HBVdb

Dataset for protein HBSP of genotype C

[Download (right click)] [Edit] [Sequences] [Repertoires]

2837 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


FJ899773_HBSP_P-C      -PLSYQHFRKLLLLDDEAGPLEEELPRLANEGLNRRVAEDLNLGNLNE-H
EU881999_HBSP_P-C      -PLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU882000_HBSP_P-C      -PLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG826125_HBSP_P-C      -PLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089795_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEIQ
AB112066_HBSP_P-C      MPPSYQHSRKLLLLDDEAGPLERELPRLADEGLNRRVAEDLNLGNLNE-H
KF053181_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
KJ803774_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
KC774226_HBSP_P-C      MPLSYQPFRKLLLLNNKAGPLKKKLPPLPNKGLNRRVAEDLNLGGFNE-H
KY470980_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEGLPRLADEGLNHRVAEDLNLGNLNE-L
KY470981_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEGLPRLADEGLNHRVAEDLNLGNLNE-L
KY470982_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEGLPRLADEGLNHRVAEDLNLGNLNE-L
KY470983_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-L
KY470984_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEGLPRLADEGLNHRVAEDLNLGNLNE-L
KY470985_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-L
KY470986_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-L
KY470987_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-L
KY470988_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEGLPRLADEGLNHRVAEDLNLGNLNE-L
KY470990_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-L
KY470991_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-L
AB241112_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU498227_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-Q
KJ717825_HBSP_P-C      MPLSYQRFLRLLLLDHEAGPLEEELPRLADEGLNRRFAEDLNLGNLNE-H
KJ803812_HBSP_P-C      MPLSYQRFLRLLLLDHEAGPLEEELPRLADEGLNRRFAEDLNLGNLNE-H
FJ715364_HBSP_P-C      MPLSYQHFPKLLLLDDEAVPLEEELPRLADEGLNHRVAEDLNLGNLNE-P
FJ562230_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598760_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGKINE-H
KC774213_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-Q
KC774214_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-Q
FJ562326_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPHLADEGLNRRVAEDLNLGNPNE-H
EU939579_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ899774_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU717215_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF182802_HBSP_P-C      MPLSYQHFRKLLLLDDKAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB112065_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KY881802_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAKDLNLGNLNE-H
KY363260_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-Q
KX765828_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013841_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KR013839_HBSP_P-C      MPLSYQHFRKLLLLDDVAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KR013780_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGSLNE-H
KC774288_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEDLNRRVAQDLNLGNLNE-H
KC774240_HBSP_P-C      MPLFYQHFRKLLLLNDKAGPLKKKLPRLKNKGLNRRVAEDLNLGNLNE-H
JX026888_HBSP_P-C      MPLSYQLFRKLLLLDDEAGPLEEELLRLADEDLNRRVAEDLNLGNLNE-H
FJ899789_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEEPPRLADEGLNRRVAEDLNLGNLNE-H
EU560439_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNHRVAEDLNLGNLNE-H
EU547562_HBSP_P-C      MPLSYQHFRKLLLLEQDAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AB367402_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367405_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
KY881819_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNE-H
KY881809_HBSP_P-C      MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963937_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
KR013875_HBSP_P-C      TPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGSLNE-H
KR013869_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013805_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNCRVAEDLNLGNLNE-H
KR013804_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013807_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598662_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KJ598663_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KJ598664_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KJ598665_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KJ598666_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KJ598667_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KJ598668_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KJ598669_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KJ598670_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KJ598671_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KJ598672_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KJ598673_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KJ598674_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KJ598676_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KJ598677_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KJ598678_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KF053175_HBSP_P-C      MPLSCQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803769_HBSP_P-C      MPLSCQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801520_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEKLPRLPHEGLNPLLAEDLNLGNLNE-H
JN827423_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828906_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828907_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828911_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828912_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828905_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828908_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828910_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HQ638218_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377545_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ899778_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNLNE-H
FJ899772_HBSP_P-C      MPLSYQDLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787490_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGFNRRVAEDLNLGNLNE-H
FJ787450_HBSP_P-C      --LSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
FJ787448_HBSP_P-C      MPLSYQHFRKLLLLDDAAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715422_HBSP_P-C      MPLSYQHFRKLLLLYDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715404_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRCVAEDLNLGNLNE-H
FJ562323_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEDLNRRVAEDLNLGNLNE-H
FJ562245_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939658_HBSP_P-C      MPLSYQHFRKLLLLDDQAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939653_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU871974_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLSE-H
EU589340_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787481_HBSP_P-C      MPLSYQHFRKLPLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU560438_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGDLNE-H
EU522069_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY220700_HBSP_P-C      MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY206381_HBSP_P-C      MPLSYQHFRRLVLLDDEAGPLEEELPRLTDEGLNRRVAEDLNLGNLNE-H
AF384371_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU560441_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787486_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ899776_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013863_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013864_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013865_HBSP_P-C      MPLSYQHSRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013867_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB697490_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386623_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
JF828916_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828919_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB675674_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLND-Q
AB675675_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLND-Q
AB670308_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU562216_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB493844_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNLNE-H
AB367421_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGTLNE-H
AB367408_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367413_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX026877_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367403_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB115417_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB111113_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014382_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AB014377_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386677_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KT366464_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG826134_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KY470927_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964214_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964014_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KT284757_HBSP_P-C      MPLSYQHFRKVLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013811_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148559_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADKGLNRRVAEDLNLGNLNE-L
KM875423_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803792_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNE-H
KJ717802_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNE-H
KJ598772_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ410511_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLDE-H
KJ173290_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774316_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNE-H
KC774191_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-Q
GQ475351_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377623_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLDE-H
FJ386620_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ032350_HBSP_P-C      TPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ032336_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939657_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU670263_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNLND-H
EU570072_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNLNE-H
EU306672_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEKLPHLADEGLNRRVAEDLNLGNLNE-H
EU306671_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNE-H
DQ922651_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLSE-H
DQ922650_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AP011106_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNE-H
AB670279_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB493839_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNPNE-H
AB300361_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAKELNLGNLNE-H
AB298721_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADAGLNRRVAEDLNLGNLNE-H
AB298720_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADAGLNRRVAEDLNLGNLNE-H
AB014380_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014372_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014364_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881873_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB182589_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB195949_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670261_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670263_HBSP_P-C      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
D23682_HBSP_P-C        MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
D23683_HBSP_P-C        MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ536411_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ536413_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU871978_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLAAEGLNRRVAEDLNLGNLNE-H
EU871979_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939567_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939593_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939612_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939647_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386602_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386616_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562220_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562293_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562324_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377575_HBSP_P-C      MPLSYQHFRKLQLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ246215_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU589345_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386579_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562320_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JN827418_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JN827421_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JN827422_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JN827424_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JN827425_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF488701_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF925409_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG571335_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386604_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367404_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939588_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX560520_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR819180_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG826136_HBSP_P-C      MPLSYQHFRKLLLLNDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG826127_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-L
MG826126_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-L
MF925375_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674504_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
MF674501_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
MF674484_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
MF674472_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
MF674468_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
MF674467_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
MF674454_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
MF674418_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
MF674417_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
MF674412_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
MF674408_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
MF674402_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
MF674390_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
MF674388_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KY881965_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY670782_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-L
KY629631_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-L
KY363287_HBSP_P-C      MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY363285_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX276840_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNXNE-H
KU964198_HBSP_P-C      MPLSYQHFRKILLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014021_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KR013904_HBSP_P-C      MPLSYQHFRKPLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013840_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KR013838_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KR013837_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KR013836_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KR013835_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KP148564_HBSP_P-C      MPLSHQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KM875412_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803814_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRCAEHLNLGNLNE-H
KJ803793_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KJ717803_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KJ173334_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KF495606_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-L
KF214668_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC793046_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-L
KC792831_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774353_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAKDLNLGNLNE-H
KC774335_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-Q
KC774306_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774252_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNINE-P
KC774235_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-R
KC774223_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774211_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDVLNRRVAEDLNLGNLNE-Q
KC774197_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
JQ801490_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
JQ707723_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707716_HBSP_P-C      MPLSYQLFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ040154_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828923_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-Q
JF828918_HBSP_P-C      MPLSYQHFRKLLSLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
HM750135_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAKDLNLGNLNE-H
GQ377538_HBSP_P-C      MPLSYQHFLKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ227692_HBSP_P-C      MPLSYQHFRKLLSLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787467_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787449_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNE-H
FJ787447_HBSP_P-C      MPLSYQHFRKLLLLDDAAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787437_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLSRRVAEDLNLGNLNE-H
FJ562310_HBSP_P-C      MPLSYQHFRKLLLLDAQAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
FJ562300_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-L
FJ562233_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386653_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAKDLNLGNLNE-H
EU939654_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNLNE-H
EU939617_HBSP_P-C      MPLSYQHFRNVLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939600_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939592_HBSP_P-C      MPLSYQHFRKLLLLDDGAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939540_HBSP_P-C      MPLSCQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916237_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDPNLGNLNE-H
EU916227_HBSP_P-C      MPLSYQHFRKLLLLDGEAGPLEEELPRLADDGLNRRVAEDLNLGNLNE-H
EU916211_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916210_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU872005_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU554541_HBSP_P-C      MPLSYQYFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU547559_HBSP_P-C      MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
EU439016_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ975274_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDPNLGNLNE-H
DQ377164_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY206384_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY206382_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF473543_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF461363_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNE-H
AF461357_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNE-H
AF286594_HBSP_P-C      MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
AB670298_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-R
AB471853_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
AB471852_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
AB471851_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
AB367433_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPREEELPRLADEGLNRRVAEDLGLGNLNE-H
AB367418_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AB367417_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367406_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB300360_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNE-H
AB246346_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
AB195946_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AB195932_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB176642_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGTLNE-H
AB115418_HBSP_P-C      MPLSYQHFRKLLLLDPEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AB111118_HBSP_P-C      MPLSYQHFRKLLLLDDKAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB111112_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014373_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ032355_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLANEGLNRRVAEDLNLGNLNE-H
FJ032356_HBSP_P-C      MPLSYPHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB931170_HBSP_P-C      MPLSYQHFLKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB931171_HBSP_P-C      MPLSYQHFLKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013993_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU679937_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGBPND-Q
KF873536_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGDPND-Q
KU679960_HBSP_P-C      MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGBPND-Q
MK321266_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNLRVAEELNLXNLNE-H
MH220971_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
KY881891_HBSP_P-C      MPISYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881890_HBSP_P-C      MPLSYQHFQKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881817_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881815_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881804_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY629637_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNLRVAEDLNLGNLNE-L
KY363274_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLAGEGLNRRVAEDLNVGNLNE-H
KY363256_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KX276838_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNINE-H
KU964343_HBSP_P-C      MPLSYQHFRKLLLLEDESGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014013_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNLNE-H
KR014005_HBSP_P-C      IPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013943_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013853_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013852_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEGELPRLADEGLNRRVAEDLNLGNLNE-H
KR013786_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013766_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013764_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803815_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRCAEHLNLGNLNE-H
KJ803811_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRGAEDLNLGNLNE-H
KJ717823_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRGAEDLNLGNLNE-H
KJ717791_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRFAEDLNLGNLNE-H
KJ598777_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598768_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598716_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ410499_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTE-R
KJ410494_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTE-R
KJ410492_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTE-R
KJ410491_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTE-R
KJ173291_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774334_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAKDLNLGNLNE-H
KC774238_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
JX661489_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNE-H
JQ341635_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTE-H
JQ341619_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNINE-H
JQ040161_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADVGLNRRVAEDLNLGNLNE-H
JN400089_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNPGNLNE-H
JN400087_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNPGNLNE-H
GQ924633_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ924620_HBSP_C-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475355_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
GQ475352_HBSP_P-C      MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475343_HBSP_P-C      MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377615_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377609_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
GQ377608_HBSP_P-C      MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377599_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377571_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377536_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-Q
FJ787484_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRDAEDLNLGNLNE-H
FJ787469_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPCLADEGLNRRVAEDLNLGNLNE-H
FJ751770_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715391_HBSP_P-C      MPLSYQHFGKLLLLDDEAGPLEEELPRLADEGPNRRAAEDLNLGNLNE-H
FJ562292_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562284_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562276_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ151413_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ032339_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ032338_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939626_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
EU939625_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNINE-H
EU939586_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLTDEGLNRRVAEDLNLGNLNE-H
EU939584_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939571_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939558_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTE-H
EU919169_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-Q
EU881996_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
EU872013_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU872012_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU871982_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU589344_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-Q
EU589341_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306688_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ993693_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ993691_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ478885_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089803_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-Q
DQ089799_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
AY247031_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY206389_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY167096_HBSP_P-C      MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY167092_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB971715_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB971714_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670273_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTE-H
AB670238_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AB300362_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014390_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014385_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014367_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGBLNE-H
AB670237_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475328_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MH818373_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
MG893553_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG826140_HBSP_P-C      MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG826137_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG826135_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG826133_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG826132_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG826131_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674471_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-Q
LC279253_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC279252_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC279251_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC279250_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881998_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881997_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881980_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881966_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLDE-H
KY881883_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881882_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881872_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881810_HBSP_P-C      MPLSYQHLRKLLLLNDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470966_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KY470926_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KY470925_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KY363284_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY363280_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765843_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-P
KX765836_HBSP_P-C      TPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KX276833_HBSP_P-C      MPLSYQHFRKLLLLDBEVGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964333_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964332_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964331_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964330_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964329_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964328_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964327_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964326_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964325_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964324_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964323_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964322_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964321_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964320_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964319_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964318_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964228_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964227_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964226_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964225_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964224_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964223_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964222_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964221_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964220_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964218_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964217_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964216_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964215_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964063_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964062_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964061_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964060_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964059_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964058_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964057_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964056_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964055_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964054_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964053_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964052_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964051_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964050_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964049_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964019_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964018_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964017_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964016_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964015_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964013_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964012_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964011_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964002_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963996_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963882_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGINRRVAEDLNLGNLNE-H
KR014099_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014098_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014059_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014048_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRFADEGLNRRVAEDLNLGNLNE-H
KR014043_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014041_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014002_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014000_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013899_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-R
KR013876_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013874_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013872_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013866_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013796_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
KR013795_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013794_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013793_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013792_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013768_HBSP_P-C      MSLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148570_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-R
KJ598780_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598779_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598778_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598776_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598775_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598774_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598762_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNINE-H
