
KC792855_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792846_MHBs_P-B      VXWNSTTFHQTLQ-DPKVRALYFPAGGSSSGTVSPAQXTVSAISSILSXX
KC510660_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341566_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
MG571334_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSRTVSPAQNTVSAISSILSKT
KC793143_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793065_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSXISSILSKT
KC792866_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAPNTVSAISSILSKT
KC792819_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSRTVSPAQNTVSAISSILSKT
KC792814_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSXLSKT
KC792782_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792781_MHBs_P-B      IQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSATSSILSKT
JQ341606_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792992_MHBs_P-B      --WNYTTFHQTLQ-NPRVRALYFPAGGSSSGTVSPAQNTXSAISSILSTT
KC793170_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSXLSXT
KC793042_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792988_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSXTVSPAQNTVSAISSILSKT
KC792986_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSXT
KC792904_MHBs_P-B      MXWNSTTFHQTLQ-DPRVRALYXPAGGSSSGTVSPAQNTVSAISSILSKT
KC792859_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341586_MHBs_P-B      XQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
JQ341561_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793008_MHBs_P-B      MQWNSTTFHLTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276778_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KX276776_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSTT
KC793171_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSTT
KC793158_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793130_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793109_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSXISSILSKT
KC792950_MHBs_P-B      XQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVXPXQNTXSAISSIXSXT
KC792786_MHBs_P-B      XQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792774_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKT
KC792723_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792721_MHBs_P-B      MXWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILXXT
KX276805_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSXISSIXSKT
KX276779_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSXLSKT
KC793200_MHBs_P-B      MQWNXTTFHQTLQ-DPRVRALYXPAGGSSSGTVXPAQNTVSAISSILSKT
KC793060_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAXSSILSKT
KC792974_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792863_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSIXSXT
KC792730_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793015_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793199_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC793071_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792970_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGFSSGTVSPAQNTVSAISSILSKT
KC792983_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKT
KC792942_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTVXPAQNTVSXXSXXXSKT
KC792808_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYXPAGGSSSXTVXPAQNTVSAISSILSXT
KC793034_MHBs_P-B      MQWNSTTFHQTLQ-DPRVRALYFPAGGSSSGTASPXQNTVSXISSILSXT
                                                *.                       

JQ429081_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KU964272_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964273_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964274_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964275_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964276_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964277_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964278_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964279_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964281_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964284_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964285_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964280_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964283_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964286_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
EU660232_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGE
EU660233_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGE
EU882003_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB048705_MHBs_P-B      GDPASNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGG
DQ993696_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWGTSLNFLVG
AB287323_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KJ717801_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGE
AB900095_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
EU939667_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGE
DQ463797_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLXTKILTIPQSLDLWWTSLNFLGG
JN792895_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLXTKILTIPQSLDLWWTSLNFLGG
AB073853_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDLWWTSLSFLGE
AB900096_MHBs_P-B      GDPVTNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGG
JQ040157_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGG
FJ032358_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLAKILTIPQSLDSWWTSLSFLGG
AB287327_MHBs_P-B      GGPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
EF494380_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141631_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
MG571338_MHBs_P-B      GDPVPNMENTXLKLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
X97850_MHBs_P-B        GDPVPNMENIASGLLGHLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KC793181_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGG
JN792897_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC793188_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
JN604187_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ562253_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFSLLIKILTIPQSLDSWWTSLSFLGG
DQ993702_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073824_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964265_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964267_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964271_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
JQ027315_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGE
AY220698_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964257_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406251_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JN827419_MHBs_P-B      GDPVPNMENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
FJ032353_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY220697_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLSFLGG
MG826153_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276815_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
JQ341597_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
JQ341599_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
EU939675_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
EU939663_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB010290_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
MF674492_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KP406254_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406253_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGG
KP406252_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406249_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406248_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406246_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406245_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406244_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KJ803820_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ717836_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN604224_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILXIPQSLDSWWTSLNFLGG
HM011503_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
FJ899791_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
FJ899790_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
EU939674_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
DQ993701_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY629635_MHBs_P-B      GDPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964268_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964266_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964264_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964263_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964262_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964261_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964260_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP659253_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KP406250_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406161_MHBs_P-B      GDPVPNMENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ803808_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ717820_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793182_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGG
JQ040128_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY881904_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881824_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KX276827_MHBs_P-B      GDPVPNMENXSSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964146_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDLWWTSLNFLGG
KP406332_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KJ803817_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ803775_MHBs_P-B      GDLVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KJ717831_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KF053182_MHBs_P-B      GDLVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793118_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLXFLGG
KC792684_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
AB642093_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGE
AB010291_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
MG826152_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
MF674464_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KY881827_MHBs_P-B      GDPVPNMENIVSGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY417926_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276830_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KX276791_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964270_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGE
KU964269_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGE
KU964259_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGE
KU964256_MHBs_P-B      GDPVPNMENIASGLLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964255_MHBs_P-B      GDPVPNMENIASGLLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964248_MHBs_P-B      GDPVPNMENIASGLLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963854_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963827_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963826_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963825_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963824_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963823_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963822_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963821_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963820_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963819_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963818_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963817_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963815_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963814_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148349_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148343_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148342_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148340_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KM875416_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ843165_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLEG
KJ803773_MHBs_P-B      GDLVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KJ173378_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173376_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173375_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KF053180_MHBs_P-B      GDLVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793189_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLSFLGG
KC793077_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793032_MHBs_P-B      GDPXPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
X98077_MHBs_P-B        GDPVPNMESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571352_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
MF674461_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
MF674422_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
LT992442_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881833_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KX276829_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KU964141_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KP659238_MHBs_P-B      GDPVTNMENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGG
KP406243_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406242_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406241_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406240_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRNLDSWWTSLNFLGG
KP406238_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRNLDSWWTSLNFLGG
KP406236_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406235_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406234_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406233_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406232_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406231_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406230_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406229_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406228_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406227_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406226_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406225_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406224_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406223_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406222_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406221_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406220_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP406165_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KP406163_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KP148348_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ717797_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KJ173402_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173401_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173368_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KJ173360_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793126_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
JN604311_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
HM011483_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
MG571337_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674383_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881868_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881867_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KY881866_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881848_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276817_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGX
KX276771_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTRVLTIPQSLDSWWTSLNFLGG
KP659251_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KP406335_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP406334_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP406333_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP406331_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP406330_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP406322_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP406321_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP406320_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP406319_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP406318_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP406219_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406217_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406214_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406210_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406208_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406203_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406200_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406199_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406197_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406195_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406192_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406189_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406188_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406187_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP148581_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFLLLTKILTIPQSLDSWWTSLNFLGG
KJ803825_MHBs_P-B      GDPVQNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KJ803816_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
KJ717843_MHBs_P-B      GDPVQNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KJ717829_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
KC793194_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC793163_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPLSLDSWWTSLSFLGE
KC793151_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
KC793124_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGG
MG571364_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571362_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571360_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571355_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571349_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571333_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
MF674512_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674404_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881838_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGE
KY881800_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY881785_MHBs_P-B      GDPVPNVENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY470962_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY470954_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276800_MHBs_P-B      GDPVQNMENIASGLLGPLLVLQAGFFLLTKILIIPQRLDSWWTSLNFLGE
KX276788_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964293_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964167_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964162_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964155_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964120_MHBs_P-B      GDPVPNMENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KU963979_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963968_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963963_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963962_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963955_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963948_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KT749820_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP148582_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148579_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148361_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148347_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148346_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148345_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148344_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148341_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148339_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148338_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP148336_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148325_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148324_MHBs_P-B      GDPVPNMENIASGLLGPMLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148322_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KM875421_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KM875420_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KM875417_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KM392084_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KM213036_MHBs_P-B      GDPVPKMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGG
KM213035_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KJ717842_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KJ717830_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173404_MHBs_P-B      GDPVPNMKNIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173390_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173389_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173388_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173387_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173366_MHBs_P-B      GDPVPNMENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173365_MHBs_P-B      GDPVPNMENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173362_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173361_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173357_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173356_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173355_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173353_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173341_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793185_MHBs_P-B      GDPVPNMENIXSXXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
KC793091_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793086_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLSFLGG
JQ341567_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGE
MG571361_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571326_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGD
MF674465_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
MF674426_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGVFFFXKNLTKPHSLDSWWTSLNFLGG
KY881839_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881830_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KX276796_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KU963977_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963976_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963970_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP406237_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLSFLGG
KP148314_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KJ803801_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ803756_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ717813_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KF053163_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793190_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793154_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGE
KC793145_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLSFLGE
KC793134_MHBs_P-B      GDPVQNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793083_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKIRTIPQSLDSWWTSLNFLGE
KY881796_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964123_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP659249_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLSFLGV
KP406218_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406215_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406213_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406211_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406209_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406207_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406206_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406205_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406204_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406202_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406201_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406198_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406196_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406193_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406191_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406186_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406185_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406184_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406183_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406181_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406180_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406178_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406177_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406176_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KM875427_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KM875426_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNSLGG
KJ803821_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNSLGE
KJ717837_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNSLGE
KJ173374_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGG
KC793197_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAVFFSLTKILTIPQSLDSWWTSLSFLGG
KC793191_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGG
KC793172_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
HM011477_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
X97851_MHBs_P-B        GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MK075117_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MH932712_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
MH663473_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MH061283_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571374_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571373_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571371_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571369_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571368_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571367_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571365_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571356_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571354_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
MG571350_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571347_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571346_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571344_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571342_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571340_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571328_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571322_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674485_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674450_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674449_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674427_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674391_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881779_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881778_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881761_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881760_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881759_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881757_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881756_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881753_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881752_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881747_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881746_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881745_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881741_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881740_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881735_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881734_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881733_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881732_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881731_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881730_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881729_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881728_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881727_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881726_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881725_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881724_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881723_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881722_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881721_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY470961_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY470960_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY470956_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY470953_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLDFLGG
KX765856_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276812_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KX276809_MHBs_P-B      GDPVTNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KX276803_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276801_MHBs_P-B      GDPVTNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276793_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276773_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964302_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964301_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964300_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964299_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964298_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964297_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964296_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964295_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964294_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964292_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964291_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964290_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964289_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964288_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964287_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU964164_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964092_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964091_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964090_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964089_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964088_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964087_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964086_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964085_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964084_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964083_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964081_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964079_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963989_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963988_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963986_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963985_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963984_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963983_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963982_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963981_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963978_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963975_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963974_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963973_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963972_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963971_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963969_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963967_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLESWWTSLNFLGG
KU963966_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963965_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963964_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963961_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963960_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963959_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963958_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963957_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963956_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963954_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963953_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963952_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963951_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963950_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963949_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963947_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963945_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963855_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963853_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963852_MHBs_P-B      GDPVQNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963851_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963850_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963849_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963848_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963847_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963846_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963845_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963844_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963843_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963842_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963841_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963840_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963839_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963838_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963837_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963836_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963835_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963834_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963833_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSLWTSLNFLGG
KU963832_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963831_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963830_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963829_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963828_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963816_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963813_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963812_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963811_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963810_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963809_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963808_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963807_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963806_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963805_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963804_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963803_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963802_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963801_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963800_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU963799_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP406216_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406212_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406194_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406190_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406182_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406179_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP148366_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148365_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148364_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148363_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148362_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148360_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148359_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148357_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148356_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148335_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148334_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148333_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148332_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148331_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148329_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148328_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148327_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148326_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148323_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148321_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148320_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148319_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148318_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148317_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KM392083_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KM392072_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KM359440_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ803764_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ803752_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KJ410517_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ410516_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ410507_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ410502_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KJ410500_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ410490_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173425_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173424_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173421_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173420_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173419_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173418_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173417_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173416_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173415_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173414_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173413_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173412_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173411_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173410_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173409_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173408_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173407_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173406_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173405_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173403_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173400_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173399_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173398_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173397_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173382_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173381_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173369_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173367_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173364_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173363_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173359_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173354_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173352_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173351_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KJ173348_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173347_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173345_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173343_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173340_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173339_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KF053171_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793186_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC793183_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793179_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793178_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793176_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793173_MHBs_P-B      GDPVPNMENXASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGG
KC793168_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793167_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793165_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793147_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KC793146_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793144_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793135_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793131_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793125_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
KC793121_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793117_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793113_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGG
KC793105_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793102_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793101_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793096_MHBs_P-B      GDPVXNMENXASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFLGX
KC793090_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793089_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793085_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793084_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGG
KC793082_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MK818223_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGXFLLTKILTIPQSLDXWWTSLSFLGG
MG571351_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KX276804_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGE
KC793116_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGG
KC793080_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGG
KC792939_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAXFFLLTKILTIPQSLDSWWTSLSFLGG
KX276808_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276806_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793180_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793175_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGG
KC793152_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
KC793128_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KC793127_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571358_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
MG571357_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
MG571341_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KX276811_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KX276777_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KU963987_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KM875418_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793140_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793114_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793095_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793087_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGX
KC793081_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KX276799_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KX276792_MHBs_P-B      GDPVPXMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KX276786_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC793164_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KC793139_MHBs_P-B      GDXVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGG
KC793136_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC793111_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793088_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KX276797_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQXLDSWWTSLSFLGG
KX276795_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGA
KX276794_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAXXFXLTKILTIPQSLDSWWTSLSFLGG
KC793192_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KX276802_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KX276790_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276798_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGX
KC793148_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793075_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLXTKILTIPQSLDXWWTSLSFLGG
KC793161_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KP406323_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP406324_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP406325_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP406326_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP406327_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP406328_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP406329_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFSLLTKILTIPQSLDSWWTSLNFLGG
DQ463791_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGD
JN604130_MHBs_P-B      GDPVPNMADITSGLLXPLLALQAGFFSLTKILTIPQSLDSGWTSLNFLGG
DQ141654_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141621_MHBs_P-B      GDPVPKMENIASGLLGPLLVVQEGIFSLTKILTIPQSLESGWTSLNFLGE
DQ141641_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KJ717840_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KJ803824_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLSFLGG
FJ562260_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILXIPQSLDSWWTSLSFLGG
KJ717835_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KJ803819_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KJ717798_MHBs_P-B      GDPVPNMENIASGLLKPLLALQAGFFLLTKILTMPQSLDSWWTSLSFLGG
JQ027325_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLSFLGG
KP406173_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KP406172_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KP406171_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KP406167_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KX276828_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KC792920_MHBs_P-B      GDPVPNMENIASGXLGPLLXLQAXFFLXTKILTIPQSLDSWWTSLSFLGG
KC792963_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGX
KP148419_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148426_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148427_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148430_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148439_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148438_MHBs_P-B      GDPVPNMENIASGLVGPLLASQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148414_MHBs_P-B      GDPVPNMENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148409_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148406_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKIPTIPQSLGSWWTSLNFLGG
KP148405_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148411_MHBs_P-B      GDPVPNMENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148413_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148415_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148420_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148423_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148425_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148429_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148416_MHBs_P-B      GDPVPNMENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148437_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148424_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148435_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148440_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148407_MHBs_P-B      GDPVPNMENISSGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148433_MHBs_P-B      GDPVPNMENISSGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148410_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148418_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148432_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924621_MHBs_P-B      GDPVPNMENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN604123_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KY881955_MHBs_P-B      GDPAPNMENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881954_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY881944_MHBs_P-B      GDPAPNMENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881945_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KY881946_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881947_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KY881948_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881949_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KY881950_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KY881951_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KY881952_MHBs_P-B      GDPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881956_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KY881957_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KY881958_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KY881953_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
DQ141647_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141651_MHBs_P-B      GDPVQNMENIASGLLGPLLVLQAGFFLLTKILTIPQRLDSWWTSLNFLGG
KX276996_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
EU660230_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGE
EU660231_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGE
DQ141639_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB219429_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ023638_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU330995_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTEILTIPQSLDSWWTSLNFLGG
FJ023637_MHBs_P-B      GDPAPNMENIXSXLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ358148_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU330989_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU330990_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU330994_MHBs_P-B      GDPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU330996_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU330997_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU330998_MHBs_P-B      GDPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU330999_MHBs_P-B      GDPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU331000_MHBs_P-B      GDPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU331001_MHBs_P-B      GDPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924635_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ358149_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ358151_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ358152_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ358150_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
HM011487_MHBs_P-B      GDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSLWTSLSFLGG
DQ141634_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
DQ141637_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY800391_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
AY800392_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
AB713528_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141635_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
DQ141636_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSGWTSLNFLGG
AB713529_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB713530_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB033554_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
AB493835_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141644_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141642_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141629_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141624_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB713527_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141622_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EF473971_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EF473972_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB033555_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB219430_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB493827_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB713531_MHBs_P-B      GDPVPNMEDIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB976562_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AP011085_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141623_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141627_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141630_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
DQ141632_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141633_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141645_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141646_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ358136_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141628_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
GQ924656_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AB219427_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AB219426_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN604141_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ358143_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
GQ358140_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ358137_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141650_MHBs_P-B      GDPVPNMENIESGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EF473976_MHBs_P-B      GDPVPNMENIESGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AP011091_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AP011092_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AP011088_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AP011090_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141648_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141649_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141652_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141653_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EF473977_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ358138_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ358139_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGG
GQ358141_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ358142_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
HQ700549_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341590_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
GQ924624_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AP011096_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AP011094_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
AP011093_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AP011089_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB493833_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JN792896_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924645_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFREG
DQ141655_MHBs_P-B      GDPVPNMENIASRLPRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLRG
GQ358144_MHBs_P-B      GDPVPNMENIASRLPRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLRG
AB241117_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AB219428_MHBs_C-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AP011086_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AP011087_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AP011095_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924640_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924651_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924654_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774418_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ358145_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ358146_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ358147_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148398_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148391_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148387_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148380_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDPWWTSLNFLGG
KP148376_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGG
KP148373_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTMPQSLDSWWTSPNFLGG
KP148371_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
HM011496_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
HM011467_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
JQ027334_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP148403_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148401_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148399_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148397_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148396_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148395_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148394_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148392_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148390_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148389_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148388_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148386_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148385_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148384_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148382_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148379_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148378_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148374_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148372_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148370_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148368_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
HM011499_MHBs_P-B      GDPVLXMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGX
HM011469_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGX
KX276822_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
JQ027311_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDXWWTSLXFLGG
JQ341554_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924630_MHBs_P-B      GDPVPNMENIASGLLKPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGD
DQ463795_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTTPQSLDSWWTSLSFLGG
AB642101_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFRGE
GQ924641_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQVGFSLLTKILTIPQSLDSWWTSLSFLGG
KC792847_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGV
HM011492_MHBs_P-B      GDPVSNMENITSGLLRPLLGLQAGFFLLTKILTIPQSLDSLWTSLSFLGG
FJ386608_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGE
EU881997_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU939637_MHBs_P-B      GDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AB931169_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGV
DQ904357_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AY596103_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGG
AB073839_MHBs_P-B      GDPVPNMETISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGD
AB073837_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793092_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
HM153811_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU939670_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKVLTIPQSLDSWWTSLSFLGG
EU139543_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP406247_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JQ027312_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
AY217355_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
AB900110_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
KC792915_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
HM011470_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
FJ386655_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU939671_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
EU939669_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
EU564822_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGV
EU547563_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGX
JQ281243_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGG
GQ377558_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY518556_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793104_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKIHTIPQSLDSWWTSLNFLGE
JX504543_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLSFLGG
JX504531_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ040138_MHBs_P-B      GDPVLNMENIASGLLRPLLVLQAGFFLLTKILTXPQSLDSWWTSLNFLGG
JN604124_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ899779_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
AY206383_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
FJ562224_MHBs_P-B      GDPVPNMENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792878_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGG
KC792810_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC792678_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KC792648_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
JQ801474_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
JQ040171_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
HM011504_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KC792805_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC792812_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDXWWTSLNFLGE
KC793016_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGE
KC793005_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC792837_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGG
JQ341582_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
JQ341572_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
JQ341563_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281206_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KJ803768_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSLWTSLNFLGE
KF053174_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSLWTSLNFLGE
KC792903_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792825_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
JQ341552_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ040170_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792981_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792861_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC792787_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792760_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
JQ341592_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
JQ341569_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
JQ341562_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
JQ341558_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ040173_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ040125_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN604134_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN406371_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JF899335_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JF412801_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
HM011480_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQXLDSWWTSLSFLGE
JQ341550_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
HM011494_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFXXLXKILTIPQSLDSWWTSLXFLGG
JQ341553_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGG
KC792854_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341551_MHBs_P-B      GDPVPNMENIASGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792749_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793138_MHBs_P-B      GDPVPNMENIXSGLLGPLLVXQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793006_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792944_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792924_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792765_MHBs_P-B      GDPVXNMENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGX
JQ341600_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
JQ341556_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
JQ341559_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGX
KC792773_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGX
KP406314_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406312_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406305_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406283_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792997_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTXPRSLDSWWTSLNFLGE
KC793160_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792885_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
JQ040147_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGX
JN604127_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792960_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGG
KC792802_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
JQ341581_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFXGX
KC792882_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792727_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
HM011482_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KX276813_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFLLTKILTIPQNLDSWWTSLNFLGX
KC792758_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
HM011478_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGX
KC792744_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLXFLGX
EU939634_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGG
AB117759_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
DQ993686_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
DQ993682_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
AB073835_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
DQ993680_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
DQ993681_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
DQ993683_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
DQ993685_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
AB212626_MHBs_P-B      GDPVPNMGNIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
JQ281224_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
JN604219_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB031267_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
GQ924626_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
JQ281141_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB205122_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JN604212_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ023635_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY517489_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY033073_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB115551_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB231909_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY517619_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ023632_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ023634_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ349236_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN604125_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN604143_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN604154_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN604284_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
HQ700546_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY033072_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ023633_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN604223_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN604119_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
JQ281143_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281140_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281139_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN604234_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFXGG
JQ281137_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGX
JQ281138_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGX
JQ707747_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281190_MHBs_P-B      GGPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGG
JQ281157_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
JQ281132_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JN604138_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKIPTIPQSLDSWWTSLSFLGG
JN604132_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
DQ993684_MHBs_P-B      GDPVPNMENIASGLQGPLLVLQAGFFLLTKSLTIPQSLDSWWTSLNFLGG
MF621878_MHBs_P-B      GDPVQNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGE
JQ281185_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB212625_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
JQ707767_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707749_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707734_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707737_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707738_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707739_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707742_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707743_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707744_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707745_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707746_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707750_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707753_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707755_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707758_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707759_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707762_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707763_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707765_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707766_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ707740_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281258_MHBs_P-B      GDPVPNMENITSGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLXFLGG
AB368295_MHBs_P-B      GDPVPNMENIASGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLSFLGE
JQ707735_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB100695_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSLWTSLNFLGE
JQ281170_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
JQ281160_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGE
MF674505_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674447_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674440_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGG
MF674432_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281234_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGG
JQ281229_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281217_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281216_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281213_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281204_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281203_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281150_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JQ281171_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
MF674416_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674406_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
JQ341601_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
JQ341585_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281238_MHBs_P-B      GDPVQNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
JQ281231_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JQ281202_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281153_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
MF674515_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674513_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674511_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674500_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674498_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674496_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
MF674493_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674487_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674477_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674476_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674469_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGG
MF674466_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
MF674455_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674452_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674451_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674446_MHBs_P-B      GDLVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
MF674439_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
MF674438_MHBs_P-B      GDPVLNMENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674437_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674431_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674414_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
MF674413_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674405_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674400_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674395_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674394_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674393_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674389_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341603_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341596_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
JQ281253_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQXLDSWWTSLNFLGG
JQ281246_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281245_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281237_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JQ281235_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281228_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281227_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JQ281226_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGG
JQ281225_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JQ281223_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281220_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281215_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281212_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281211_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281210_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281208_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281200_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281199_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281197_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281194_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JQ281192_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281186_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQXLDSWWTSLNFLGG
JQ281184_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281178_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281168_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281159_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281154_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGE
MF674460_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674407_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILKIPQSLDSWWTSLNFLGG
JQ281240_MHBs_P-B      GDPVPNMENIASGLLGPLLVXQAGXFXLTKILTIPQSLDSWWTSLNFLGX
JQ281196_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281149_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674509_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674497_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674490_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674488_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674470_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674453_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674410_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674397_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674384_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674382_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341588_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281257_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281209_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281187_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281180_MHBs_P-B      GDPVQNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281179_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281176_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281172_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281166_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281165_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281151_MHBs_P-B      GDPVPNMENIASGLLGPLLVXQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281144_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281147_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674508_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
JQ707764_MHBs_P-B      GDPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
JQ281131_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
JN604244_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
MF674462_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ023636_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ993687_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFSLTKILTIPQXLDSWWTSLNFPGG
MF674424_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674415_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
MF674396_MHBs_P-B      GDPVPNMENIASGLPGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281148_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGG
JQ281129_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
MF674491_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
MF674478_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
MF674473_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
JQ281252_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLNFLGE
JQ281221_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFXLTKILTIPQSLDSWWTSLNFLGE
JQ281158_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGX
JN604221_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILXIPQSLDSWWTSLNFLGE
JQ341605_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGG
JQ281256_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281242_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JQ281193_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGE
JQ281188_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281164_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
JN604253_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
JN604213_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGD
MF674495_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674483_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674482_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674481_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674459_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
MF674456_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674423_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674420_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674419_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674409_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674387_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674385_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU234318_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341589_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
JQ281255_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFXGG
JQ281254_MHBs_P-B      GDPVQNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281249_MHBs_P-B      GDPVQNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281189_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281181_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281167_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSXWTSLNFLGG
JQ281134_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGE
JQ281214_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
JQ341604_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
JQ341608_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674436_MHBs_P-B      GDPVLNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
MF674401_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
JQ281236_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
MF674510_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674507_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
MF674499_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
MF674445_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
MF674443_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674441_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
MF674434_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674433_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674421_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674392_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JQ281244_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTXPQSLDSWWTSLNFLGX
JQ281248_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTXPQSLDSWWTSLNFLGX
JQ281239_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFXLTKILTIPQSLDSWWTSLXFLGX
KX765841_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
JQ341580_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JQ281241_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFXGG
JQ281230_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGX
JQ281218_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKIXTIPQSLDSWWTSLNFLGG
JQ281195_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFXGG
JQ281133_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPXSLDSWWTSLNFLGG
JQ281163_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQXGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281161_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGG
JQ281207_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281222_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLXFLGG
JQ281152_MHBs_P-B      GDLVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFLGG
JQ281205_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ717808_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGE
KJ803797_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGE
KJ717805_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGE
KJ717806_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGE
KJ803795_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGE
KF053194_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGE
KJ803781_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGE
D50521_MHBs_P-B        GDPVPNMENIASGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGG
AB287326_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
D50522_MHBs_P-B        GDPVPNMENIASGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
EU796068_MHBs_P-B      GDPVPNMVNIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073852_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEG
AF121243_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AF121244_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AF121245_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AF121246_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377519_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924627_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073848_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB205121_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQRLDSWWTSLNFLGG
EU306699_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY206373_MHBs_P-B      GDPVPNMENITSGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ032349_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386675_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ995801_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AY596111_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGE
FJ386636_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141618_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EF473974_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815635_MHBs_P-B      GDPVPNMENIASGLLKPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924606_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377567_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
FJ899787_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTTPQSLDSWWTSLSFLGE
FJ562316_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AY220704_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815565_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815567_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815576_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073828_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ993697_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ993698_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGE
DQ993699_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGE
EU939672_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
FJ899784_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
FJ899785_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
FJ899786_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
GU815657_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815656_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815644_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815643_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815639_MHBs_P-B      GDPVPNMENIASGLLEPLLVLQAGLFLLTKILTIPQSLDSWWTSLNFLGG
GU815619_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ475340_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
FJ562259_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGE
FJ518812_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386676_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
FJ386600_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU564824_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU439020_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ562254_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306711_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ993709_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ993700_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ448625_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY220703_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY167100_MHBs_P-B      GDPVPNMENIVSGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGG
GU815560_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377639_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377537_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU570075_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGG
AY167102_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AF121248_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306680_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306679_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AF100309_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073822_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073826_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073827_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073834_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073836_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815677_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815676_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815675_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815674_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815673_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815672_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815669_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815668_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815667_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815666_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815665_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815664_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815663_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815662_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815661_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815660_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815659_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815658_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815654_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815653_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815652_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815651_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGSFLLTKILTIPQSLDSWWTSLNFLGG
GU815650_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815649_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815648_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815647_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815646_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815645_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815642_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815641_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815640_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815638_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815637_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815636_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815632_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815631_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815630_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815629_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815628_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815627_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815626_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815625_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815624_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815623_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815622_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815621_MHBs_P-B      GDPVPNMENIASGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815620_MHBs_P-B      GDPVPNMENIASGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815618_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815617_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815571_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815569_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815568_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815566_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815564_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815561_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815559_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815556_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815555_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815554_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815553_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815552_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815551_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815549_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU434373_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU434372_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924653_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924632_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924611_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924610_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924608_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924605_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924603_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377643_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377641_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377638_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377625_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377612_MHBs_P-B      GDPVPNMENIVSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377588_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377569_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377568_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377566_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377547_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377542_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ787444_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ562322_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386684_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386683_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386681_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386668_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386666_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386660_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386615_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386584_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386583_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386582_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ032354_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ032352_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU570071_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU570070_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU439023_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU439022_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU439021_MHBs_P-B      GDPVPNMESIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU439018_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU350409_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306712_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306710_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306708_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306707_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306706_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306705_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306704_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306703_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306702_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306701_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306700_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ993708_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ993706_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ993704_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ993703_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ448628_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ448627_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ448626_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ448624_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ448623_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ448621_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ448619_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141620_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY766463_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY293309_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY167097_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AF479684_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AF282918_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AF121249_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AF100308_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB471855_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB471854_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQRLDSWWNSLNFLGG
AB300364_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB287328_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB246339_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073840_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWXTSLNFLGG
AB195933_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU939638_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSLWTSLSFLGE
EU306681_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306678_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386654_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ562289_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
FJ562231_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AF121247_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
FJ562222_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AB287329_MHBs_P-B      GDPVPNMENIASGLLKPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AF121250_MHBs_P-B      GDPVPNMENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY206375_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU564823_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU522072_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU522074_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141616_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141617_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EF473975_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU305547_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386658_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGE
EU305548_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY217368_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
D00330_MHBs_P-B        GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386610_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815550_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
FJ562257_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
FJ562236_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGE
EU939666_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
AY167093_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
AF282917_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
GQ377610_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGE
AB073829_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU595031_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY800389_MHBs_P-B      GDPVPNMENIASGLLGPPLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815578_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
GU815577_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
GU815575_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
GU815574_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
GU815572_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
GU815570_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
GU815563_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
GU815562_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
GU815558_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
GU815557_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
GU815548_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
GQ924648_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
GQ377629_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGE
GQ377622_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
GQ377525_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
FJ562234_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFSSLTKILTIPQSLDSWWTSLNFLGE
FJ562219_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
AY596105_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
AB073833_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFXSLTKILTIPQSLDSWWTSLNFLGE