KJ598753_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598703_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598702_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598699_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598698_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598694_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598693_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598689_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173432_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173431_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173302_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF873544_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-Q
KF873541_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPND-Q
KF873539_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPND-Q
KC792834_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774359_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774354_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-R
KC774348_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774267_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774260_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774242_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-R
JX870000_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEXLPXLADEGLNRRVAEDLNLGNLNE-H
JX661496_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX504544_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX429917_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX026884_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX026878_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341670_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
JQ341631_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-R
JQ040145_HBSP_P-C      MPLSXQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JN827414_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM750139_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM011481_HBSP_P-C      MPLSYQHFXKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GU721029_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
GQ924655_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475353_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ475336_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ377632_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377631_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377605_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377600_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ358157_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
GQ227693_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGSLNE-H
FJ899795_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ899794_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
FJ899793_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
FJ787452_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLDE-P
FJ715406_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGSLNE-H
FJ715405_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGSLNE-H
FJ562272_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
FJ562256_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
FJ386630_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTE-H
FJ386617_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
FJ032334_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLND-H
EU939614_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939583_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEDLNRRVAEDLNLGNLSE-R
EU939578_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916219_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916214_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLDE-H
EU439012_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU439008_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306725_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGGLNE-H
EF688062_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ975272_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AY641560_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AP011107_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670306_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNE-H
AB670272_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPTE-H
AB670268_HBSP_P-C      MPLSYXHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNE-H
AB670265_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPTE-H
AB670264_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
AB670262_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTPNE-H
AB670248_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLBE-H
AB670246_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB241113_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
AB241111_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB111120_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB033551_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014387_HBSP_P-C      MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881973_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964042_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
HQ700529_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
JQ027322_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
MH891502_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MH887433_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG826123_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG725248_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF925410_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF925408_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF925406_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF925405_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF925395_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF925394_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF925387_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF925377_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF925376_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF925374_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF925369_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF925367_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF925365_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF925359_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674514_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674494_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674489_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674486_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674475_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674474_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674463_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674458_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674457_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674444_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674442_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674435_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674429_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674428_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEELNLGNLNE-H
MF674425_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674411_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674403_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674399_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674398_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674386_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF488703_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC318703_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
LC318702_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
LC279275_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
LC279257_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
LC279256_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
LC279255_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
LC279254_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
KY882000_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881999_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881996_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881995_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881992_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881986_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881985_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881983_HBSP_P-C      MPLPYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881982_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881977_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881976_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881975_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881970_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881969_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881968_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881967_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881964_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881963_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881959_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881943_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881942_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881941_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881940_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881939_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881938_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881937_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881936_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881935_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881934_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881933_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881932_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881931_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881930_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881929_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881928_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881927_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881926_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881925_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881924_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881923_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881922_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881921_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881920_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881919_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881918_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881917_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881915_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881892_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470918_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470917_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470916_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470915_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470914_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470913_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470912_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470911_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470910_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470909_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470908_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470907_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470906_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY363286_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY363261_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-Q
KX774506_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX774504_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX774503_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765853_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765852_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765851_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765850_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765849_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765848_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765846_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765845_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765844_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765842_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765838_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765837_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765834_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765833_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765832_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765831_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765829_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765827_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765826_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765825_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765824_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765823_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765822_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765821_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765820_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765818_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX276854_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX276852_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX276851_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX276850_HBSP_P-C      MPLSYQHFRKLXLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KX276849_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KX276848_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX276847_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPND-H
KX276844_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964365_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964364_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964363_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964362_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964361_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964360_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964359_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964358_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964357_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964356_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964355_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964354_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964353_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964352_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964350_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964349_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964341_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964219_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964199_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964197_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964196_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964195_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964194_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964193_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964192_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964191_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964188_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964187_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963914_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KU963913_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KU963912_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KU963911_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KU963910_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KU963909_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KU963908_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KU963907_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KU963906_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KU963905_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KU963904_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KU963903_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KU963902_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KU963901_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KU963900_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
KU051427_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU051426_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU051425_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU051423_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KT987426_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KT987425_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KT987424_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KT987423_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
KT366463_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KT364721_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KT364718_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KT347089_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KT307719_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KT307718_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KT284759_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013984_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013935_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013927_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013923_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-R
KR013905_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KR013903_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013902_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013900_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013862_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013861_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013860_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013859_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013857_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013856_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013855_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013854_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013826_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013821_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013808_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013803_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013802_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013787_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013782_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013781_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013779_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013770_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013762_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNCRVAEDLNLGNLNE-H
KP148575_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148574_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148573_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148572_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148571_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148568_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148567_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148566_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148563_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148562_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148561_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148560_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148558_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148557_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148555_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148554_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148552_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148551_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148549_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148548_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148547_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148546_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148545_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148543_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148540_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KP148538_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148537_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148535_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148534_HBSP_P-C      MPLSYQHFRKLLLLDDEAGLLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148532_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148531_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148530_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148529_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148528_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148526_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148525_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148524_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148523_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148521_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148520_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148519_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148517_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148514_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148513_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148512_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148493_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148492_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148491_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148489_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148488_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVTEDLNLGNLNE-H
KP148487_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148483_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148482_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148481_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148480_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148479_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148477_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148476_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148475_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148474_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148473_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148472_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148471_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148470_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148469_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148468_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148466_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148465_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148464_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148463_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP148315_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KM875430_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KM875429_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KM875428_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KM875411_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KM875405_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KM875404_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KM359441_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KM229703_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KM213037_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803826_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803823_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
KJ803818_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803800_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803799_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803780_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803779_HBSP_P-C      MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803776_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803770_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KJ803760_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ717844_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ717839_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
KJ717834_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ717812_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ717811_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ717810_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ717809_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ717790_HBSP_P-C      MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ410519_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ410515_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ410513_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ410510_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ410508_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ410504_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KJ410501_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ410498_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
KJ410496_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ410495_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ410493_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KJ173444_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
KJ173443_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
KJ173392_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173391_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173332_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173331_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173324_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173323_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173296_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173286_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173285_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF485390_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNXRVAEDLNLGNLNE-H
KF214676_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF214673_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF214667_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KF214652_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-Q
KF053193_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF053187_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF053183_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF053177_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KF053176_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF053168_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC875274_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC875273_HBSP_P-C      MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC875272_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC875271_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC875270_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC875269_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC875268_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEALNLGNLNE-H
KC792658_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774352_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLKYRVAEDLNLGNLNE-H
KC774338_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774320_HBSP_P-C      MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774318_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774315_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774284_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-Q
KC774283_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774277_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-Q
KC774264_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774256_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-Q
KC774254_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-Q
KC774237_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KC774236_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774228_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774227_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774225_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774199_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774194_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774189_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-Q
KC774187_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KC774182_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774180_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC315399_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JX507214_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX504545_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX504536_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX504535_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX429918_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX429915_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX429914_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX429905_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801521_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801519_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801515_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
JQ801513_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801511_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801509_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801505_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801504_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
JQ801503_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRPADEGLNRRVAEELNLGNLNE-H
JQ801502_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801500_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801499_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801497_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801496_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801495_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801491_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801489_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801488_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801486_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801483_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801482_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801481_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801480_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801475_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801473_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801472_HBSP_P-C      MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801470_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ707774_HBSP_P-C      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ707773_HBSP_P-C      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ707772_HBSP_P-C      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ707771_HBSP_P-C      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ707770_HBSP_P-C      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ707769_HBSP_P-C      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ707768_HBSP_P-C      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ707733_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707732_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707731_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707729_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707728_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707727_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707726_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707725_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707724_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707722_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707721_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707720_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707719_HBSP_P-C      MPLSYRHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707718_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707717_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707712_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707711_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707710_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707708_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLANEGLNRRVAEDLNLGNLND-H
JQ688403_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341669_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341668_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341664_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341663_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341657_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341655_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341654_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341652_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341651_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341650_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341649_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341647_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341644_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341643_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341642_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341641_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341639_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLGLGNLNE-H
JQ341637_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341626_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341622_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341621_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341620_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEXLNLGNLNE-H
JQ341618_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341617_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341616_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341615_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341611_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040172_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040168_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040163_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040158_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040151_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040149_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040133_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ027333_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ027324_HBSP_P-C      MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ027321_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ027317_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JN827420_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JN827417_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JN827416_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF899336_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828937_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828928_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828922_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828921_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828920_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
JF828917_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
JF828915_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828913_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
JF436920_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HQ700543_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-R
HQ700522_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-R
HQ622095_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM750140_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM750136_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-Q
HM750134_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM011497_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM011495_HBSP_P-C      MPLSYQHFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNXNE-H
HM011493_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
HM011491_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GU357845_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475344_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
GQ475341_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475338_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475323_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475309_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377636_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
GQ377628_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377616_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
GQ377601_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377577_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377570_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377555_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
GQ377531_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377528_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377518_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
GQ377515_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377514_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ358158_HBSP_C-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVADDLNLGNLNE-H
GQ227697_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ899788_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787471_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNINE-H
FJ787470_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNINE-H
FJ787466_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787465_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787464_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787458_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787457_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNFNE-H
FJ787456_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787455_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787445_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715402_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
FJ715382_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
FJ715367_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
FJ715366_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
FJ715365_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
FJ715350_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715342_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADECLNRRVAEDLNLGNLNE-H
FJ562340_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562339_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562333_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562332_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562331_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562330_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562329_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562325_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562318_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
FJ562315_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562307_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562306_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
FJ562301_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562299_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
FJ562297_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
FJ562295_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
FJ562290_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562288_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562286_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562285_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562283_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562280_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562279_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562275_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562274_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562273_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562269_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562268_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562265_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562264_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562261_HBSP_P-C      MPLSYQHFRKLLLLDVEAGHLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562258_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
FJ562255_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562251_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
FJ562249_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562248_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562244_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562243_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562239_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562238_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562221_HBSP_P-C      MPLSYQHFRKLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
FJ562218_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ518813_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386687_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386685_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386678_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386672_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386671_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386670_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
FJ386667_HBSP_P-C      MPLSYQHFRKLLLLDDEAGSLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386665_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
FJ386663_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386662_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386657_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386652_HBSP_P-C      MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386651_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386650_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386647_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386645_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
FJ386637_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386631_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386629_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386628_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386627_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386621_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
FJ386614_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386613_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
FJ386611_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
FJ386609_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386607_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386605_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386603_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386601_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386598_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386597_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386596_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386592_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386591_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386589_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
FJ386588_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386587_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386577_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386576_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
FJ386575_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ032347_HBSP_P-C      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ032345_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ032341_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ032333_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
FJ032332_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ032331_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023656_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939652_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939651_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-Q
EU939648_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
EU939646_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939643_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939640_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939619_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939618_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939616_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
EU939615_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939611_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939610_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939609_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939607_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939604_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939597_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939596_HBSP_P-C      MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939595_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939594_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939591_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939590_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939587_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939585_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939580_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939576_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939570_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939568_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939566_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
EU939564_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939563_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939561_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939560_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939554_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939553_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939550_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939549_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939548_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939546_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939545_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939544_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939543_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939538_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939537_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939536_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916238_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
EU916234_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916233_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916229_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916224_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916223_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916222_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916217_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916216_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
EU916215_HBSP_P-C      MPLSYQHFRELLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916213_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916212_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916204_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU872010_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU872008_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-I
EU871977_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU871975_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU796069_HBSP_P-C      MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
EU717218_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLDEELPRLADEGLNRRVAEELNLGNLNE-H
EU589336_HBSP_P-C      MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU579443_HBSP_P-C      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU579442_HBSP_P-C      MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU570068_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU562218_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU562217_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU562215_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU560440_HBSP_P-C      MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU554542_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU554540_HBSP_P-C      MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU554539_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU554538_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU554537_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU554536_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU554535_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU439025_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLKLGNLNE-H
EU439015_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU439014_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU439013_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU439009_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU439005_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU410081_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU410080_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU410079_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306728_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306727_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306726_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306724_HBSP_P-C      MPLSYQHFRKLLLLDVEAGTLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306722_HBSP_P-C      MPLFYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306721_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306720_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306719_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306714_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306713_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306675_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306674_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306673_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EF536066_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EF536065_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ986376_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ980551_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ980550_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ975273_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ536414_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ536412_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ536410_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ478899_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ377165_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ377163_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ377162_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ377161_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089800_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089797_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089794_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNINE-H
DQ089793_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
D50519_HBSP_P-C        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
D50518_HBSP_P-C        MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
D50517_HBSP_P-C        MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
D23684_HBSP_P-C        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
D23681_HBSP_P-C        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
D23680_HBSP_P-C        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
D12980_HBSP_P-C        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
D00630_HBSP_P-C        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY641561_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY641559_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AY641558_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY306136_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY247032_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY167099_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY066028_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY057947_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AP011101_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AP011100_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AP011099_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AP011098_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF533983_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF461359_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF461358_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF458665_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF458664_HBSP_P-C      MPLSYQHFRELLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF411410_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF241411_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF241410_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB900116_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB900099_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB697502_HBSP_P-C      MPLSYQHFRKLLLLDNEVGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AB697500_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB697494_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB675677_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670311_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670310_HBSP_P-C      MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670309_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AB670307_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670305_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670304_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670302_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670301_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670300_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AB670297_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670295_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670294_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670292_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670291_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670290_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670289_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670288_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670287_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670285_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670283_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670282_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670281_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670278_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670277_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-Q
AB670276_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670275_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670270_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670269_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670267_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670266_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670259_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670256_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670255_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670254_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670253_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670252_HBSP_P-C      MPLSYQHFRKLLLLDDEGGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670249_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
AB670247_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670243_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AB670242_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRHVAEELNLGNLNE-H
AB642100_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB642099_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB642097_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGXLNE-H
AB642095_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AB640730_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB485808_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB471850_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB471849_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB471848_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367803_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADECLNRRVAEDLNLGNLNE-H
AB367802_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367801_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367435_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367430_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AB367426_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367425_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367424_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367422_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AB367420_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AB367416_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367414_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367412_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367410_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367407_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AB367401_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AB367399_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367398_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367397_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367396_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367395_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367394_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367392_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB365451_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLAEEGLNRRVAEDLNLGNLNE-H
AB362932_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB300373_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNE-H
AB300372_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB300365_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB300359_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB288026_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB250109_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB246345_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB246344_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB241110_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB222715_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB222714_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB205124_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEGLPRLADEGLNRRVAEDLNLGNLNE-H
AB202072_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB202071_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB198082_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB198081_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB198080_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB198079_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB198078_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB198077_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB198076_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB195954_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB195953_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB195952_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB195948_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB195947_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB195944_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
AB195943_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
AB195942_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB195938_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB195937_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB195936_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB195931_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB195930_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB113879_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB113878_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB113876_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB113875_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB111125_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB111124_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB111123_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AB111122_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AB111121_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AB111119_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB111117_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AB111114_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB106895_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-Q
AB050018_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB049610_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB042285_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB042284_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
AB033556_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB033553_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB033552_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB033550_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-Q
AB026815_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB026814_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB026813_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB026812_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB026811_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014399_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014397_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014396_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-Q
AB014394_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014393_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014392_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014389_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014383_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AB014381_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014379_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014378_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014376_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014374_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014369_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040139_HBSP_P-C      MPLSYPHFRKLLLLDNEAXPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040152_HBSP_P-C      MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC792753_HBSP_P-C      MPLSYQHFRKLLLLDNXAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
X52939_HBSP_P-C        MPLSYQHFRKLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
X04615_HBSP_P-C        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MH094411_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG893560_HBSP_P-C      MPLSYQHFRKLLLLDDEAGHLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG893558_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG893557_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG893556_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG826139_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG826122_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC373512_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC373511_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC279274_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
LC279262_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC279261_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC279260_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC279259_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC279258_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC279249_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC279248_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC279247_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC279246_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC279245_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC090200_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY882003_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY882002_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY882001_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881994_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881993_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881990_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881989_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881988_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881987_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881984_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881981_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881979_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881978_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881974_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881972_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881971_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881962_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881961_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881960_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881888_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLDLGNLNE-H
KY881887_HBSP_P-C      MPLSYQHFRELLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881886_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881884_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881881_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881880_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLVDEGLNRRVAEDLNLGNLNE-H
KY881879_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881878_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881877_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881876_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881875_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881874_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881871_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881870_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881818_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881814_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881813_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881812_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881811_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881806_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881805_HBSP_P-C      MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881803_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881777_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881776_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881775_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881774_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881773_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881772_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881771_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881770_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881769_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881768_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881767_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881766_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881765_HBSP_P-C      MPLSYQHFRKLLLLDDEVGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881764_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881763_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881762_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881758_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881755_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881754_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881751_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881750_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881749_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881748_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881744_HBSP_P-C      MPLSYQHFRKLLLLDDEVGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881743_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881742_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881739_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881738_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881737_HBSP_P-C      MPLSYQHFRKLLLLDDEVGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881736_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470934_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KY470933_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KY470930_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KY470929_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KY470905_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470904_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470902_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470901_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470900_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470897_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470896_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470894_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470892_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470891_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470890_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470889_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470888_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLDLGNLNE-H