AY167098_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
AB195934_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
AB195935_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
DQ995804_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLGFPGG
DQ463787_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ463802_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN792894_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGG
DQ463799_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGD
DQ463793_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
DQ463801_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
JN792893_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
DQ463800_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
JN792898_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
DQ463792_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
DQ463796_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ463788_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ463790_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ463798_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN792899_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN792900_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ995802_MHBs_P-B      GDPVPNMENISSGLLGPLLVLRAGFFSLTKILTIPQSLDSWWTSLNFLGE
AF121251_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGQ
FJ023631_MHBs_P-B      GVPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
AB900098_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
AB246343_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWLTSLSFLGE
HM011471_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLSFLGE
GU357842_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGG
AB073857_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQARFFLLTKILTIPQSLDSWWTSLNFLGG
AB302095_MHBs_P-B      GDPVTNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU939633_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
HM011476_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEG
GU815773_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815776_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU919172_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB555499_MHBs_P-B      GDPAPNMENIASGLPGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792881_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAAFSLWTRILTIPQSLDSWWTSLSFLGG
GQ924647_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
EU939661_MHBs_P-B      GDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU919173_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ032342_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
FJ032344_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
AB073854_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
AB900107_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
EU882004_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU564826_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073849_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
KC793017_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGYFSLTKILTIPQSLDSWWTSLSFLGD
KC792998_MHBs_P-B      GDPVLNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPEG
KC792777_MHBs_P-B      GDPVXNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWXSLNFRGG
GU815783_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815772_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ562312_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
EU487257_MHBs_P-B      GDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AJ627225_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGG
AB900097_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGG
AB362933_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AB073821_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792953_MHBs_P-B      GDPVSNMENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC774412_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN604149_MHBs_P-B      GDPVPNMDNITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU939635_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGYFSLTKILTIPQSLDSWWTSLNFLGE
EF134945_MHBs_P-B      GDPVPNMENIASGLLGPPLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073838_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KY881787_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792688_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JX026883_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGG
JQ429082_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281156_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815722_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815587_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWRTSLNFLGG
GU815581_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924644_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ562321_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386680_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
EU939673_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
EU939664_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGE
AB900106_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
AB900105_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AB900104_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
AB073844_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KC792709_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
KC792683_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGE
KC792660_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
JQ281247_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
GU815782_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815781_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815777_MHBs_P-B      GDPVPNMENITSGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815775_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815774_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815756_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815713_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815711_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU451682_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386682_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGE
EU306709_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EF494381_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
EF134946_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ993710_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGE
AY217358_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
AY217357_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
AY217356_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
AY167101_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGE
AB900108_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AB900102_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGG
AB246340_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
AB073845_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY881893_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP659223_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGE
KJ717796_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KJ173298_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173297_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792897_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KC792788_MHBs_P-B      GDPAPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KC774367_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX870001_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
HM011474_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
HM011466_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
GU815780_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
GU815681_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815584_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
D23679_MHBs_P-B        GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
AY217359_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY206390_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB900112_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
AB205120_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792741_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792733_MHBs_P-B      GDLVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC774362_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JX504533_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAVFFSLTKILTIPQSLDSWWTSLNFLGG
JQ341549_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ281177_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN604146_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN604122_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815779_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815771_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815770_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815769_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815768_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815767_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815766_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815765_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815764_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815762_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815761_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815760_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815759_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815757_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815755_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815754_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815753_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815752_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815751_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815750_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815749_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815748_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815747_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815746_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815745_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815744_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815743_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815742_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815740_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815739_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815738_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815737_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815736_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815735_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815734_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815733_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815732_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815731_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815730_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815729_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815728_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815727_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815726_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815725_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815724_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815721_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815720_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815719_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815718_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815717_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815716_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815715_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815712_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815710_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
GU815709_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815708_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815707_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
GU815706_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
GU815705_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815704_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815703_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815702_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
GU815701_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
GU815700_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815699_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815698_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815697_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815696_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815695_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815694_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815693_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815692_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815691_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815689_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815688_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815687_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815686_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815685_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815684_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815683_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815680_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815679_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815614_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815613_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815612_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815610_MHBs_P-B      GDPVPNMENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815609_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815608_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQVGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815607_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815606_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815605_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815604_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815603_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815602_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815601_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815600_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815599_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815598_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815597_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815596_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815595_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815594_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815593_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815591_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815590_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815589_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815588_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815586_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815585_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815583_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815579_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924634_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924631_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924607_MHBs_P-B      GDPVPNMENIASGLIGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU939677_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
EU919176_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU919175_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU919171_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
EU882002_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU796066_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
EU522067_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306698_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306697_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306696_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU306695_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EF473973_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
DQ448622_MHBs_P-B      GDSVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ448620_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ377158_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141619_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
D23678_MHBs_P-B        GDPVTNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
D00329_MHBs_P-B        GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY596112_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
AY596110_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY596109_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY596106_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
AY596104_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
AY596102_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY217360_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881910_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881908_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881906_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881899_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881863_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881858_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881857_MHBs_P-B      GDPAPNMENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881799_MHBs_P-B      GDPVPNMEKIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792975_MHBs_P-B      GDPVPNMENIXSGLLGPLLVFQAGFFLLTKILTIPMSLDSWWTSLSFLGG
KC774416_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774410_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774404_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774402_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774396_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774380_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774375_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774370_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774368_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510653_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510646_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX661483_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX429910_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX026886_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
GU815778_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ386634_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU158263_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ141615_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
AY217362_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881909_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173342_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793009_MHBs_P-B      GDPVPNMENIASGPLGPLLVLQAGFFLLTKILTIPQXLDSWWTSLNFLGE
KC792947_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGD
KC792820_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792798_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792754_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792724_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KC792692_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGG
KC774369_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510658_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MK052965_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MK052964_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MK052962_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173372_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173371_MHBs_P-B      GDPVPNMENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793106_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792821_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGE
KC792729_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792671_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
KC792661_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792657_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KY881914_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881913_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881912_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KY881911_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KY881905_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881903_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881902_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881901_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881900_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881898_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881897_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881896_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881895_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881894_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881862_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881861_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881860_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881859_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881855_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881854_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881852_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881846_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881844_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793177_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGE
KC792937_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792931_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KC792896_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
KC792860_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KC792811_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFPGG
KC792764_MHBs_P-B      GDPVPNMDNITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLEG
KC792763_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
KC792755_MHBs_P-B      GDPXPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792748_MHBs_P-B      GDPVXNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC792698_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKIXTIPQSLDSWWTSLNFLGG
KC792674_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792667_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792663_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC774419_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774417_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774415_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KC774411_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774409_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774408_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774407_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774406_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774403_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774401_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774400_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774399_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774398_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774395_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774392_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774391_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774390_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774385_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774384_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774383_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774382_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774381_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774379_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774378_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774377_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774374_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774373_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774372_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774371_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774366_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774365_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774363_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510652_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510650_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510649_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510647_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510641_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX661484_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX661481_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX661470_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX429901_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