KY470887_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470886_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLDLGNLNE-H
KY470885_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470884_HBSP_P-C      MPLSYLHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470883_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470882_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470881_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470880_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470879_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470878_HBSP_P-C      MPLSYLHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470877_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470876_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470875_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470874_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470873_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY363283_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY363281_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY363279_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY363278_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY363275_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY363268_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY363264_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY363257_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KY363253_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY363252_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY022423_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX276839_HBSP_P-C      MPLSYPHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964348_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964347_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964346_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964345_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964344_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964342_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964340_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964339_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964338_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964337_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964336_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964334_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964212_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KU964209_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KU964206_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KU964205_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KU964203_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KU964202_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KU964200_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KU964184_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964183_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964182_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964181_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964180_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964179_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964178_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964177_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964176_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964175_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964174_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964173_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964172_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964171_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964170_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964169_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964078_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964077_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964076_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964075_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964074_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964073_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964072_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964071_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964070_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964069_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964068_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964067_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964066_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964065_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964048_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964047_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964046_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEELNLGNLNE-H
KU964045_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964044_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964043_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964041_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964040_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964039_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964038_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964037_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964036_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964035_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964034_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964004_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963997_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963992_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963929_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963928_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963927_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963926_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963925_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963924_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963923_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963922_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963921_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963920_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963919_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963918_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963917_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963916_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963915_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963899_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963898_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963897_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963896_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963895_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963894_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963893_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963892_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963891_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963890_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963889_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963888_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963887_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963886_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963885_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963884_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963881_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963880_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963879_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963878_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963877_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963876_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963875_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963874_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963873_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963872_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU963871_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KT284756_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KT284755_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KT284753_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014092_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014083_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014082_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014078_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRPADEGLNRRVAEDLNLGNLNE-H
KR014077_HBSP_P-C      MPLSYQHFRELLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014060_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014057_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014055_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014049_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014018_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014017_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014015_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014012_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLKLGNLNE-H
KR014011_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014010_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013919_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013909_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013908_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013877_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013873_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013871_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013870_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLKRRVAEDLNLGNLNE-H
KR013868_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KR013858_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013851_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013850_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013834_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KR013833_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEGLNLGNLNE-H
KR013832_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KR013830_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KR013829_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KR013828_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KR013791_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013790_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KR013789_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KR013788_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KR013785_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013784_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013778_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLDRRVAEDLNLGNLNE-H
KR013777_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013776_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013774_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013773_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013772_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNFNE-H
KR013771_HBSP_P-C      MPLSYRHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLDLGNLNE-H
KR013769_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013767_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013765_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013763_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013761_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP784761_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KP027477_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598771_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598770_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598769_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598767_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598766_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598749_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598740_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598718_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598717_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598715_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598713_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598712_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598711_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598710_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598709_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598708_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598707_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598706_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598705_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598701_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598697_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598696_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598695_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598691_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598690_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598688_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598687_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598686_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598681_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598680_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598679_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ410521_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KJ410505_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173445_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173440_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KJ173439_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KJ173438_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173437_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173436_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
KJ173435_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
KJ173434_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173433_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173430_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173429_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173428_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173427_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173426_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173396_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173395_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173338_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173337_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173336_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173335_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173321_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173319_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173318_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KJ173317_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KJ173316_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173315_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173314_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173313_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173312_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173311_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173310_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173309_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173308_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173307_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173306_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173305_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173304_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173303_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173301_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173295_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173294_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173293_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173292_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173289_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173288_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173287_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADESLNRRVAEDLNLGNLNE-H
KJ173284_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173283_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173282_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173281_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF779327_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF779300_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF485389_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF214655_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF214651_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
KC875262_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC875261_HBSP_P-C      MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774361_HBSP_P-C      MPLSYQHFRKLLLLDAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774360_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774358_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774357_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774356_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774347_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774345_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774343_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774342_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774339_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774337_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774336_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774333_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774331_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774329_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774327_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774326_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774314_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774312_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774310_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774309_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774301_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774299_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774295_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774293_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774292_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774290_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774289_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774287_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774286_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774279_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774278_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774276_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774275_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774274_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774271_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774270_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774268_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774266_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774262_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774261_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774259_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774257_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774255_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774251_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774250_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774249_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774248_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774247_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774244_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774241_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774239_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774233_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774231_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774224_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774219_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774218_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774210_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774209_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774208_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
KC774206_HBSP_P-C      MPLSYRHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774205_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774203_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774202_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774200_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774196_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774195_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774192_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774190_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774185_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774181_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX661495_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX661493_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX661492_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX661491_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX661490_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
JX661488_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX504546_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX504541_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX504534_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX429916_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX429912_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX429909_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
JX429907_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
JX429906_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX429904_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX429903_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX026885_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ707730_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707715_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707713_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707709_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ707707_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
JQ688404_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341662_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
JQ341658_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341648_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040166_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040165_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040162_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040156_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040155_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
JQ040144_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040141_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040129_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040127_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JN827415_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JN400088_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JN315779_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM750141_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM750138_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM750137_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM750132_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM750131_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
HM011489_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GU434374_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ872211_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ872210_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475357_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475356_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475354_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475350_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475349_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475348_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475347_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ475345_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475342_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475337_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475334_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ475332_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475331_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ475330_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475327_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ475326_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475325_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475324_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475322_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475321_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475320_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ475319_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475318_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ475317_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475316_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ475315_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ475314_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475313_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ475312_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ475311_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ475310_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ475308_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ475307_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475306_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ377640_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377637_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377621_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377620_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPND-H
GQ377619_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377618_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377617_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377603_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377598_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377585_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377583_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377580_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377579_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377578_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377574_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377563_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377562_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377559_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377557_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ377554_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377553_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377546_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377543_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377541_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377540_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377535_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377533_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377530_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377527_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377526_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377524_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ377523_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377521_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
GQ377517_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ259588_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ227696_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ227695_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ227694_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ899783_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ899777_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ899775_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ899771_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ899768_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ899764_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ899763_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787474_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787468_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787461_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715424_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715421_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715418_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRAAEDLNLGNLNE-H
FJ715416_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715415_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715409_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715407_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715403_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715400_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715398_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715397_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
FJ715395_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
FJ715392_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715389_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715383_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715381_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715380_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715378_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715377_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715376_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715375_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715374_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715372_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715371_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715370_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715360_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715359_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715358_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715353_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715352_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715351_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRAAEDLNLGNLNE-H
FJ715390_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRAAEDLNLGNLNE-H
KC774313_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRAAEDLNLGNLNE-H
KY881889_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRAAEDLNLGNLNE-H
FJ715368_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRAAEDLNLGNLNE-H
KR013783_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRAAEDLNLGNLNE-H
KY881807_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ040135_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014368_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-X
JQ040143_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470920_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774232_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341633_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-X
DQ089791_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023648_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341630_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM011488_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014384_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AB014388_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
FJ386619_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386664_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562225_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562250_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
FJ562252_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562319_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715341_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
FJ787439_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787441_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787451_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
FJ787479_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377529_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ377591_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
GQ475305_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475329_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475339_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475346_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774179_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774204_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774207_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774221_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774253_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774280_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774282_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774285_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774296_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774297_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774298_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774300_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLKLGNLNE-H
KC774302_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774303_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774304_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774308_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774321_HBSP_P-C      MPLSYQHFRKLLLLDAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774325_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774330_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNE-H
KC774340_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774351_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KR013817_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KR013818_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KR013819_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KT364751_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KT364752_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KY363276_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ717827_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRCAEHLNLGNLKE-H
KJ717828_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRCAEHLNLGNLKE-H
EU939541_HBSP_P-C      MPLSYQHFRKLLLLDDKAGPLKKKLPRLANKGLNRRVAKNLNLGNLNE-H
KJ717822_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803810_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089758_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY206376_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AY206379_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AB014365_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
GQ924642_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670260_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF182803_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF182804_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF182805_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU717217_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU871969_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU871970_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU871971_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU871972_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU871973_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386641_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ475333_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
D28880_HBSP_P-C        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
S75184_HBSP_P-C        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KC792880_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB112472_HBSP_P-C      MLLSYQHFRKLLLLDDEAGPLEEEFPRLADEGLNRRVAEDLNLGNLNE-H
DQ089802_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
AY167091_HBSP_P-C      MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
KU964033_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964032_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964031_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964030_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964029_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964028_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964027_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964026_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964025_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964024_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964023_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964022_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964021_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964020_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089801_HBSP_P-C      MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562298_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB368297_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB900109_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AY206385_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU522071_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU882005_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386689_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ410514_HBSP_P-C      MPLSYQHFRKLLFLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KU679951_HBSP_P-C      MPLSYQRFRXLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-Q
KJ717826_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803813_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801493_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADKGLNRRVAEDLNLGNLNE-H
JQ341661_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
LC279276_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
FJ151414_HBSP_P-C      MPLSYQHFPELLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939655_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939656_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089760_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089786_HBSP_P-C      MPLSYPHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AF363961_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013820_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB198083_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377624_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HQ700517_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC792862_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU051424_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765819_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765847_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765855_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY470936_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLSLGNLNE-H
KY470937_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLGLGNLNE-H
AB014395_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598773_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013915_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014007_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013813_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB074756_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AB105174_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB111946_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB117758_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB247916_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB299858_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB300363_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367423_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367428_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367432_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB426467_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670239_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670240_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB670258_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB205123_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ027320_HBSP_P-C      MPLSYQLFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ788835_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY881916_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF214672_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB205125_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF674502_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KM875406_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF214670_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KC774272_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX507211_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVADDLNLGNLNE-H
JQ341653_HBSP_P-C      MPLSYQHFRKLLLLDPEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
DQ089766_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341624_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341628_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX504537_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-L
KJ173333_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-L
KF053170_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-R
KJ803762_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-R
KR013885_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGTLNE-H
KR013890_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGTLNE-H
KR013883_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADGDLNRRVAEDLNLGTLNE-H
KC792921_HBSP_P-C      --LSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC792999_HBSP_P-C      --LSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU871980_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
EU871998_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
DQ993692_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG826143_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013878_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGTLNE-L
JQ341634_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089796_HBSP_P-C      MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-P
AY206378_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLND-P
KC792902_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEDELPRLADEGLNRRVAEDLNLGDLNE-H
KC792799_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-L
EU919165_HBSP_P-C      MPLSYQHFRKLLLLDAGAGPLEEELPRLADEGLNRRVAEDLNLGDPNE-H
EU919164_HBSP_P-C      MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KX276831_HBSP_P-C      MPLSYQHFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNLDE-H
KX276835_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803765_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ790199_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173446_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173442_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173441_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173394_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173393_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173328_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ173327_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF053172_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC793097_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC793024_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774229_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341665_HBSP_P-C      MPLSYQHFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341636_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ027323_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
JQ027319_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM011500_HBSP_P-C      MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
HM011479_HBSP_P-C      MPLSYQHFRKLLLLDXXAGPLEEELPRLADEGLNRRVAEDLXLGXLNE-H
KX276837_HBSP_P-C      MPLSYQHFRKLLLLDHXAGPLEEELPRLADEGLNRRVAEXLXLGXLNE-H
V00867_HBSP_P-C        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM011502_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014363_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
EU939569_HBSP_P-C      MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
EU939601_HBSP_P-C      MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939599_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLAYEGLNRRVAQDLNLGNPNE-H
KR013842_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEEPPRLADEGLNRRVAEDLNLGNLNE-H
FJ562291_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377576_HBSP_P-C      MPLSYQHFRKLQLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377593_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX429913_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774184_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774217_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
KC774220_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774243_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774245_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
KC774265_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774311_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774346_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
KC792995_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013797_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013798_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013844_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013845_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013846_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013847_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013848_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013849_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013961_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRHVAEDLNLGNLNE-H
KJ598635_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598636_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598637_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598638_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598639_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598640_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598641_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598642_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598644_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598645_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598646_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598647_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598659_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598658_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598657_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598656_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598655_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598654_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598653_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598652_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598651_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598650_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598649_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598648_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLVDEGLNRRVAEDLNLGNLNE-H
KJ598660_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLVDEGLNRRVAEDLNLGNLNE-H
KJ598661_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLVDEGLNRRVAEDLNLGNLNE-H
FJ787442_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787443_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916225_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562232_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562282_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377572_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX560519_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939573_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939552_HBSP_P-C      MPLSYQHFRKLLLLNNQAGPLEKELPRLANEGLNRRVAKDLNLGNLNE-H
FJ562304_HBSP_P-C      MPLSYQRFRKLLLLDGEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MF925403_HBSP_P-C      MHLSYQRFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801518_HBSP_P-C      MPLSCQHVRKLMLLYDEAGRIEEELPRIANEGLNRRVAEDVNLGNLNE-H
KJ598741_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598742_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598743_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598744_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598745_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598746_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598747_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598748_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598750_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598751_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598752_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598754_HBSP_P-C      MHLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF053164_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
KJ803757_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
AB112471_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM011472_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-R
MK818227_HBSP_P-C      MPLSYQHFRXLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-R
MG571359_HBSP_P-C      MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KY881991_HBSP_P-C      MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF053184_HBSP_P-C      MPLSYPHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KJ803777_HBSP_P-C      MPLSYPHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
DQ089778_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVADDLNLGNLNE-H
AB111115_HBSP_P-C      RPLSYQHLRKLLMLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KJ717821_HBSP_P-C      MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGTLDE-H
KJ803809_HBSP_P-C      MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGTLDE-H
AB105173_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
DQ089777_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
JF828924_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828925_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828926_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828929_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828930_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JF828931_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367411_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ032351_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386640_HBSP_P-C      MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386624_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ372968_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013827_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014006_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013812_HBSP_P-C      MPQSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF053185_HBSP_P-C      MPLSYQHFRKLLLLDVAAGPLEEELPHLADEGLNRRVAEDLNLGDLNE-H
EU939645_HBSP_P-C      MPLSYQHFRKLLLLDDNAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
FJ386626_HBSP_P-C      MPLSYQHFRKLLLLDDNAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939605_HBSP_P-C      MPLSYQYFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTE-H
EU939582_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774215_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774216_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EF137802_HBSP_P-C      MPLSYQHFRKLLLLDDAAGPLEEELPRLADEDLNRRVADDLNLGNLNE-H
DQ377160_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306729_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ361526_HBSP_P-C      MPLSYQRFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
D50520_HBSP_P-C        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386612_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY641563_HBSP_P-C      MPLSYQHFRKLLLLDDAAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
EF137803_HBSP_P-C      MPLSYQHFRKLLLLDDAAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AY641562_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY220701_HBSP_P-C      MPLSYQLFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AF411408_HBSP_P-C      MPLSYQHFRKLLLLDDEADPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF411411_HBSP_P-C      MPLSYQHFRKLLLLDDEADPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU796070_HBSP_P-C      MPLSYQHFRKLLLLDGEADPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU796072_HBSP_P-C      MPLSYQHFRKLLLLDGEADPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367434_HBSP_P-C      MPLSYQHFRKLLLLDDEACLLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715344_HBSP_P-C      MPLSYQHFRKLLLLDDEACPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB367429_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
DQ986375_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386638_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AB195945_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KR013942_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AB014391_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB113877_HBSP_P-C      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562334_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU439010_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLKLGNLNE-H
EU439011_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLKLGNLNE-H
MF674430_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNHLVAEDLNLGTLNE-H
KY363267_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY363266_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715343_HBSP_P-C      MPFSYQHSRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386661_HBSP_P-C      MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGTLNE-H
FJ023639_HBSP_P-C      MPLSYQHFRKLLLLDDGAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU717214_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ361534_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNE-H
DQ089781_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNE-H
DQ089776_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNHRVAEDLNLGNLNE-H
DQ089773_HBSP_P-C      MPLSYQHFRKLLFLDDEAAPLEEELPRLADEVLNRRVAEDLNLGNLNE-H
AB112063_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGDLNE-H
AB074047_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
AB014360_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014361_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014362_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801487_HBSP_P-C      MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801501_HBSP_P-C      MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013824_HBSP_P-C      MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765839_HBSP_P-C      MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVTEDLNLGNLNE-H
EU717212_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ993181_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
AB111116_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KU964064_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KT284758_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598765_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598757_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598756_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598719_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ598714_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC774281_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715379_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ032340_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939603_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR014014_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KY363254_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
KX276841_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNE-H
KR013998_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-Q
JX507212_HBSP_P-C      MPLSYQHFRKLLLLDNEXGPLEEEPPRLADEGLNRRVAEDLNLGNLNE-H
JQ801523_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEEHPRLADEGLNRRVAEDLNLGNLNE-H
JQ341614_HBSP_P-C      MPLSYQHFRKLLLLEGDAGPLEEELPRLADEGLNRRVAEDLHLGDLNE-H
FJ023655_HBSP_P-C      MPLSYQHFLKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EF494377_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNE-H
AY206386_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGSLNE-Q
AB900113_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
AB367427_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
AB074755_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023640_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023649_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ924615_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ924619_HBSP_P-C      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801478_HBSP_P-C      MPLSYPHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF053167_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF053169_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KF214671_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803759_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803761_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013809_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLKEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013810_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013814_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KR013815_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX765830_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB042282_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
AB042283_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
GQ924629_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPXEEELPLLADEGLNRQVAEDLNVGNVXE-H
GQ924636_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPIEEELPRLADEGLNRRVAEDLNVGNVNE-H
MG826124_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KX765840_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNE-H
KR013822_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGDLNE-H
KP148462_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRPADEGLNRRVAEDLNLGDLNE-H
KM875425_HBSP_P-C      MPLSYQHFRKLLLLEDGAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KM875424_HBSP_P-C      MPLSYQHFRKLLLLEDGAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KJ803754_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTE-H
KJ410489_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTE-H
KF214677_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KF053161_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTE-H
KC793107_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC792911_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGBLNE-H
JX504542_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JX504539_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLSE-H
JQ801517_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLHLGDLNE-H
JQ801508_HBSP_P-C      MPLSYQSFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLHLGDPNE-H
JQ341612_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLSE-H
JQ040164_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
HM011486_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGXLBE-H
GQ924643_HBSP_P-C      MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
GQ924613_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTE-H
GQ924612_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTE-H
GQ184326_HBSP_P-C      MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562266_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
FJ562241_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
FJ562228_HBSP_P-C      MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386673_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939574_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939572_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939562_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTE-H
EU939556_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-R
DQ089804_HBSP_P-C      MPLSYQHFRKLLLLEDDAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
DQ089775_HBSP_P-C      MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF223961_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB697510_HBSP_P-C      MPLSYQHFRKLLFLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
AB014371_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
JX661497_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KU964190_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964189_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964186_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KU964185_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KC792759_HBSP_P-C      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ801510_HBSP_P-C      MPLSYQHFRKLLLLDDKAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ429078_HBSP_P-C      MPLSYQHFRKLLLLDAGAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM011468_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
HM011465_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GU563561_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ924658_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ924650_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ924649_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ924623_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ924616_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ924614_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ924609_HBSP_P-C      MPLSYQHFRKLLLLDDEAGLLEEELPRLAXEGLNRRVAEDLNLGNXNE-H
GQ924604_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377642_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377597_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377584_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377552_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ377551_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ358154_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
GQ358153_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
FJ904423_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ899767_HBSP_P-C      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787463_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787462_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787459_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787454_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ787453_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715357_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ715355_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562337_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562335_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562327_HBSP_P-C      MPLSYHHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562313_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562308_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ562281_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLND-H
FJ562235_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ518810_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386659_HBSP_P-C      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386644_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386639_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386632_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386625_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386618_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386595_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386594_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ386574_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ349225_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ032361_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ032360_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ032359_HBSP_P-C      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023658_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023657_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023654_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023653_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023652_HBSP_P-C      MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023651_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023650_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023647_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023646_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLSLGNLNE-H
FJ023645_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023644_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023643_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023642_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
FJ023641_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939642_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939641_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939613_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939557_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939555_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU939542_HBSP_P-C      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU919168_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU916226_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
EU916218_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU872004_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
EU872003_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
EU872002_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
EU872001_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
EU872000_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
EU871976_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU522068_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306694_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306691_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306690_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306689_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306687_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU306685_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU305542_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU305541_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EU305540_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EF494379_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
EF197911_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ478901_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ361533_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ315783_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ315782_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ315781_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089790_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089789_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089787_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089785_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLAEEGLNRRVAEELNLGNPNE-H
DQ089784_HBSP_P-C      MPLSYQHLRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089783_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLSLGNLNE-H
DQ089782_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089780_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
DQ089779_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089772_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
DQ089770_HBSP_P-C      MPLSYQHFRKLLLLDDEPGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089769_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089768_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089767_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089765_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089764_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089763_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089762_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089756_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE-H