JQ801524_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JQ801514_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ801494_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
JQ341609_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
HM011473_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGE
MG571327_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILIIPQSLDSWWTSLNFLGE
MF674480_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MF674479_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
LC279273_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
LC279272_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
LC279271_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
LC279270_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
LC279269_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
LC279268_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881847_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFPGG
KR232337_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793150_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC792967_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792964_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792807_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792789_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792772_MHBs_P-B      GDXAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC792768_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGG
KC792731_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792711_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792685_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ801506_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP659220_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
KC793078_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793048_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC793004_MHBs_P-B      GDPVPNMENXASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KC792835_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792761_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFXGE
KC792701_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEG
KC792650_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFSLIKILTIPQSLDSWWTSLXFLGG
JQ341598_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
AY167094_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGX
KY881907_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLSFLGG
KC792987_MHBs_P-B      GDPVPNMENIXSGXLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGE
KC792949_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792890_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792845_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KC792840_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKXLXIPQSLDSWWTSLNFXGG
KC792767_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792686_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
KC792676_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFLGX
KC792791_MHBs_P-B      GDPVPNMENIASRLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGX
KC792677_MHBs_P-B      GDPVPXMENIASGLLGPLLVLQAGFFLLTKILTIPXSLDSWWTSLSFLGX
KC793072_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGX
KC793137_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793045_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792796_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTXPQSLDSWWTSLXFLGG
KC792665_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGX
KC792649_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSXLGX
JQ341595_MHBs_P-B      GDPXXNMENIASGLLGPLLVLQAGFFLLTKILTXPQSLDSWWTSLSFLGG
KX276807_MHBs_P-B      GDPXPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KX276962_MHBs_P-B      GDPVPNMETIASGLLRPLLVLQAGFFLLTKILTMPQSLDSWWTSLNFLGG
KF053191_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KJ803786_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGE
JF436921_MHBs_P-B      GDPVPNMATNLSELLKLLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924617_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLSFLGG
DQ141626_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLNSWWTSLNFLGG
AB287325_MHBs_P-B      GDPVQNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
EU579441_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSPNFPGG
FJ386656_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGG
EU589335_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGG
GQ924639_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
GQ924638_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
DQ141643_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY163869_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY163870_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073851_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JN792901_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JN792902_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
AB302942_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AB302943_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AB302944_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AB302945_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
GQ377606_MHBs_P-B      GDPVPNMENITSGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
DQ141638_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377644_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFLLTKILTIPQSLDSLWTSLSFLGG
FJ386648_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ993705_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ027330_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ027331_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ787475_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
EU939678_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
EU487256_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KP659248_MHBs_P-B      GDPVPNMENIASGLLAPLLALQAVFFLLTKILTIPQSLDSWWTSLNFLGG
KP659239_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLWTKILTIPQSLDLWWTSLNFLGD
JQ341560_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924637_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
FJ386669_MHBs_P-B      GDPVPNMENISSGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AB900103_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB300371_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073847_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
AB287314_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB287315_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB287319_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB287317_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881849_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KX276820_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924625_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
AB931168_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGV
AB287322_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
AB287321_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AB287320_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGG
AB073855_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGV
AB073842_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGG
MG571376_MHBs_P-B      GDPVPNMENTASGPLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KJ717841_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
GU332695_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ924628_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
FJ787477_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
FJ386688_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
EU881998_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
AB365445_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
AB073858_MHBs_P-B      GDPVPKMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073841_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
AB073823_MHBs_P-B      GDPVPNMESIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGG
AB073850_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ562240_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341555_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073825_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB675676_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571353_MHBs_P-B      GDPVPNMENTASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
LC349874_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPRSLDSWWTSLNFLGE
KY881869_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSFNFLGE
KY881794_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP148452_MHBs_P-B      GDPAPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148455_MHBs_P-B      GDPAPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148456_MHBs_P-B      GDPAPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148458_MHBs_P-B      GDPAPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148459_MHBs_P-B      GDPAPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148461_MHBs_P-B      GDPAPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792918_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792737_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
GQ924646_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGG
FJ562311_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU158262_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLSFLGG
DQ463794_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
DQ463789_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLNFLGG
DQ141640_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AF461360_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGG
AB287316_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGE
AB246342_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB246341_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB205119_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073843_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGE
AB010292_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
AB010289_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073830_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571331_MHBs_P-B      GDPAPNMENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881841_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KX276821_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLXFLGE
KC793061_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792966_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQNLDLWWTSLSFLGG
JQ341587_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
JQ341576_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
HQ700548_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815633_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377561_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ562303_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
FJ562246_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
FJ032357_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
EU939639_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
EU939636_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
EU796067_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGLFLLTKILTIPQSLDSWWTSLNFLGG
D00331_MHBs_C-B        GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPLSLDSWWTSLNFLGE
AF279464_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB900111_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
AB828708_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
AB073856_MHBs_P-B      GDPVLNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KX276770_MHBs_P-B      GDPVPNMENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964166_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQGGFFLLTKILTIPQSLDSWWTSLNFLGE
KP148457_MHBs_P-B      GDPAPNMENITSGLLGPLLVLQAGFFLLTKILAIPQSLDSWWTSLNFLGG
KC793038_MHBs_P-B      GDLVPNMENIASGLLGPLLALQAGFFXLTKILTIPQSLDSWWTSLSFLGG
KC793028_MHBs_P-B      GDPVLNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792770_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792745_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792712_MHBs_P-B      GDPVQNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792703_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774376_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377587_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GQ377582_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
FJ562296_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
FJ562237_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU939559_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
AB555498_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
AB073832_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
MG571370_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406279_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792694_MHBs_P-B      GDPVPNMENIXSGLLGPLLXLQAGFFXLTKILTIPQSLDSWWTSLNFLGE
KC792785_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
LC349872_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881865_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881850_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY881780_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KX765854_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964156_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQGGFFLLTKILTIPQSLDSWWTSLNFLGE
KU964118_MHBs_P-B      GDPVPNMENTASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP659252_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPGG
KP659244_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGG
KP406166_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792957_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC792715_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792699_MHBs_P-B      GDPVPNMENIAXGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGX
KC792652_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
JX869998_MHBs_P-B      GDPVPNMENTASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX429897_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQEGFFLLTKILTIPQSLDSWWTSLNFLGE
HM011490_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
GU815723_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY167089_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AP011084_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB642094_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB106884_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
AB073846_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
LC349875_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881864_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881853_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881843_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881835_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881821_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881808_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSRWTSLNFLGE
KY470841_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276825_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KU964394_MHBs_P-B      GDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964249_MHBs_P-B      GDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964247_MHBs_P-B      GDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964246_MHBs_P-B      GDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964153_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KP659235_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP659234_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP406239_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGG
KP148377_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ803805_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFRGV
KJ803758_MHBs_P-B      GDPAPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KJ803755_MHBs_P-B      GDPAPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KJ717818_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ717817_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFRGV
KJ173379_MHBs_P-B      GDLVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KF053165_MHBs_P-B      GDPAPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KF053162_MHBs_P-B      GDPAPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC793159_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGYFLLTKILTIPQSLDSWWTSLNFLGA
KC793036_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLWTKVLTIPQSLDSWWTSLNFLGE
KC793025_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792982_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGE
KC792969_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGV
KC792943_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792842_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792752_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792726_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792722_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWISLNFLGG
KC774397_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
JQ412092_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGG
JQ341607_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKIXTIPQSLDSWWTSLNFLGX
JQ027316_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
HM011475_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
GU815678_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
GU815670_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU939676_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
DQ993707_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AY206391_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
AB287318_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGE
MG571372_MHBs_P-B      GDPVPNMENIASGLLKPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571348_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY881783_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KX276814_MHBs_P-B      GDPVPNMENIASGLLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276782_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964154_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KP659254_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KP659240_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGG
KJ173384_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KJ173383_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KC793063_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793012_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792959_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC792958_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGE
KC792935_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792883_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGE
KC792794_MHBs_P-B      GDPVPNMENIASGPLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792720_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPEG
KC792719_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC792681_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC510656_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510654_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX429911_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX026879_MHBs_P-B      GDPVSNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
JQ801512_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ801485_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341573_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341570_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341565_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
FJ386642_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
EU939665_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
AB073831_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLNFLGG
MG571321_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGD
LC349879_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
LC349877_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
LC349869_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881842_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY881826_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881825_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGE
KY881801_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY881798_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY881795_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY881793_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY881791_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY881790_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY881788_MHBs_P-B      GDLVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY881782_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY629636_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276970_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964168_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQGGFFLLTKILTIPQSLDSWWTSLNFLGE
KU964161_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQGGFFLLTKILTIPQSLDSWWTSLNFLGE
KU964157_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQGGFFLLTKILTIPQSLDSWWTSLNFLGE
KP659219_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGE
KP406298_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406277_MHBs_P-B      GDPVPNMDNITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP406272_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP406265_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148451_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148375_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148369_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP148367_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ803796_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KJ803784_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ717807_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KF053190_MHBs_P-B      GDPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793115_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793056_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793044_MHBs_P-B      GDPVPNMENXASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793041_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KC792916_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC792910_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792889_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792887_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSLWTSLSFLGG
KC792851_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792844_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792841_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792813_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792800_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGXFLLTKILTIPQSLDSWWTSLNFLGE
KC792780_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792736_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
KC792697_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGG
KC792689_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792668_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGX
KC774413_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
JX504538_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
JX504532_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
JX429908_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX429902_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX026881_MHBs_P-B      GDPVPNMENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341568_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
HM011484_MHBs_P-B      GDPVLNMENIASGLLGPLLVLQAGFFLLTKXLTIPQXLDXWWTSLSFLGV
AB014366_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KC792662_MHBs_P-B      GDPVPNMENIASGXLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KC792664_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
MF674503_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
LC349871_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
LC349870_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KY881837_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881836_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881834_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881831_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881829_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881828_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881823_MHBs_P-B      GDPVPNTENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881822_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881820_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881797_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KY881789_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY881786_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY881784_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY881781_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY470837_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY470834_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276818_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KX276784_MHBs_P-B      GGPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964254_MHBs_P-B      GDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964253_MHBs_P-B      GDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964252_MHBs_P-B      GDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964251_MHBs_P-B      GDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964250_MHBs_P-B      GDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964244_MHBs_P-B      GDPVPNMENIASGLLRPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964110_MHBs_P-B      GDPVPNMENTASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KU964109_MHBs_P-B      GDPVPNMENTASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KU964108_MHBs_P-B      GDPVPNMENTASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KU964106_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964105_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964100_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964099_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964097_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964096_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KU964095_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964093_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP659247_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP659246_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP659245_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQXLDSWWTSLNFLGG
KP659237_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP659224_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP406257_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP148383_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KM213034_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KJ803789_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQNLDLWWTSLNFLGE
KJ717795_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQNLDLWWTSLNFLGE
KJ173423_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173422_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793156_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KC793073_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793064_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793059_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793057_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793054_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KC793047_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793031_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793021_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792938_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792934_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792919_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792913_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792901_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792877_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
KC792875_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792870_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
KC792850_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGE
KC792849_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792848_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792822_MHBs_P-B      GGPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGX
KC792750_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGE
KC792743_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792742_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792728_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KC792718_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGX
KC792717_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGD
KC792702_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774405_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774388_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ801479_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGG
JQ341579_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341571_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KY470838_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY470830_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276824_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDXWWTSLNFLGG
KX276823_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KX276772_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964397_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964395_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964393_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964391_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964388_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964385_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964384_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964383_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964382_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964381_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964245_MHBs_P-B      GDPVPNMENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KU964165_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQGGFFLLTKILTIPQSLDSWWTSLNFLGE
KU964163_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQGGFFLLTKILTIPQSLDSWWTSLNFLGE
KU964160_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGE
KU964159_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGE
KU964158_MHBs_P-B      GDPVPNMENIASGHLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGE
KU964149_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KU964143_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KU964139_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KU964122_MHBs_P-B      GDPVPNMENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964121_MHBs_P-B      GDPVPNMENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964119_MHBs_P-B      GDPVPNMENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964116_MHBs_P-B      GDPVPNMENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964115_MHBs_P-B      GDPVPNMENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964114_MHBs_P-B      GDPVPNMENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964113_MHBs_P-B      GDPVPNMENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964112_MHBs_P-B      GDPVPNMENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964111_MHBs_P-B      GDPVPNMENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU963946_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP659255_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KP659250_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KP406302_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406301_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406297_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406295_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406278_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP406275_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKVLTIPQSLDSWWTSLNFLGE
KP406258_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKALTIPQSLDSWWTSLNFLGE
KJ173386_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793193_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC793058_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793029_MHBs_P-B      GDPVPNMENIASGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC793020_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGG
KC793014_MHBs_P-B      GDPVPNMENISSGLLGPLLVSQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792991_MHBs_P-B      GXPVXNMENIASGLLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLSFLGG
KC792956_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792955_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
KC792952_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792933_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLEG
KC792908_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792898_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792888_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPEG
KC792852_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792843_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLSFLXG
KC792836_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKIRTIPQSLDSWWTSLSFLGG
KC792829_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
KC792827_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGD
KC792797_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC792795_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792784_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792783_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792766_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792756_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792747_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792735_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792714_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792705_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792696_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792687_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792666_MHBs_P-B      GDPVPNMETIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC792654_MHBs_P-B      GDPVPNMENIASGLLGPLLVXQAGFFLLTKILTIPQSLDSWWTSLNXLGE
KC774394_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774393_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774389_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774387_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC774386_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510659_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510657_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510655_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510651_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510648_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510644_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510643_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC510642_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC492739_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX978431_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX869999_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX661482_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX661480_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX661479_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX661478_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX661477_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX661476_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX661475_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX661474_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX661473_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX661472_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX661471_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX507215_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX507213_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX507210_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX429900_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JX429899_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ801516_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
JQ801507_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ801471_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ688405_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ412090_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341594_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341593_MHBs_P-B      GDPVQNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341584_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341583_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341578_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341575_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341574_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341564_MHBs_P-B      GDPVPNMENIASGLLXPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG571339_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
M54923_MHBs_P-B        GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
LC349878_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
LC349873_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
LC349868_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276819_MHBs_P-B      GDPAPNMENIASRLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLNFLGG
KU964258_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964132_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964082_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964080_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP406285_MHBs_P-B      GXPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406280_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP406276_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP406274_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP406270_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP406268_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP406264_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KP406263_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP406255_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ803787_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ717792_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793166_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGE
KC793155_MHBs_P-B      GDPXPNMENIASGLXGPLLVLXAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793153_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793070_MHBs_P-B      GDPVPNMENTTSGLLGPLLVLQGGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793067_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KC793055_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC793053_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793043_MHBs_P-B      GDPVPNMENITSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
KC793033_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLSFLGE
KC793011_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLSFLGE
KC793000_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLXFLGE
KC792994_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792990_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGYFLLTKILTIPQSLDSWWTSLNFLGE
KC792980_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792978_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KC792977_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGG
KC792932_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792912_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792907_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792906_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792905_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792895_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792894_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792893_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792892_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792884_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792874_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792872_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792869_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792865_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC792864_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792858_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792856_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792838_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792832_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792828_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792823_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792804_MHBs_P-B      GDLVXNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792738_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792725_MHBs_P-B      GDPVPNMENIXSGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792651_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGG
KC792659_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGG
KX276785_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
MG571336_MHBs_P-B      GDPVQNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGD
MG571329_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGD
MG571323_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
MG372436_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPEG
MF674506_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KY470840_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDPWWTSLNFLGG
KY470832_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDPWWTSLNFLGG
KU964152_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KU964151_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KU964150_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KU964148_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KU964147_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KU964145_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KU964144_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KU964142_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KU964140_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KU964138_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKTLTIPQSLDSWWTSLNFLGG
KU964136_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTYLNFLGE
KU964131_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964107_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KU964104_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KU964103_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KU964102_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KU964101_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KU964094_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KR152339_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KP406311_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406294_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406289_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406287_MHBs_P-B      GDPVTNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406286_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406284_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406281_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406273_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKALTIPQSLDSWWTSLNFLGE
KP406271_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP148330_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KM213032_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKVLTIPQSLDSWWTSLNFLGE
KJ803783_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KJ173385_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KJ173377_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KF053189_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793196_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793122_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC793120_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KC793099_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC793098_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC793094_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC793079_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC793069_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGD
KC793062_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793052_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793027_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793023_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793018_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC793013_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793010_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC793007_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC793001_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792996_MHBs_P-B      GDPVPNMENIVSGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGG
KC792993_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792985_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC792984_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792976_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGX
KC792973_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792972_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792948_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792936_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGG
KC792930_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792928_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQXLDLWWTSLSFLGG
KC792917_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792909_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792899_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792879_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792871_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGG
KC792839_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792824_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDXWWTSLNFLGE
KC792815_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792809_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGG
KC792778_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLSFLGG
JQ341591_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKIXTIPQSLDSWWTSLNFLGX
JQ341577_MHBs_P-B      GDPVPNMENIXSGXLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGG
JQ341557_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGX
KC792675_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792769_MHBs_P-B      GDPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
MG571325_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFPGG
KY470839_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY470836_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY470835_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KY470833_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276810_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGG
KX276781_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964135_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964134_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964133_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964130_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964129_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964128_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964127_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964126_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964125_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU964124_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KU963980_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KP406317_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406316_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406315_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406313_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406310_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406309_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406308_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406307_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406306_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406304_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406303_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406300_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406299_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406296_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406293_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406292_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406291_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406290_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406288_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406282_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406269_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406266_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP406262_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KP406260_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KP036970_MHBs_P-B      GDPVPNMENIVSGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KJ803763_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPGG
KJ790200_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KF053192_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPGG
KC793198_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGE
KC793174_MHBs_P-B      GDPVPNMEXIASGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
KC793157_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGX
KC793132_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793049_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793022_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793002_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792971_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792954_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGG
KC792945_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGG
KC792925_MHBs_P-B      GDPVPNMENISSGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLSFLGX
KC792900_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792867_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGE
KC792855_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792846_MHBs_P-B      GDXVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
KC510660_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