AY862869_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY596108_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY220699_HBSP_P-C      MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AY206392_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNE-H
AY167090_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AP011097_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AJ748098_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF411412_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF223960_HBSP_P-C      MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF223959_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF223958_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF223957_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF223956_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF223955_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF223954_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AF068756_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
AB014386_HBSP_P-C      MPLSYHHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
AB014398_HBSP_P-C      MPLSYQHFRKLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KX276855_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLXLGDLNE-H
AB670274_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGXLNE-H
AB485810_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
AB367804_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KY470979_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KY470978_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KY470977_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KY470976_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KY470975_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLDRRVAEDLNLGDLNE-H
KY470974_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KY470973_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KY470972_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KY470971_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KY470970_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KY470969_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KY470968_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KY470967_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KY470965_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KU964213_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KU964211_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KU964210_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KU964208_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KU964207_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KU964204_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KU964201_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KR013996_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KR013831_HBSP_P-C      MPLSYQHFRKLLLLDDETGPLEEELPRLADEDLNRRVAEDLNLGDLNE-H
KR013825_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KR013823_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KF214669_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
KC774355_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
JQ341613_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
JQ040131_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDLNE-H
JQ027318_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNE-H
GQ377586_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDPNE-H
FJ899765_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
FJ899761_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
FJ787489_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
FJ787488_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
FJ787487_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
FJ562270_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
FJ562242_HBSP_P-C      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
FJ386679_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDLNE-H
EU939659_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
EU939539_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLHLGDLNE-H
DQ089788_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
DQ089771_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
DQ089761_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
DQ089757_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
AB900115_HBSP_P-C      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGDLNE-H
AB670241_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
AB670251_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDLNE-H
AB367431_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
MG826129_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNE-H
MG826138_HBSP_P-C      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEDLNRRVAEDLNLGNLNE-H
MG826128_HBSP_P-C      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
MG571332_HBSP_P-C      MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX276836_HBSP_P-C      MPLSYQHFRKLLLLDNXAGPLEEELPRLADEGLNRRVAEDLNLGNLBE-H
JQ801522_HBSP_P-C      MPLSYQHFRKLLLLDEEAGPVEEELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089792_HBSP_P-C      MPLSYQHFRKLLLLDDXAGPLEXELPRLADEGLNRRVAEDLNLGNLNE-H
DQ089759_HBSP_P-C      MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341656_HBSP_P-C      MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341659_HBSP_P-C      MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
JQ341666_HBSP_P-C      MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNE-H
KX276853_HBSP_P-C      MPLSYQHFRKLLLLEDXAGPLEEELPRLADEXLNRRVAEDLXLGXXNE-H
                                    *       .           .   :.        :  

FJ899773_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
EU881999_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU882000_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
MG826125_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
DQ089795_HBSP_P-C      QPPARGHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
AB112066_HBSP_P-C      QLPSRDHARPARILLKEPLCFPRAAVQNLRTEMALVFPSHHLGLSQDSYG
KF053181_HBSP_P-C      QPPARDHAKPARLLLKEPLCFPHVAVQNLWTETAPVFPSHHLGLSQNTYG
KJ803774_HBSP_P-C      QPPARDHAKPARLLLKEPLCFPHVAVQNLWTETAPVFPSHHLGLSQNTYG
KC774226_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY470980_HBSP_P-C      QLPVRDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KY470981_HBSP_P-C      QLPVRDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KY470982_HBSP_P-C      QLPVRDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KY470983_HBSP_P-C      QLPVRDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KY470984_HBSP_P-C      QLPVRDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KY470985_HBSP_P-C      QLPVRDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KY470986_HBSP_P-C      QLPVRDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KY470987_HBSP_P-C      QLPVRDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KY470988_HBSP_P-C      QLPVRDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KY470990_HBSP_P-C      QLPVRDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KY470991_HBSP_P-C      QLPVRDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
AB241112_HBSP_P-C      PQQARDHAKPARILLKATLCFPHVAVQNLRMEIAPVFPSHHLGLSQNTYG
EU498227_HBSP_P-C      QLPAGDHAGPARLLLKEPLCFPLVAVQNFRTQIALVFPSQHLGLSQNSYG
KJ717825_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNPWTEIALVFPSHHLGLSQDSYG
KJ803812_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNPWTEIALVFPSHHLGLSQDSYG
FJ715364_HBSP_P-C      QLPARDHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562230_HBSP_P-C      QPPARDHARPARVLLKEPLCFPLAAVQNLRTETALVFPSHHHGLSQDSYG
KJ598760_HBSP_P-C      QLPARDHARPARVLLKEPLWFPLVAVQNLRTEIALVFPSHHPGLSQNSHG
KC774213_HBSP_P-C      QLPVRDHARPARFLLTDPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774214_HBSP_P-C      QLPVRDHARPARFLLTDPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562326_HBSP_P-C      QPPARDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
EU939579_HBSP_P-C      QPPARDHARPARLLLEETLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ899774_HBSP_P-C      QPPARDHARPARLLLEETLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU717215_HBSP_P-C      QLPARDHARPARLLPTEPLCFPLVAVQNLRTETVLAFPSHRPGLSQNSYG
AF182802_HBSP_P-C      QLPARDHARPARVPLKETLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB112065_HBSP_P-C      QLPSRDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KY881802_HBSP_P-C      QLPAREHARPARFLLKESLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY363260_HBSP_P-C      QLPARDHARPARFLLEEPLCFPLVAVQNLRTETALVFPSHRPGLSQDSYG
KX765828_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVVVQTLRMEIVLVFPSHLLGLSQDSYG
KR013841_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTGIALVFPSHHLGLSQDSYG
KR013839_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLWLSQDSYG
KR013780_HBSP_P-C      QPPARDHARPARFLLKEPLSFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774288_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774240_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JX026888_HBSP_P-C      QLPARDHARPAQLLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
FJ899789_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTGTALVFPSHHPGLSQDSYG
EU560439_HBSP_P-C      QPPVRDHARPARVLLKEPLCFPLVAVQNLRTETAPVFPSHHPGLSQDSYG
EU547562_HBSP_P-C      QLPARAHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB367402_HBSP_P-C      QLPVRDHARPARVLLKEPLCFPLAAVQNLRTETALVFPSHHPGLSQDSYG
AB367405_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLSQDSYG
KY881819_HBSP_P-C      QLPAREHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY881809_HBSP_P-C      QLPAREHARPARFLLKEPLCFPLVAVQNLRTETALVFSSHHPGLSQDSYG
KU963937_HBSP_P-C      QLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLSQDSYG
KR013875_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLIAVQNLRTETALVFPSHHPGLSQDSYG
KR013869_HBSP_P-C      QLQPRDHARPARVLPKEPLCFPPVAAQNLRTETALVFPSHHLGLSQDSYG
KR013805_HBSP_P-C      QRPARDHARPTRFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013804_HBSP_P-C      QRPARDHARPARSLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013807_HBSP_P-C      QRPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KJ598662_HBSP_P-C      QLPARDHARPARHLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598663_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598664_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598665_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598666_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598667_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598668_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598669_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598670_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598671_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598672_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598673_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598674_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598676_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598677_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598678_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KF053175_HBSP_P-C      QPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KJ803769_HBSP_P-C      QPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ801520_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JN827423_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTAIALVFPSHHLGLSQDSYG
JF828906_HBSP_P-C      QLPARDHAKPARLLLKEPLCFPLVAVQNLRTETALVFPSHHHGLSQDSYG
JF828907_HBSP_P-C      QLPARDHAKPARLLLKEPLCFPLVAVQNLRTETALVFPSHHHGLSQDSYG
JF828911_HBSP_P-C      QLPARDHAKPARLLLKEPLCFPLVAVQNLRTETALVFPSHHHGLSQDSYG
JF828912_HBSP_P-C      QLPARDHAKPARLLLKEPLCFPLVAVQNLRTETALVFPSHHHGLSQDSYG
JF828905_HBSP_P-C      QLPARDHAKPARLLLKEPLCFPLVAVQNLRTETALVFPSHHHGLSQDSYG
JF828908_HBSP_P-C      QLPARDHAKPARLLLKEPLCFPLVAVQNLRTETALVFPSHHHGLSQDSYG
JF828910_HBSP_P-C      QLPARDHAKPARLLLKEPLCFPLVAVQNLRTETALVFPSHHHGLSQNSYG
HQ638218_HBSP_P-C      QLPARDHARPARILPTEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
GQ377545_HBSP_P-C      QLPARGHARPARFLLKEPLCFHLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ899778_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHRPGLSQDSYG
FJ899772_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQSLRTETALVFPSHHPGLSQDSYG
FJ787490_HBSP_P-C      QLPVRDHARPARLLLKEPLCFPPVAVQNLRTETALVFPSHHPGLSQDSYG
FJ787450_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ787448_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHSGLSQDSYG
FJ715422_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGPSQDSYG
FJ715404_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLQTETALVFPSHHPGLSQDSYG
FJ562323_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562245_HBSP_P-C      QLPAREHARPARFLLKEPLCFPLTAVQNFRTETALVFPSHHPGLSQNSYG
EU939658_HBSP_P-C      QLPARDHARPARFLLKEPLCFTLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939653_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTQTALVFPSHHPGLSQDSYG
EU871974_HBSP_P-C      QLPARDHARPARVLLKETLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU589340_HBSP_P-C      QLPVRDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ787481_HBSP_P-C      QLPVRDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU560438_HBSP_P-C      QPPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU522069_HBSP_P-C      QLPARGHARTARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
AY220700_HBSP_P-C      QLPAREHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYE
AY206381_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDTYG
AF384371_HBSP_P-C      QLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
EU560441_HBSP_P-C      QLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
FJ787486_HBSP_P-C      QLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
FJ899776_HBSP_P-C      QLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KR013863_HBSP_P-C      QLQPRDHARPARFLLKEPLCFPPVAVQNLRTETALVFPSHHLGLSQDSYG
KR013864_HBSP_P-C      QLQPRDHARPARFLLKEPLCFPPVAVQNLRTETALVFPSHHLGLSQDSYG
KR013865_HBSP_P-C      QLQPRDHARPARFLLKEPLCFPPVAVQNLRTETALVFPSHHLGLSQDSYG
KR013867_HBSP_P-C      QLQPRDHARPARFLLKEPLCFPPVAVQNLRTETALVFPSHHLGLSQDSYG
AB697490_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386623_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
JF828916_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JF828919_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB675674_HBSP_P-C      QLPARGHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB675675_HBSP_P-C      QLPARGHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670308_HBSP_P-C      QLPARDHARPAQLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU562216_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB493844_HBSP_P-C      QLPARGLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
AB367421_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB367408_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB367413_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
JX026877_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
AB367403_HBSP_P-C      QPPVRDHAKPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLSQDSYG
AB115417_HBSP_P-C      QPPVRDHARPARFLLKAPLCFPLGGGQNLRTEIALVFPSHRPGLSQESYG
AB111113_HBSP_P-C      QLPARDHERPARFLLKESLCVPLVAVQNLRTETALVFPSHHPGLSQNSYG
AB014382_HBSP_P-C      QLPARDHARPARFLLETPLYFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB014377_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLSQDSYG
FJ386677_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTATALVFPSHHLGLSQDSYG
KT366464_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTAIALVFPSHHLGLSQDSYG
MG826134_HBSP_P-C      QLPVRDHARHARFLLKEPLCFPHVAVQNLRTETALVFPSHHLGLSQDSYG
KY470927_HBSP_P-C      QLPTRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSRDSYG
KU964214_HBSP_P-C      QLPVRDPARPARFLLKEPLCFPLVAVQNLRTETTLVFPSHHLGLSQDSYG
KU964014_HBSP_P-C      QLPARDHARPARVLLKETLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KT284757_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013811_HBSP_P-C      QLPARDHARPARFRLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KP148559_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KM875423_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTQTALVFPSHHPGLSQDSYG
KJ803792_HBSP_P-C      QLPARDHARTARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ717802_HBSP_P-C      QLPARDHARTARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ598772_HBSP_P-C      QLPAREHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ410511_HBSP_P-C      QLPARDHARPARFLPTEPLCFPHVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ173290_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDTYG
KC774316_HBSP_P-C      QPPARGHARHARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774191_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTQTALVFPSHHLGLSQDSYG
GQ475351_HBSP_P-C      QPPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377623_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLAAVQNLRTEIALVFPSHHPGLSQDSYG
FJ386620_HBSP_P-C      QPPVRDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
FJ032350_HBSP_P-C      QLPARDHTRPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ032336_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939657_HBSP_P-C      QPPARDHARPARVLLKETLLFPLVAVQNLRTETALVFPSHRPGLSQDSYG
EU670263_HBSP_P-C      QPPVRDHARPARFLLKEPLCFPHVAVQNLRTEIALVFPSHHPGLSQDSYG
EU570072_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETAPVFPSHYPGLSQDSYG
EU306672_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
EU306671_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
DQ922651_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLSQDSYG
DQ922650_HBSP_P-C      QLPARDHARPARLLLKEPLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AP011106_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
AB670279_HBSP_P-C      QPPVRDHARPARLLLKETLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB493839_HBSP_P-C      QRPPQDLARPAQFLLKEPLCFPPVAVQNLRTETALVFPSHHPGLSQDSYG
AB300361_HBSP_P-C      QPPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB298721_HBSP_P-C      QPPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB298720_HBSP_P-C      QPPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB014380_HBSP_P-C      QPPARDHARPARFLLKATLCFPLVAVQNLRMETALVFPSHHPGLSQDSYG
AB014372_HBSP_P-C      QLPARDHARPARLLLKETLRFPLVAVQNLRTETAPVFPSHHPGLSQDSYG
AB014364_HBSP_P-C      QLPARDHARPARFLLKAXLCFPLVAVQNLRTATALVFPSHHPGLSQDSYG
KY881873_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTQTALVFPSHHPGLSQDSYG
AB182589_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB195949_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
AB670261_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670263_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
D23682_HBSP_P-C        QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
D23683_HBSP_P-C        QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ536411_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
DQ536413_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
EU871978_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU871979_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939567_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939593_HBSP_P-C      QLPARDHARPARFLLKAPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939612_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939647_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386602_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386616_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562220_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562293_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562324_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377575_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
DQ246215_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
EU589345_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
FJ386579_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
FJ562320_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JN827418_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
JN827421_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
JN827422_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JN827424_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
JN827425_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
MF488701_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF925409_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MG571335_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
FJ386604_HBSP_P-C      QLPARDHARHARFLLKEPLCFPLVAVQNLRTETALVFPSHHLWLSQDSYG
AB367404_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939588_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JX560520_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR819180_HBSP_P-C      QLPARDHARPAQLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
MG826136_HBSP_P-C      QLPVRDHARPARILLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
MG826127_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
MG826126_HBSP_P-C      QLPARDHARPARHLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
MF925375_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTAIALVFPSHHLGLSQDSYG
MF674504_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674501_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674484_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674472_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674468_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674467_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674454_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674418_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674417_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674412_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674408_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674402_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674390_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674388_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KY881965_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTGTALVFPSHHLGLSQDSYG
KY670782_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KY629631_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KY363287_HBSP_P-C      RLPARDHARPAQLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY363285_HBSP_P-C      QPPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFTSHHPGLSQDSYG
KX276840_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTQIALVFPSHHLGLSQDSYG
KU964198_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KR014021_HBSP_P-C      QLPARDRARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KR013904_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013840_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEVALVFPSHHLGLSQDSYG
KR013838_HBSP_P-C      QLPALDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013837_HBSP_P-C      RLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013836_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013835_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148564_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KM875412_HBSP_P-C      QQQARDPARPARLLLEAPLCFPLVAVQNLRTETAPVFPSHRPGLSQNSYG
KJ803814_HBSP_P-C      QLPARDHARPARFLLKGPLCFPLVAVQNLRTEIALVFPSHHLGPSQDSYG
KJ803793_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
KJ717803_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
KJ173334_HBSP_P-C      QLPARDHARPARHLLKEPLCFPLAAVQNLRTEIALVFPSHHPGLSQDSYG
KF495606_HBSP_P-C      QLPARDHARPARYLLKEPLCFPHVAVQNLRTEIALVFPSHHPGLSQDSYG
KF214668_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLSTEIALVFPSHHLGLSQDSYG
KC793046_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KC792831_HBSP_P-C      QLPARDHARPARLLLQETLRFPHVAVQNLRTETALVFPSHHPGLSQDSYG
KC774353_HBSP_P-C      QLPARDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
KC774335_HBSP_P-C      QLPAREHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774306_HBSP_P-C      QLPARGHARPARFLLKEALCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774252_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774235_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KC774223_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLSQDSYG
KC774211_HBSP_P-C      QLPARDHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774197_HBSP_P-C      QLPARDHARPALFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLSQDSYG
JQ801490_HBSP_P-C      QLPARDHAGPARILLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ707723_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLSQDSYG
JQ707716_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ040154_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLDAVQNLRTETALVFPSHHLGLSQDSYG
JF828923_HBSP_P-C      QLPARDPARPARFLLKEPLCFPLVAVQNLRTQTALVFPSHHPGLSQDSYG
JF828918_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
HM750135_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377538_HBSP_P-C      QPPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ227692_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ787467_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQYLRTETALVFPSHHPGLSQDSYG
FJ787449_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ787447_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ787437_HBSP_P-C      QLPARDHARHARFLLKEPLCFPLVAVQNLRTETALVFPSHHLWLSQDSYG
FJ562310_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
FJ562300_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
FJ562233_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQSLRTETALVFPSHHPGLSQNSYG
FJ386653_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939654_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939617_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939600_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLSQDSYG
EU939592_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939540_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU916237_HBSP_P-C      QPPARDHAGPARFLLKEPLCFPPVAVQNLRTETALVFPSHHPGLSQDSYG
EU916227_HBSP_P-C      QQPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU916211_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAAQNLRTETALVFPSHHPGLSQDSYG
EU916210_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGPSQDSYG
EU872005_HBSP_P-C      QLPARVHARPARFLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLSQDSYG
EU554541_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU547559_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTAIALVFPSHHPGLSQDSYG
EU439016_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLIAVQNLRTETALVFPSHHPGLSQDSYG
DQ975274_HBSP_P-C      QLQARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ377164_HBSP_P-C      QLPARDHARPARFLFKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDPYG
AY206384_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
AY206382_HBSP_P-C      QPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AF473543_HBSP_P-C      QPPARDPARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
AF461363_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AF461357_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AF286594_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670298_HBSP_P-C      QLPARDHARPARILPTEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB471853_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLSQDSYG
AB471852_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLSQDSYG
AB471851_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLSQDSYG
AB367433_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB367418_HBSP_P-C      QLPAREHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB367417_HBSP_P-C      QPPARGHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB367406_HBSP_P-C      QLPARDHARPARLLLKEPLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB300360_HBSP_P-C      QLPARDLARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB246346_HBSP_P-C      QPPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
AB195946_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVVVQNLRTETALVFPSRHPGLSQDSYG
AB195932_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB176642_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB115418_HBSP_P-C      QPPVRDHARPARFLLKAPLCFPFVAVQNLRTEIALVFPSHRLGLSQDSYG
AB111118_HBSP_P-C      QQPARDHARPARFLLKAPLCFPLVAVQNLRMETALVFPSHHPGLSQDSYG
AB111112_HBSP_P-C      QLPARDHARPARFLLKESLCVPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB014373_HBSP_P-C      QLPARDHAGPARLLLKTPQGFPLVAVQNLRTETALVFPSHHPGLSQNSYG
FJ032355_HBSP_P-C      QLPARDHARPALFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ032356_HBSP_P-C      QLPARDHARPALFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB931170_HBSP_P-C      QPPVRDHARPARFLLKGPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
AB931171_HBSP_P-C      QPPVRDHARPARFLLKGPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013993_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU679937_HBSP_P-C      RPPARDLAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNSYG
KF873536_HBSP_P-C      RPPARDLAEPARSLLKEPLCFPHVAVQNLRTXIAPVFPSHXLGLSQNSYG
KU679960_HBSP_P-C      RPPARDLAEPARSLLKEPLCFPHVAVQNLRTAIAPVFPSHHLGLSQNSYG
MK321266_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLAAVQNLRTEIALVFPSHHPGLSQDSYG
MH220971_HBSP_P-C      QLPAREHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KY881891_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY881890_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY881817_HBSP_P-C      QLPAREHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY881815_HBSP_P-C      QLPAREHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY881804_HBSP_P-C      QLPAREHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY629637_HBSP_P-C      QLPARDHARPARHLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KY363274_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KY363256_HBSP_P-C      QLPARDHTRPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KX276838_HBSP_P-C      QPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964343_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR014013_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR014005_HBSP_P-C      QLPPRDRARPARTLLKEPLCFPLVAVQNFRTETALVLPSHHLWLSQDSYG
KR013943_HBSP_P-C      QLPARDHARPARFLLEAPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013853_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSLHPGLSQDSYG
KR013852_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013786_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQYLRTETALVFPSHHPGLSQDSYG
KR013766_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDTYG
KR013764_HBSP_P-C      QLPARDHARPARFLLKEPLCFLLVAVQNLRTETALVFPSHHPGLSQDSYG
KJ803815_HBSP_P-C      QLPARDHARPARFLLKGPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ803811_HBSP_P-C      QLPARDHARPARFLLKGPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ717823_HBSP_P-C      QLPARDHARPARFLLKGPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ717791_HBSP_P-C      QLPARDHARPARFLLKGPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KJ598777_HBSP_P-C      QLPAREHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598768_HBSP_P-C      QLPAREHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598716_HBSP_P-C      QLPAREHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KJ410499_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ410494_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ410492_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ410491_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ173291_HBSP_P-C      QLPAREHARPARFLHKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774334_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774238_HBSP_P-C      QLPARGHARPAPFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JX661489_HBSP_P-C      QLQARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ341635_HBSP_P-C      QRTARDHAKPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341619_HBSP_P-C      QLPAQDHARPARFLPTEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ040161_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVVVQNLRTETALVFPSHHPGLSQDSYG
JN400089_HBSP_P-C      QLPARDHARPARFLLKAPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JN400087_HBSP_P-C      QLPARDHARPARFLLKAPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ924633_HBSP_P-C      QPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ924620_HBSP_C-C      QQQARDHARPAQLXLKAPLCFPLVAVQNLRTETAPVFPSHHPGLSQNSYG
GQ475355_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
GQ475352_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ475343_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377615_HBSP_P-C      QLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
GQ377609_HBSP_P-C      QLPPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
GQ377608_HBSP_P-C      QLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
GQ377599_HBSP_P-C      QLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
GQ377571_HBSP_P-C      QLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
GQ377536_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
FJ787484_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
FJ787469_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ751770_HBSP_P-C      QPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ715391_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562292_HBSP_P-C      QLQPRDHARPARFLFKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
FJ562284_HBSP_P-C      QPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562276_HBSP_P-C      QLPVRDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ151413_HBSP_P-C      QPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ032339_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ032338_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939626_HBSP_P-C      QLPARGHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939625_HBSP_P-C      QLPARGHARPARLLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
EU939586_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939584_HBSP_P-C      QPQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
EU939571_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
EU939558_HBSP_P-C      QRPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU919169_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
EU881996_HBSP_P-C      QPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
EU872013_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU872012_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU871982_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU589344_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
EU589341_HBSP_P-C      QLPVRDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU306688_HBSP_P-C      QLPPRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
DQ993693_HBSP_P-C      QPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ993691_HBSP_P-C      QPPARGHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ478885_HBSP_P-C      QPPARGHARLARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ089803_HBSP_P-C      QLPARDHARPARILLKGPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
DQ089799_HBSP_P-C      QPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AY247031_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AY206389_HBSP_P-C      QPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AY167096_HBSP_P-C      QPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AY167092_HBSP_P-C      QQPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
AB971715_HBSP_P-C      QPPARGHAGPARLLFKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB971714_HBSP_P-C      QPPARGHAGPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670273_HBSP_P-C      QLPARDHARPAQXLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670238_HBSP_P-C      QLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB300362_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB014390_HBSP_P-C      QLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB014385_HBSP_P-C      QLPARDHARPARLLLRTPLCFPLVAVQNLRMETALVFPSHHPGLSQDSYG
AB014367_HBSP_P-C      QLPVREHAGPARFLLKEPLCFPPVAVQNLRTETAPVFPSHHPGLSQDSYG
AB670237_HBSP_P-C      QPPVRDHARPARLLLKXPLCFPLVAVQNLRTETALVFPSHHXGLSQDSYG
GQ475328_HBSP_P-C      QPPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
MH818373_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
MG893553_HBSP_P-C      QPPTRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
MG826140_HBSP_P-C      QPPVRDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
MG826137_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
MG826135_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
MG826133_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
MG826132_HBSP_P-C      QLPVRDHARPARVLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
MG826131_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
MF674471_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
LC279253_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
LC279252_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
LC279251_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
LC279250_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY881998_HBSP_P-C      QLPARDHARPARFPLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881997_HBSP_P-C      QLPARDHARPARFLLKETLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY881980_HBSP_P-C      QLPARDHARPARFLLKETLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY881966_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY881883_HBSP_P-C      QLPARDHARPARFLLKETLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY881882_HBSP_P-C      QLPARDHARPARFLLKETLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY881872_HBSP_P-C      QLPARDHARPARFLLKETLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY881810_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRKETALVFPSHHPGLSQDSYG
KY470966_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSNG
KY470926_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY470925_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY363284_HBSP_P-C      QPPVRDHARHARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY363280_HBSP_P-C      QLPARDHARPARFLLKESLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KX765843_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765836_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
KX276833_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHLGLSQDSYG
KU964333_HBSP_P-C      QRPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964332_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964331_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964330_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964329_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964328_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964327_HBSP_P-C      QRPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964326_HBSP_P-C      QRPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964325_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964324_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964323_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964322_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964321_HBSP_P-C      QRPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964320_HBSP_P-C      QPPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964319_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964318_HBSP_P-C      QRPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964228_HBSP_P-C      QLPVRDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964227_HBSP_P-C      QQPVRDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964226_HBSP_P-C      QQPVRDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964225_HBSP_P-C      QLPVRDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964224_HBSP_P-C      QLPVRDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964223_HBSP_P-C      QQPVRDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964222_HBSP_P-C      QLPVRDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964221_HBSP_P-C      QLPVRDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964220_HBSP_P-C      QQPVRDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964218_HBSP_P-C      QLPVRDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964217_HBSP_P-C      QQPVRDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964216_HBSP_P-C      QLPVRDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964215_HBSP_P-C      QQPVRDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964063_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KU964062_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KU964061_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KU964060_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KU964059_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KU964058_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KU964057_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KU964056_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KU964055_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KU964054_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KU964053_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KU964052_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KU964051_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KU964050_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KU964049_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHRLGLSQDSYG
KU964019_HBSP_P-C      QLPARDHARPARVLLKETLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964018_HBSP_P-C      QLPARDHARPARVLLKETLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964017_HBSP_P-C      QLPARDHARPARVLLKETLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964016_HBSP_P-C      QLPARDHARPARVLLKETLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964015_HBSP_P-C      QLPARDHARPARVLLKETLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964013_HBSP_P-C      QLPARDHARPARVLLKETLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964012_HBSP_P-C      QLPARDHARPARVLLKETLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964011_HBSP_P-C      QLPARDHARPARVLLKETLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964002_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU963996_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU963882_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR014099_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR014098_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR014059_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR014048_HBSP_P-C      QLPARDHARPARSLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KR014043_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR014041_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR014002_HBSP_P-C      QLPPRDRARPARTLLKEPLCFPLVAVQNLRTETALVLPSHHLWLSQDSYG
KR014000_HBSP_P-C      QLQPRDNARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHLWLSQDSYG
KR013899_HBSP_P-C      QLPAQDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013876_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013874_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013872_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013866_HBSP_P-C      QLQPRDHARPARFLLKEPLCFPPVAVQNLRTETALVFPSHHLGLSQDSYG
KR013796_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013795_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013794_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013793_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013792_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013768_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KP148570_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ598780_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598779_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598778_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598776_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598775_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598774_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598762_HBSP_P-C      QLPAWDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KJ598753_HBSP_P-C      QLPARDHARLARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KJ598703_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KJ598702_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KJ598699_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KJ598698_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KJ598694_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KJ598693_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KJ598689_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KJ173432_HBSP_P-C      QLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KJ173431_HBSP_P-C      QLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KJ173302_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KF873544_HBSP_P-C      RPPARXLAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNSYG
KF873541_HBSP_P-C      RPPARDLAEPARSLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLSQNSYG
KF873539_HBSP_P-C      RPPARDLAEPARSLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLSQNSYG
KC792834_HBSP_P-C      QXPARDHARPARLLLKETLRFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774359_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774354_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774348_HBSP_P-C      QLPPRDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774267_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774260_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774242_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JX870000_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JX661496_HBSP_P-C      QLQPRDHARPARFLLKGPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
JX504544_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JX429917_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JX026884_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JX026878_HBSP_P-C      QLPARDHARPARFRLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ341670_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ341631_HBSP_P-C      QPPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ040145_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
JN827414_HBSP_P-C      QQQARDHARPARLLLKAPLCFPLVAVQNLRTEIAPVFPSHHPGLSQNSYG
HM750139_HBSP_P-C      QLPVRDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
HM011481_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLSQDSYG
GU721029_HBSP_P-C      QPPARDHARPARLLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
GQ924655_HBSP_P-C      QPPAQDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
GQ475353_HBSP_P-C      QLPARDHARSARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ475336_HBSP_P-C      QPPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377632_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
GQ377631_HBSP_P-C      QLPPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377605_HBSP_P-C      QLPPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377600_HBSP_P-C      QLPPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ358157_HBSP_P-C      QPPARDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
GQ227693_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ899795_HBSP_P-C      QQPARDHARTARFLLKEPLCFPLVAVQNLRAETALVFPSHHPGLSQDSYG
FJ899794_HBSP_P-C      QQPARDLARTARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ899793_HBSP_P-C      QQPARDLARTARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ787452_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ715406_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ715405_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562272_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
FJ562256_HBSP_P-C      QLPARGHARHARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386630_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386617_HBSP_P-C      QQPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ032334_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939614_HBSP_P-C      QQPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
EU939583_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939578_HBSP_P-C      QLPARDHARLARFLLKEPLCFPLVAVQNLRTETAPVFPSHHPGLSQDSYG
EU916219_HBSP_P-C      QLPARDHARSAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU916214_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU439012_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU439008_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU306725_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EF688062_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
DQ975272_HBSP_P-C      QLPARDHARLARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AY641560_HBSP_P-C      QLPVRDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AP011107_HBSP_P-C      QLPVRDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
AB670306_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670272_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670268_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVVVQNLRTETALVFPSHHPGLSQDSYG
AB670265_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670264_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670262_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670248_HBSP_P-C      QLPARDHARTARFLLKEPLCFPLVAVQNLRTETALVFPSHRPGLSQDSYG
AB670246_HBSP_P-C      QLPARDHARTARFLLKEPLCFPLVAVQNLRTETALVFPSHRPGLSQDSYG
AB241113_HBSP_P-C      PPPARDPAKPARILLKAPLCFPHVAVQNLRTETAPVFPSHHPGLSQNSYG
AB241111_HBSP_P-C      PQQARDHARPARLLLKAPLCFPLVAVQNLRTETAPVFPSHHPGLSQNSYG
AB111120_HBSP_P-C      QQPARDHARPARFLLKAPLCFPLVAVQNLRMETALVFPSHHPGLSQDSYG
AB033551_HBSP_P-C      QLPARDHARTARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
AB014387_HBSP_P-C      QQTARDHARPARFLLKTPLCFPLVAVQNLRTEIALVFPSHHPGLSQNSYG
KY881973_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KU964042_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVPNLRTETALVFPSHHPGLSQDSYG
HQ700529_HBSP_P-C      PLPARDLARPARFLLKEXLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
JQ027322_HBSP_P-C      QLPARDHARPARLLLKEXLCFPLVAVXNLRTETALVFPSHHPGLSQDSYG
MH891502_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
MH887433_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
MG826123_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MG725248_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
MF925410_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
MF925408_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF925406_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF925405_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF925395_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF925394_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF925387_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF925377_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF925376_HBSP_P-C      QLPARDHARPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLSQDSYG
MF925374_HBSP_P-C      QLPARDHARPARFLLKEPLCFPPVAVQNLRTEIALVFPSHHLGLSQDSYG
MF925369_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF925367_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF925365_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF925359_HBSP_P-C      QLPARDHARPARFLLKEPLCFPPVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674514_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674494_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674489_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674486_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674475_HBSP_P-C      QLPARDHARPARFLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674474_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674463_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674458_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQNSYG
MF674457_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674444_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674442_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674435_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674429_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674428_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
MF674425_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQNSYG
MF674411_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674403_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674399_HBSP_P-C      QLPARDPARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674398_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF674386_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
MF488703_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
LC318703_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
LC318702_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
LC279275_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
LC279257_HBSP_P-C      PLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
LC279256_HBSP_P-C      PLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
LC279255_HBSP_P-C      PLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
LC279254_HBSP_P-C      PLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KY882000_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881999_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881996_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881995_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881992_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881986_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881985_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881983_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881982_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881977_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881976_HBSP_P-C      RLPARDHARPTRFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881975_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881970_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881969_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881968_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881967_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881964_HBSP_P-C      QLPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881963_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881959_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881943_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881942_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881941_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881940_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881939_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881938_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881937_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881936_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881935_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881934_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881933_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881932_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881931_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881930_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881929_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881928_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881927_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881926_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881925_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881924_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881923_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881922_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881921_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881920_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881919_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881918_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881917_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KY881915_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNPRTETALVFPSHHLGLSQDSYG
KY881892_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY470918_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KY470917_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KY470916_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KY470915_HBSP_P-C      QLPARDHARPARFLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLSQDSYG
KY470914_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KY470913_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KY470912_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KY470911_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KY470910_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KY470909_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KY470908_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KY470907_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KY470906_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KY363286_HBSP_P-C      QLPARDHARPAQLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KY363261_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KX774506_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX774504_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX774503_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765853_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765852_HBSP_P-C      QPPARDHARPARXLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765851_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765850_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765849_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765848_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765846_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765845_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
KX765844_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
KX765842_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765838_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765837_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765834_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765833_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765832_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765831_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765829_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765827_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
KX765826_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765825_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
KX765824_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765823_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765822_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765821_HBSP_P-C      QLPARDHAGPARFLLKEPLCFPLVAVQNLRKEIALVFPSHHLGLSQDSYG
KX765820_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX765818_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX276854_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX276852_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVLPSHHLGLSQDSYG
KX276851_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX276850_HBSP_P-C      QLPARDHARPARXLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX276849_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
KX276848_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX276847_HBSP_P-C      QQPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KX276844_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KU964365_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964364_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964363_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQNSYG
KU964362_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964361_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964360_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964359_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964358_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQNSYG
KU964357_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964356_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964355_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964354_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964353_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964352_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964350_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964349_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQNSYG
KU964341_HBSP_P-C      QPPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964219_HBSP_P-C      QLPARDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964199_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964197_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964196_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964195_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964194_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964193_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964192_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964191_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964188_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU964187_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KU963914_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KU963913_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KU963912_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KU963911_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KU963910_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KU963909_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KU963908_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KU963907_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KU963906_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KU963905_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KU963904_HBSP_P-C      QLPARDHARPARYLLKEPLCLPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KU963903_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KU963902_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KU963901_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KU963900_HBSP_P-C      QLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
KU051427_HBSP_P-C      QLPARDHARPARCLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KU051426_HBSP_P-C      QLPARDHARPARCLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KU051425_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRMEIALVFPSHHLGLSQDSYG
KU051423_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KT987426_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KT987425_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KT987424_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KT987423_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KT366463_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQNSYG
KT364721_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KT364718_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KT347089_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KT307719_HBSP_P-C      QLPARDHARPARCLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KT307718_HBSP_P-C      QLPARDHARPARCLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KT284759_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KR013984_HBSP_P-C      QRPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013935_HBSP_P-C      QLPARDHARPARFLLKEPLCFPPVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013927_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013923_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013905_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013903_HBSP_P-C      QLPAQDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013902_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013900_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013862_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KR013861_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KR013860_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KR013859_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KR013857_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013856_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013855_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013854_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013826_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013821_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013808_HBSP_P-C      QRPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013803_HBSP_P-C      QRPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPELSQDSYG
KR013802_HBSP_P-C      QRPARDHARPARFLLKEPLCSPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013787_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRSEIALVFPSHHLGLSQDSYG
KR013782_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013781_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013779_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KR013770_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KR013762_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KP148575_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148574_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148573_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148572_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148571_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148568_HBSP_P-C      QLPARDHAGPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148567_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148566_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148563_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148562_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148561_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148560_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148558_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148557_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148555_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148554_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148552_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148551_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148549_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148548_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148547_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148546_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148545_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148543_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148540_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148538_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148537_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148535_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148534_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148532_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148531_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148530_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148529_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148528_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148526_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148525_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148524_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148523_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148521_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148520_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVVVQNLRTEIALVFPSHHLGLSQDSYG
KP148519_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148517_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148514_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148513_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148512_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148493_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLRLSQDSYG
KP148492_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148491_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148489_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148488_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148487_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148483_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148482_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148481_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148480_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148479_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148477_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148476_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVVVQNLRTEIALVFPSHHLGLSQDSYG
KP148475_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148474_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148473_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148472_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148471_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148470_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148469_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148468_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148466_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148465_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148464_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148463_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KP148315_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KM875430_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KM875429_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KM875428_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVVVQNLRTEIALVFPSHHLGLSQDSYG
KM875411_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KM875405_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KM875404_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KM359441_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KM229703_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KM213037_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KJ803826_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ803823_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ803818_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ803800_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ803799_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ803780_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ803779_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ803776_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
KJ803770_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ803760_HBSP_P-C      RLPARDHARPARILLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ717844_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ717839_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ717834_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ717812_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ717811_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ717810_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ717809_HBSP_P-C      QLPAPDHAKPARFLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ717790_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ410519_HBSP_P-C      QLPARDHAKPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ410515_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ410513_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ410510_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KJ410508_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ410504_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ410501_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ410498_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ410496_HBSP_P-C      QLPARDHARPARILLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ410495_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ410493_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ173444_HBSP_P-C      QLPARDHARPARFLLKEPLCFPPVAVQNLRTETALVFPSHHPGLSQDSYG
KJ173443_HBSP_P-C      QLPARDHARPARFLLKEPLCFPPVAVQNLRTETALVFPSHHPGLSQDSYG
KJ173392_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KJ173391_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KJ173332_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KJ173331_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KJ173324_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ173323_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ173296_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHRLGLSQDSYG
KJ173286_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KJ173285_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KF485390_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KF214676_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KF214673_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KF214667_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQNSYG
KF214652_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KF053193_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KF053187_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KF053183_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
KF053177_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KF053176_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KF053168_HBSP_P-C      RLPARDHARPARILLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KC875274_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KC875273_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KC875272_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KC875271_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KC875270_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KC875269_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KC875268_HBSP_P-C      QVPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KC792658_HBSP_P-C      QLPARDHARPAPFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774352_HBSP_P-C      QLPARDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774338_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774320_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KC774318_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KC774315_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KC774284_HBSP_P-C      QLPARDHARPARFLHKDPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774283_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KC774277_HBSP_P-C      QLPARDHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774264_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774256_HBSP_P-C      QLPARDHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774254_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774237_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KC774236_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KC774228_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
KC774227_HBSP_P-C      QLPARDHARPARFLLKEPLCFPPVAVQNLRTEIALVFPSHHLGLSQDSYG
KC774225_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774199_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KC774194_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774189_HBSP_P-C      QLPARDHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774187_HBSP_P-C      QLPARDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774182_HBSP_P-C      QPPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
KC774180_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
KC315399_HBSP_P-C      QQPAPDHAKPAQLLLKGPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JX507214_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JX504545_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHLGLSQDSYG
JX504536_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
JX504535_HBSP_P-C      QLPARDHAKPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLSQDSYG
JX429918_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
JX429915_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
JX429914_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JX429905_HBSP_P-C      QLPARDHARPAPFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ801521_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQNSYG
JQ801519_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801515_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801513_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801511_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801509_HBSP_P-C      QPPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801505_HBSP_P-C      QLPARDHARPARFLLKEPLCFPPVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801504_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801503_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801502_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801500_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
JQ801499_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801497_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801496_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801495_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801491_HBSP_P-C      QLPARDHARPARLLLKEPLCFPIVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801489_HBSP_P-C      QLPARDHARPARFLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801488_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801486_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801483_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801482_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
JQ801481_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801480_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801475_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
JQ801473_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801472_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ801470_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ707774_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ707773_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ707772_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ707771_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ707770_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ707769_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ707768_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ707733_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707732_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707731_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707729_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707728_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707727_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707726_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707725_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTENALVFPSHHPGLSQDSYG
JQ707724_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707722_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707721_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707720_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707719_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707718_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707717_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707712_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707711_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707710_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ707708_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ688403_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341669_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341668_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341664_HBSP_P-C      QLPARDHARPARXLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341663_HBSP_P-C      QLPARDHARPARFLHKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341657_HBSP_P-C      QLPARDXARPARHLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341655_HBSP_P-C      QLPARDHARPARXLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341654_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341652_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341651_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQBSYG
JQ341650_HBSP_P-C      QLPARDHARPARFLLKEPLCFPXVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341649_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341647_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIAXVFPSHHLGLSQDSYG
JQ341644_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341643_HBSP_P-C      QPXARGHARPARXLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ341642_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341641_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341639_HBSP_P-C      QPPARDHARPARXLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341637_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341626_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341622_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341621_HBSP_P-C      QPPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341620_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341618_HBSP_P-C      QLPARDHAXPARFLLKEPLCFPLVAVQNLRTEIAXVFPSHHLGLSQDSYG
JQ341617_HBSP_P-C      QLPARDHARPARXLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341616_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341615_HBSP_P-C      QLPAWDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ341611_HBSP_P-C      QLPARDHARPARXLLKEPLCFPLVAVQNLRTEIAPVFPSHHLGLSQDSYG
JQ040172_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
JQ040168_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ040163_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
JQ040158_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ040151_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ040149_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JQ040133_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ027333_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ027324_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ027321_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JQ027317_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JN827420_HBSP_P-C      QPPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JN827417_HBSP_P-C      QLPARDHAGPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JN827416_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
JF899336_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRMEIALVFPSHHLGLSQDSYG
JF828937_HBSP_P-C      QLPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JF828928_HBSP_P-C      QLPARDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JF828922_HBSP_P-C      QLPARDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JF828921_HBSP_P-C      QLPARDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JF828920_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JF828917_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JF828915_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JF828913_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
JF436920_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
HQ700543_HBSP_P-C      QLPARDHARPARFLLKAPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
HQ700522_HBSP_P-C      QLPARDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
HQ622095_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
HM750140_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDSYG
HM750136_HBSP_P-C      QLPARDHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
HM750134_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
HM011497_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
HM011495_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVPNLRTEIALVFPSHHLGLSQDSYG
HM011493_HBSP_P-C      QLPARDHARPARHLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
HM011491_HBSP_P-C      QQPARDPARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLSQDSYG
GU357845_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ475344_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ475341_HBSP_P-C      QPPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ475338_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ475323_HBSP_P-C      QQPARDHARPAPFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ475309_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377636_HBSP_P-C      PLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377628_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377616_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377601_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377577_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377570_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377555_HBSP_P-C      QLPARDHARPARHLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
GQ377531_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377528_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377518_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377515_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ377514_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
GQ358158_HBSP_C-C      QLPARDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
GQ227697_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ899788_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ787471_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
FJ787470_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ787466_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ787465_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ787464_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ787458_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
FJ787457_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
FJ787456_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
FJ787455_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
FJ787445_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ715402_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ715382_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ715367_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ715366_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ715365_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ715350_HBSP_P-C      QQPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ715342_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562340_HBSP_P-C      QLPARDHARPARLLLKTPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562339_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSNG
FJ562333_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562332_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562331_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562330_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562329_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562325_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562318_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562315_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
FJ562307_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562306_HBSP_P-C      QLPARDHARHARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562301_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562299_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562297_HBSP_P-C      QPPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562295_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
FJ562290_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562288_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562286_HBSP_P-C      QLPARDLARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562285_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562283_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562280_HBSP_P-C      QLPAQDLARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562279_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562275_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562274_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562273_HBSP_P-C      PLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562269_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562268_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562265_HBSP_P-C      QLPARDHARPARFLLKEPLCFPRVAVQNLRTEIALVFPSHHPGLSQNSYG
FJ562264_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562261_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562258_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562255_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562251_HBSP_P-C      QLQARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562249_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562248_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562244_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562243_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562239_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562238_HBSP_P-C      QLPALDHARPARYLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562221_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ562218_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ518813_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
FJ386687_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386685_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386678_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386672_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386671_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386670_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386667_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386665_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386663_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
FJ386662_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386657_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386652_HBSP_P-C      QLPARDHARPAQFLLKAPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386651_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386650_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
FJ386647_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHRPGLSQDSNG
FJ386645_HBSP_P-C      RLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386637_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386631_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386629_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386628_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386627_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386621_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386614_HBSP_P-C      QRPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386613_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386611_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHRPGLSQDSYG
FJ386609_HBSP_P-C      PLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386607_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRMETALVFPSHHPGLSQDSYG
FJ386605_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386603_HBSP_P-C      QLPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386601_HBSP_P-C      QLPARDHAGPARLLLKEPLCFPLVAVPNLRTETALVFPSHHPGLSQDSYG
FJ386598_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386597_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386596_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386592_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386591_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
FJ386589_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386588_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386587_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386577_HBSP_P-C      QLPARDHARPARFLLKAPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386576_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ386575_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ032347_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ032345_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ032341_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
FJ032333_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ032332_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ032331_HBSP_P-C      QLPARDHARPARFLLKAPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
FJ023656_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
EU939652_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939651_HBSP_P-C      QLPARDHARPARLLLKGPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939648_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939646_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
EU939643_HBSP_P-C      QLPAQDLARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
EU939640_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939619_HBSP_P-C      QLPARDHARPARLLHKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939618_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939616_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939615_HBSP_P-C      QLPARDHARPAQXLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939611_HBSP_P-C      QQPAQDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939610_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939609_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939607_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939604_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939597_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939596_HBSP_P-C      QLPARDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
EU939595_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939594_HBSP_P-C      QLPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939591_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939590_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939587_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939585_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939580_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939576_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939570_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939568_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
EU939566_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939564_HBSP_P-C      QLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939563_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939561_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939560_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939554_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939553_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
EU939550_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939549_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLSQDSYG
EU939548_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939546_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939545_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939544_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939543_HBSP_P-C      QLPARDHARHARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939538_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939537_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU939536_HBSP_P-C      RLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU916238_HBSP_P-C      QPPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU916234_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU916233_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU916229_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU916224_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU916223_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU916222_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVSPSHHPGLSQDSYG
EU916217_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU916216_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU916215_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVSPSHHPGLSQDSYG
EU916213_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU916212_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU916204_HBSP_P-C      QQPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU872010_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU872008_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
EU871977_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU871975_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU796069_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQASYG
EU717218_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
EU589336_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU579443_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU579442_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU570068_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU562218_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU562217_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU562215_HBSP_P-C      QLPARDHARPTQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU560440_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU554542_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU554540_HBSP_P-C      QLPARDHARPARLLLKEPLCSPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU554539_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU554538_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU554537_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU554536_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU554535_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU439025_HBSP_P-C      QLPARDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLSQDSYG
EU439015_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU439014_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU439013_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU439009_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU439005_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU410081_HBSP_P-C      PQQARDHAKPARLLLKAPLCFPLVAVQNLRTETAPVFPSHHPGLSQNSYG
EU410080_HBSP_P-C      PQQARDHARPARLLLKAPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
EU410079_HBSP_P-C      PQQARDHARPARLLLKAPLCFPLVAVQNLRTETAPVFPSHHPGLSQNSYG
EU306728_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU306727_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU306726_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU306724_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU306722_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU306721_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU306720_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU306719_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU306714_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU306713_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU306675_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU306674_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EU306673_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EF536066_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
EF536065_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ986376_HBSP_P-C      QLPARDHARPARLLLKEPLCLPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ980551_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ980550_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ975273_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ536414_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
DQ536412_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
DQ536410_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
DQ478899_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ377165_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ377163_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ377162_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ377161_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ089800_HBSP_P-C      QLPARDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ089797_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHRPGLSQDSYG
DQ089794_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
DQ089793_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
D50519_HBSP_P-C        QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
D50518_HBSP_P-C        QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
D50517_HBSP_P-C        QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
D23684_HBSP_P-C        QLPARDHARPARFLLKAPLCFPLVAVQNLRMETALVFPSHHPGLSQDSYG
D23681_HBSP_P-C        QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
D23680_HBSP_P-C        QLPAQDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
D12980_HBSP_P-C        QLPARDHARPARFLLKEPLCFPLVGVQNLRTETALVFPSHHPGLSQDSYG
D00630_HBSP_P-C        QLPARDHARPARFLLKEPLCFPPVAVQNLRTETALVFPSHHPGLSQDSYG
AY641561_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AY641559_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQNSYG
AY641558_HBSP_P-C      QLPARDHARPARFLLKAPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AY306136_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AY247032_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AY167099_HBSP_P-C      QPPARDHARPARFLLKEPLCFPLVAVQNLRTENALVFPSHHPGLSQDSYG
AY066028_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
AY057947_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIARVFPSHHPGLSQNSYG
AP011101_HBSP_P-C      PQQARDHARPARLLLKAPLCFPLVAVQNLRTEIAPVFPSHHPGLSQNSYG
AP011100_HBSP_P-C      PQQARDHARPARLLLKAPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
AP011099_HBSP_P-C      PQQARDHARPARLLLKAPLCFPLVAVQNLRTEIAPVFPSHHPGLSQNSYG
AP011098_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AF533983_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AF461359_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AF461358_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AF458665_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AF458664_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AF411410_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AF241411_HBSP_P-C      QQQARDHARPARLLLKAPLCFPLVAVQNLRTEIAPVFPSHHPGLSQNSYG
AF241410_HBSP_P-C      QQQARDHARPARLLLKAPLCFPLVAVQNLRTEIAPVFPSHHPGLSQNSYG
AB900116_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB900099_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB697502_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB697500_HBSP_P-C      QLPAQDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB697494_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
AB675677_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670311_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670310_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
AB670309_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670307_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670305_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
AB670304_HBSP_P-C      XLPARDHARPARFLLKEPLCFPLVVVQNLRTETALVFPSHHPGLSQDSYG
AB670302_HBSP_P-C      QLPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670301_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670300_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670297_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670295_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670294_HBSP_P-C      QLPARDHARPARFLLKAPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670292_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670291_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670290_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670289_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670288_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670287_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670285_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLSQDSYG
AB670283_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670282_HBSP_P-C      QLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670281_HBSP_P-C      QLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670278_HBSP_P-C      QLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670277_HBSP_P-C      QLPARDHARPARVLLKDPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670276_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670275_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670270_HBSP_P-C      QLPARDHARPAQLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670269_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670267_HBSP_P-C      QLPARDHAXPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670266_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670259_HBSP_P-C      RLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670256_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670255_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670254_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
AB670253_HBSP_P-C      QLPARDHARPAQLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQDSYG
AB670252_HBSP_P-C      QLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLSQNSYG
AB670249_HBSP_P-C    &