JQ341566_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSXWTSLNFLGG
MG571334_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGA
KC793143_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGX
KC793065_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792866_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGX
KC792819_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792814_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792782_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXXLGE
KC792781_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGX
JQ341606_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792992_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLSFLGG
KC793170_MHBs_P-B      GDPVPNMENIASGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC793042_MHBs_P-B      GDPVPNMENIXSGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGX
KC792988_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC792986_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDXWXTSLNFLGX
KC792904_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLNFLGX
KC792859_MHBs_P-B      GDPVPNMENXASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGX
JQ341586_MHBs_P-B      GDPVPNMENIASGLLXPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGX
JQ341561_MHBs_P-B      GDPVPNMENIASGXLXPLLVLQAGFFXXTKILTIPQSLDSWWTSLNFLGX
KC793008_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLXTKILTIPQSLDSWWTSLNFLGX
KX276778_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KX276776_MHBs_P-B      GDPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFPGV
KC793171_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGYFSLTKVLTIPQSLDSWWTSLNFLGE
KC793158_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGX
KC793130_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGX
KC793109_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGE
KC792950_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLSFLGX
KC792786_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQXLDXWWTSLXFLGG
KC792774_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGX
KC792723_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDXWWTSLSFLGX
KC792721_MHBs_P-B      GDPVXNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGX
KX276805_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KX276779_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793200_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
KC793060_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792974_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
KC792863_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPXSLDSWWTSLXFLGX
KC792730_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLXFLGX
KC793015_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793199_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGG
KC793071_MHBs_P-B      GDPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
KC792970_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGX
KC792983_MHBs_P-B      GDPVPNMENIASGLLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLXFLGX
KC792942_MHBs_P-B      GXXVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGG
KC792808_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFXLTKILXIPQSLDXWWTSLXFLGX
KC793034_MHBs_P-B      GDPVPNMENIASGLLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLXFLGX
                       *                                 *  *            

JQ429081_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964272_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964273_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964274_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964275_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964276_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964277_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964278_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964279_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964281_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964284_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964285_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964280_MHBs_P-B      TPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964283_MHBs_P-B      TPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964286_MHBs_P-B      TPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
EU660232_MHBs_P-B      TPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
EU660233_MHBs_P-B      TPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
EU882003_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
AB048705_MHBs_P-B      APACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFL
DQ993696_MHBs_P-B      APVCLDQNSQSPISSHSPTCCPPICPDYPWMCLRRFIIFLCILLLCLIFL
AB287323_MHBs_P-B      MPGCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFL
KJ717801_MHBs_P-B      APTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLNLIFL
AB900095_MHBs_P-B      TPVCLGQNSQSQICSHLPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFL
EU939667_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
DQ463797_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLYLIFL
JN792895_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLYLIFL
AB073853_MHBs_P-B      PPVCHGQNSQCQICSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
AB900096_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
JQ040157_MHBs_P-B      APTCPGQNSQSPTSNHSPTSCPPIXPGYRWMCLRRFIIFLFILLLCLIFL
FJ032358_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
AB287327_MHBs_P-B      TPVCLGQNSQSPISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
EF494380_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFL
DQ141631_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
MG571338_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
X97850_MHBs_P-B        TPACPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KC793181_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
JN792897_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KC793188_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
JN604187_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
FJ562253_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFL
DQ993702_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRSFIIFLCILLLCLIFL
AB073824_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964265_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIISLCILLLCLIFL
KU964267_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIISLCILLLCLIFL
KU964271_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIISLCILLLCLIFL
JQ027315_MHBs_P-B      TPVCLGQNSQSPISRHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
AY220698_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFL
KU964257_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIISLCILLLCLIFL
KP406251_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
JN827419_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
FJ032353_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
AY220697_MHBs_P-B      TPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
MG826153_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFL
KX276815_MHBs_P-B      XPVCXGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFL
JQ341597_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFL
JQ341599_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFL
EU939675_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFL
EU939663_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
AB010290_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
MF674492_MHBs_P-B      TTACLGQNSQSQISSHSPTCCPPNCPGYRWMCLRRFIIFLCILLLCLIFL
KP406254_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFL
KP406253_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406252_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFL
KP406249_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFL
KP406248_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFL
KP406246_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFL
KP406245_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFL
KP406244_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLTFL
KJ803820_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFL
KJ717836_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFL
JN604224_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRSIIFLCILLLCLIFL
HM011503_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
FJ899791_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
FJ899790_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
EU939674_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
DQ993701_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KY629635_MHBs_P-B      TPECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964268_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIISLCILLLCLIFL
KU964266_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIISLCILLLCLIFL
KU964264_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIISLCILLLCLIFL
KU964263_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIISLCILLLCLIFL
KU964262_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIISLCILLLCLIFL
KU964261_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIISLCILLLCLIFL
KU964260_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIISLCILLLCLIFL
KP659253_MHBs_P-B      TPVCLGQNSQSQISSHSLTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406250_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406161_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ803808_MHBs_P-B      APTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFL
KJ717820_MHBs_P-B      APTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFL
KC793182_MHBs_P-B      TPVCHGQNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFL
JQ040128_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFL
KY881904_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMRLRRFIIFLCILLLCLIFL
KY881824_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KX276827_MHBs_P-B      TPVCLGQNSQSQISXHSXTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964146_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406332_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ803817_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ803775_MHBs_P-B      TPVCLGQNSQSPISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFL
KJ717831_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KF053182_MHBs_P-B      TPVCLGQNSQSPISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFL
KC793118_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFL
KC792684_MHBs_P-B      TPVCLGQNSQSQISSHSXTCCPPICPGYRWMCLRRFIXFLCILLLCLIFL
AB642093_MHBs_P-B      TPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
AB010291_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
MG826152_MHBs_P-B      TPECLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIICLCILLLCLIFL
MF674464_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KY881827_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KY417926_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFL
KX276830_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPXCPGYRWMYLRRFIIFLCILLLCLIFL
KX276791_MHBs_P-B      TPVCXGQNSQSPISSHSPTCCPPXCPGYRWMYLRRFIIFLCILLLCLIFX
KU964270_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIISLCILLLCLIFL
KU964269_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIISLCILLLCLIFL
KU964259_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIISLCILLLCLIFL
KU964256_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964255_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964248_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963854_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963827_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963826_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963825_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963824_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963823_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963822_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963821_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963820_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963819_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963818_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963817_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963815_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963814_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148349_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148343_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148342_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148340_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KM875416_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ843165_MHBs_P-B      TPVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ803773_MHBs_P-B      TPVCLGQNSQSPISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFL
KJ173378_MHBs_P-B      TPVCRGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFL
KJ173376_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173375_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KF053180_MHBs_P-B      TPVCLGQNSQSPISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFL
KC793189_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRXFIIFLCILLLCLIFL
KC793077_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFL
KC793032_MHBs_P-B      TPVCLGQNSQSQICSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFL
X98077_MHBs_P-B        TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFL
MG571352_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
MF674461_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
MF674422_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
LT992442_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KY881833_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLISL
KX276829_MHBs_P-B      TTVCLGQNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFL
KU964141_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP659238_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406243_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406242_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406241_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406240_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406238_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406236_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406235_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406234_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406233_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406232_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406231_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406230_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406229_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406228_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406227_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406226_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406225_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406224_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406223_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406222_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406221_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406220_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406165_MHBs_P-B      TPVCRGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFL
KP406163_MHBs_P-B      TPVCRGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFL
KP148348_MHBs_P-B      TPVCLGQNSQSQISSHSPTYCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ717797_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLILIFL
KJ173402_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173401_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173368_MHBs_P-B      APVCLGQNSQSPISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173360_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KC793126_MHBs_P-B      TPVCLGQNSQSPISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFL
JN604311_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
HM011483_MHBs_P-B      TPVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
MG571337_MHBs_P-B      TPVCLGQNSQSPISSHSPTCCPPICPGYRWMCLRRFIIXLCILLLCLIFL
MF674383_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KY881868_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KY881867_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KY881866_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KY881848_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KX276817_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFL
KX276771_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP659251_MHBs_P-B      TTVCLGQNSQSQISSHSPTCCPPXCPGYRWMCLRRFIIFLCILLLCLIFL
KP406335_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406334_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406333_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406331_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406330_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406322_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406321_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406320_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406319_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406318_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406219_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406217_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406214_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406210_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406208_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406203_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406200_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406199_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406197_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406195_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406192_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406189_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406188_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406187_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148581_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ803825_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFILFLCILLLCLIFL
KJ803816_MHBs_P-B      KLVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ717843_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFILFLCILLLCLIFL
KJ717829_MHBs_P-B      KLVCPGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KC793194_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KC793163_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KC793151_MHBs_P-B      XPVCXGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KC793124_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
MG571364_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
MG571362_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
MG571360_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
MG571355_MHBs_P-B      TPVCLGQNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
MG571349_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
MG571333_MHBs_P-B      TPECLGQNSQSRISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFL
MF674512_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
MF674404_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KY881838_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KY881800_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KY881785_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KY470962_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KY470954_MHBs_P-B      TPVCLGQNSQSQISSRSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KX276800_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KX276788_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRXFIIFLCILLLCLIFL
KU964293_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFL
KU964167_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964162_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964155_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964120_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963979_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963968_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963963_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963962_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963955_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963948_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KT749820_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148582_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCFIFL
KP148579_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148361_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWICLRRFIIFLCILLLCLIFL
KP148347_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148346_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148345_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148344_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148341_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148339_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148338_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148336_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148325_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148324_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148322_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KM875421_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KM875420_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFL
KM875417_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KM392084_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KM213036_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KM213035_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ717842_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ717830_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173404_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPQICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173390_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173389_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173388_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173387_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173366_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173365_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173362_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173361_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173357_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173356_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173355_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173353_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ173341_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KC793185_MHBs_P-B      XPVCLGQNSQSQISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KC793091_MHBs_P-B      TPVCLGQDSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KC793086_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFL
JQ341567_MHBs_P-B      XPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
MG571361_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
MG571326_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIICLCILLLCLIFL
MF674465_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFL
MF674426_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KY881839_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KY881830_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLISL
KX276796_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFL
KU963977_MHBs_P-B      TPECLGQNSQSQISSHSPTFCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963976_MHBs_P-B      TPECLGQNSQSQISSHSPTFCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU963970_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPNCPGYRWMCLRRFIIFLCILLLCLIFL
KP406237_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP148314_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ803801_MHBs_P-B      IPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ803756_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KJ717813_MHBs_P-B      IPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KF053163_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KC793190_MHBs_P-B      TPVCLGQNSQSQISSHLPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KC793154_MHBs_P-B      XPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIXFLCILLLCLIFL
KC793145_MHBs_P-B      TPVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KC793134_MHBs_P-B      TPVCLGQNSQSPISXHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KC793083_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRHFIIFLCILLLCLIFL
KY881796_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KU964123_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP659249_MHBs_P-B      PPVCLGQNSQSQTSSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFL
KP406218_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406215_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406213_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFL
KP406211_MHBs_P-B      TPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLC