HBVdb

Dataset for protein HBe of genotype C

[Download (right click)] [Edit] [Sequences] [Repertoires]

2115 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


JQ801523_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774240_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939541_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377552_HBe_P-C      KQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGGSEELLS-FLP
MF488703_HBe_P-C      MQLFHLRLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS-FLP
FJ562329_HBe_P-C      KQLFHLCLIISCSCPTVQASKLLIGWLWGMDIDPYKEFGAPVDILF-FFP
EU939552_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674425_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674458_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089785_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASQELIS-FLP
DQ089775_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
AY269140_HBe_P-C      MQLFHLCLIISCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU717214_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASRELLS-FLP
EU872005_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASRELLS-FLP
KJ598762_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
DQ089787_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
KR013996_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
JX507211_HBe_P-C      ALLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
EU939658_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX276846_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWNMDIDPYKEFGASVELLS-FLP
KR013819_HBe_P-C      MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AY596108_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013837_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803770_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS-FLP
KR013823_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
KR013820_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWNMDIDPYKEFGASVELLS-FLP
KJ410491_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWDMDIDHYKEFGASVELLS-FLP
HM011497_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670275_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
AF241411_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AY247031_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386618_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562232_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562238_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDLYKEFGASVELLS-FLP
KX276841_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
MF925394_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674475_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
KX276840_HBe_P-C      LQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
KR013857_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013840_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKGFGASVELLS-FLP
KJ410514_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
KC774357_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774331_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774316_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF363961_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013826_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
KR013825_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
KR013824_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWPWSMDIDPYKEFGASAELLS-FLP
KR013822_HBe_P-C      MQLLHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
KR013821_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
KM875430_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KM875404_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
JN104437_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MG571335_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
HM011486_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
KX276853_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASXXLLS-FLP
KR013854_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674457_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDAYKEFGASVELLS-FLP
MF674442_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013856_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDTDPYKEFGASVELLS-FLP
KR013855_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013770_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ410519_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173286_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173285_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774330_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774329_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774312_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ341544_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ341518_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDXYKEFGASVELLS-FLP
JQ341541_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASXELLS-FLP
MG826132_HBe_P-C      MQLFHLCVIISCACPTVLASPLCLGWVWGMDIDPYIEFGASVEILS-FLP
KY881972_HBe_P-C      MQLFHLCLIISCSCPTVQSSELCLGWLWGMDIEPYKEFGASVKLLS-FLP
FJ562248_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
AB105173_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGATVELLS-FLP
KJ410510_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGRLWGMDIDPYKEFGASVELLS-FLP
D00630_HBe_P-C        MQLFHLCLIISCSCPTVQASKLCLGWLRGMDIDTYKEFGASVELLS-FLP
AY206378_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
KR014059_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
AB014364_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ848339_HBe_P-C      --FFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASGELLS-FLP
KY881987_HBe_P-C      MHLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881872_HBe_P-C      MQLFHDYIIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY363275_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDLDTYKEFGASVELLS-FLP
KC774253_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ040143_HBe_P-C      MQIFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
KX276852_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS-FLP
EU939643_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
AB014376_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB105174_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
AB113875_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FMP
AB113876_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FMP
AB300372_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
FJ386638_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013943_HBe_P-C      MQLLHLCLIISCSCPTVQASKLCLGWLWGMDLDTYKEFGASVELLS-FLP
KJ598638_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
KJ598637_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
KF214672_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377543_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
FJ562332_HBe_P-C      MQLSHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562318_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
FJ562272_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
FJ386609_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386595_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023648_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939641_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS-FLP
AB670297_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089759_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700544_HBe_P-C      --LFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
V00867_HBe_P-C        --LFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367395_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU872013_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
EU916234_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
FJ386632_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
FJ386647_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562285_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475342_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013862_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
JQ040162_HBe_P-C      MQIFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881871_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ040167_HBe_P-C      MQIFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
JQ040172_HBe_P-C      MQIFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS-FLP
DQ089791_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
DQ089776_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
GQ924655_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
DQ089790_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
DQ089777_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
DQ089781_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
AB246346_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
AY167092_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
DQ089778_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS-FLP
FJ386644_HBe_P-C      MQIFHLCLIISCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB112063_HBe_P-C      MQLFHLCLIISCLRPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ924629_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715343_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AY641558_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLVWLWGMDIDPYKEFGASVELLS-FLP
JN400088_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLVWLWGMDIDPYKEFGASVELLS-FLP
JN400087_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLVWLWGMDIDPYKEFGASVELLS-FLP
JN400089_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLVWLWGMDIDPYKEFGASVELLS-FLP
DQ922651_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB112408_HBe_P-C      MQLFEFFLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASEELLS-FLP
AB111946_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB042282_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX661490_HBe_P-C      MQLFHLCLVISCSCTRVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ924636_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089786_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089780_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB205125_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF223955_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF223956_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF223959_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF473543_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AY862869_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089779_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089782_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FWP
DQ089783_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU562216_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801501_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX504539_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC875263_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGAPVELLS-FLP
KC774353_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774352_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774334_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801520_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JN104434_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828910_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS-FLP
JF828905_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS-FLP
GQ872210_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKKFGASVELLS-FLP
GQ377609_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787454_HBe_P-C      MQPFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715424_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
FJ715422_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
FJ715389_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715376_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715364_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715357_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562282_HBe_P-C      MQLFLLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562273_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASAELLS-FLP
FJ562264_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
FJ386653_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ032356_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939605_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
EU916212_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU916210_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVVLLS-FLP
EU410079_HBe_P-C      MXLFHLCLIISCSCPTVQASXLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU306719_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU306687_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ922649_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ536414_HBe_P-C      MHLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ536413_HBe_P-C      MHLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
DQ089801_HBe_P-C      MQLFHLWLIISCSCPTVQASKRCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ040127_HBe_P-C      MQLFXLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASXELLS-FLP
FJ023624_HBe_P-C      MQLIHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939554_HBe_P-C      MLLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
DQ478899_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089773_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB042283_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148564_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803790_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598691_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774300_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774284_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ040145_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ924609_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377631_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377605_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377559_HBe_P-C      TQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377521_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715372_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ032334_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939648_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU570074_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU570073_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EF688062_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ536411_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
DQ246215_HBe_P-C      MQLFHSCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089789_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089784_HBe_P-C      MQLFHLCLIISCSCXTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670306_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ751770_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EF197911_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803766_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KF485389_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KF214673_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KF214671_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC875272_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC875271_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC875270_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC875269_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC875268_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC875267_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC875262_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC875261_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774361_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774360_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774359_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774358_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774356_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774351_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774348_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774347_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774343_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774342_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774339_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774337_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774336_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774335_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774333_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774327_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774325_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774321_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774320_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774318_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774315_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774314_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774313_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774310_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774309_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774308_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774304_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774303_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774302_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774299_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774298_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774295_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774293_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774292_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774290_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774289_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774287_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774285_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774283_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774281_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774280_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774277_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774276_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774274_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774272_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774271_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774270_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774268_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774267_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774261_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774260_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774255_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774254_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774252_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774250_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774244_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774242_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774241_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774239_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774238_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774237_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774236_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774235_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774233_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774216_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774215_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774214_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774213_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774206_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774196_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774187_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774185_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774184_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774182_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774181_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774180_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX661488_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX560519_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX504546_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX504545_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX504544_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX504537_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX429917_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX429916_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX429915_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX429913_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX429912_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX429909_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX429907_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX429906_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX429905_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX429904_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX429903_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801519_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801513_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801511_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801505_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801504_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801502_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801497_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801496_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801490_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801489_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801488_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801487_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801486_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801482_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801475_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801473_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801470_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ688404_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ688403_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ040163_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ040133_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ027319_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JN827425_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JN827424_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JN827423_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JN827422_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JN827421_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JN827420_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JN827418_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JN827417_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JN827416_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JN827415_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JN827414_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JN104440_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JN104435_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JN104433_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF899336_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828920_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828919_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828918_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828917_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828916_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828915_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828913_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828912_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS-FLP
JF828911_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS-FLP
JF828908_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS-FLP
JF828907_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS-FLP
JF828906_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS-FLP
HQ700574_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700573_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700572_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700569_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700568_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700567_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700566_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700565_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700564_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700563_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700562_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700561_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700558_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700556_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700555_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700516_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700504_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700502_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700496_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700495_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700456_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HM750141_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HM750140_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HM750139_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HM750138_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HM750137_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HM750136_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HM750132_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HM750131_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HM011489_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HM011465_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GU721029_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GU563561_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GU434374_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ924649_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ924633_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ924614_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ924604_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ855548_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ855544_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ855534_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ855528_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ855525_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ855523_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475355_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475354_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475347_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475346_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475345_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475344_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475339_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475338_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475334_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475333_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475331_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475330_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475329_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475328_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475327_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475325_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475321_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475320_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS-FLP
GQ475319_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475317_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475316_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475315_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475314_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475313_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475312_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475311_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475310_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475309_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
GQ475308_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475307_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475306_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475305_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377642_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377640_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377637_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377624_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377619_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377618_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377617_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377616_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377615_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377601_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377600_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377598_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377585_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377584_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377580_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377579_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377578_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377576_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377574_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377572_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377571_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377570_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377562_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377555_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377554_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377553_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377551_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377545_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377541_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377540_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377538_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377536_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377535_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377533_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377531_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377528_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377527_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377524_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377523_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377517_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377515_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377514_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ358158_HBe_C-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ358157_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ358154_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ259588_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
GQ227696_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
GQ227695_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGTDIDHYKEFGASVELLS-FLP
GQ227694_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
GQ227693_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
FJ899777_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
FJ899775_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ899763_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787479_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787471_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLP-FLP
FJ787453_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787449_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787447_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787441_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787439_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ751765_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ751764_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715409_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715407_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715405_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715403_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715400_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715398_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715397_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715395_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715383_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715382_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715381_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715380_HBe_P-C      MQLFHLCLILSCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715379_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715378_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715377_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715374_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715371_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715370_HBe_P-C      MQLFHLCLIISCSCPNVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715367_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FVP
FJ715365_HBe_P-C      MQLFHLCLIISCSCPNVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715359_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
FJ715358_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715355_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715353_HBe_P-C      MQLFHLCLIISCSCPNVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715352_HBe_P-C      MQLFHLCLIISCSCPNVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715350_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715342_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562325_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS-FLP
FJ562323_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562320_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562307_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
FJ562298_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS-FLP
FJ562297_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562288_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562283_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562279_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
FJ562274_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562269_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562258_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562252_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
FJ562245_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562244_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562218_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ518813_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386678_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386673_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASAELLS-FLP
FJ386667_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386664_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386659_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASXELLS-FLP
FJ386657_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS-FLP
FJ386652_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386651_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
FJ386639_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386628_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386619_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386616_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
FJ386612_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386607_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386591_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386588_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386587_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386577_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386575_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ349225_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ032361_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ032355_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ032350_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ032346_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ032341_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ032340_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ032339_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ032332_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ032331_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023658_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023657_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023656_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023654_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023653_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023650_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023649_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023647_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023646_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023644_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023643_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023642_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023641_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023625_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023591_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023590_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023589_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023587_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023571_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023568_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023567_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023566_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939642_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
EU939619_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939615_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
EU939611_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939609_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939604_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939597_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939593_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
EU939584_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939574_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
EU939572_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
EU939557_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939549_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU919168_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU916238_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU916237_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU916225_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU916224_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU916217_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU916215_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU881996_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU872010_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU871982_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU796072_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
EU796070_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
EU670263_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU589345_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU579442_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU570068_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU570067_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU562217_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU562215_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU560440_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU554539_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU554538_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU554537_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU554535_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU522069_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLT-FLP
EU522068_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU410081_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU410080_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU306729_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU306721_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU306720_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU306714_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU306713_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU306694_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU306691_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU306690_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU306689_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU306688_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU306685_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU306673_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU305540_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EF536066_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS-FLP
EF536065_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS-FLP
EF384201_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EF137802_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ993693_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ993690_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ922650_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ683578_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
DQ478901_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ377165_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLP-FLP
DQ377164_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ377163_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ377162_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ377161_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ377160_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ315783_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ315782_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS-FLP
DQ315781_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089793_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089769_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089765_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089764_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089763_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089758_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
D50519_HBe_P-C        MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
D28880_HBe_P-C        MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
D23680_HBe_P-C        MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
D12980_HBe_P-C        MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AY641560_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AY596107_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AY269099_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AY220700_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AY220699_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AY206389_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AY206384_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AY206382_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
AY167090_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AY066028_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
AY057947_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AP011107_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AP011106_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AP011101_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AP011100_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AP011099_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AP011098_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AP011097_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AJ748098_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF458664_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF411411_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
AF411408_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
AF384366_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF384365_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF384364_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF286594_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF241410_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF223960_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089762_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
FJ386662_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDLYKEFGASVELLS-FLP
AB697510_HBe_P-C      IQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB112066_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU439013_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279250_HBe_P-C      MQLFHLSLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881802_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013961_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKKFGASVELLS-FLP
KR013817_HBe_P-C      MQLFHLCLIISCSCPTIQASKLCLGWPWGMDIDHYKEFGASVELLS-FLP
KP148476_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700543_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB675674_HBe_P-C      MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB675675_HBe_P-C      MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715341_HBe_P-C      MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377529_HBe_P-C      MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377591_HBe_P-C      MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MK321266_HBe_P-C      MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY363277_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLP-FLP
KR013801_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYIEFGASVELLS-FLP
KR013796_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670310_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF411412_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013800_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
KJ410494_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KJ410492_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ410489_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX507214_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715421_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
X04615_HBe_P-C        MQLFPLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279252_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881988_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881889_HBe_P-C      MQLFHLCLIISCSCPTVQASKPCLGWLWGMDIDPYKEFGASAELLS-FLP
KY470991_HBe_P-C      MQLFHLCLIISCPCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470990_HBe_P-C      MQLFHLCLIISCPCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470983_HBe_P-C      MQLFHLCLIISCPCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470937_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470925_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFRASVELLS-FLP
KY470900_HBe_P-C      MQLFHLCLIISCSCPTVQASKLRLGWLWGMDVDPYKEFGASVELLS-FLP
KY470882_HBe_P-C      MQLFHLCLIISCSCPTAQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470874_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX276851_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964198_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964078_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964002_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963997_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963996_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963891_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU051423_HBe_P-C      MQLFHLCLIISCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT307719_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013975_HBe_P-C      MQLFHLCLIISCSCPTVQASKLRLGWLWGMDIDTYKEFGASVELLS-FLP
KR013846_HBe_P-C      MQLFHLCLIISCSCPPVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013818_HBe_P-C      MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDAYKEFGASVELLS-FLP
KR013808_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013780_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013773_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013772_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013762_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148572_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148568_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKAFGASVELLS-FLP
KP148558_HBe_P-C      MQLFHLCLIIPCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148540_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148532_HBe_P-C      MQLFHLCLIISCSCPTVQASRLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148526_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148464_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148315_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KM359441_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KJ803815_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803774_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598699_HBe_P-C      MQLFPLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598642_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KF873541_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
MH220971_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MG826123_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674428_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881812_HBe_P-C      MHLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881807_HBe_P-C      MHLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881806_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881777_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881776_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881775_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881774_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881773_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881772_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881771_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881770_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881769_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881768_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881767_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881766_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881765_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881764_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881763_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881762_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881758_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881755_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881754_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881751_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881750_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881749_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881748_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881744_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881743_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881742_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881739_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881738_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881737_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881736_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY363256_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-SLP
KU964046_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013984_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148547_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148474_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ410498_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173394_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173393_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173316_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MG826126_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674444_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881814_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470885_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013904_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013771_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
X75665_HBe_P-C        MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MH891502_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MH887433_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MH094411_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MG893560_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MG893557_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MG893556_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MG893553_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
MG826135_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MG826134_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MG826133_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MG826128_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MG826127_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MG725248_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF925410_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF925408_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF925377_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF925376_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF925375_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF925367_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
MF925365_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF925359_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674502_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674501_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674494_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674489_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
MF674484_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674474_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674472_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674467_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674454_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674435_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674429_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674418_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674412_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674408_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674403_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674402_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674388_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674386_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC373512_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC373511_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC318703_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC318702_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279276_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279275_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279274_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279262_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279261_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279260_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279259_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279258_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279257_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279256_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279255_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279254_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279253_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279251_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279249_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279248_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279247_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279246_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC279245_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
LC090200_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881984_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881980_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881970_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881967_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881928_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881920_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881880_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881818_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881815_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881803_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY689471_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY670782_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY629631_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470988_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470987_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470986_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470985_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470984_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470982_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470981_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470980_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470934_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470929_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470916_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470905_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470904_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470903_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470902_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470901_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470899_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470897_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470896_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470895_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470894_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470892_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470891_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470890_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470889_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470888_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470886_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470884_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470883_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470881_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470880_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470879_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470878_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470876_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470875_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470873_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY363279_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY363278_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY363276_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY022423_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX774506_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765855_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765853_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765851_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765850_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765849_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765848_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765847_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765846_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765845_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765844_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765843_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765840_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765839_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765838_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765837_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765836_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765833_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765832_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765831_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765830_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765829_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765827_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765826_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765825_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765824_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765823_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765821_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765820_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765819_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765818_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964348_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964347_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964346_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964345_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964344_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964342_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964341_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964340_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964339_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964338_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964337_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964336_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964334_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964329_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964326_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964324_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964323_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964321_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964228_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964227_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964226_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
KU964225_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964224_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964223_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
KU964222_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
KU964221_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964220_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964218_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964217_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964216_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964214_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964199_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964197_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964196_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964195_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964194_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964193_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964192_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964191_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLX-FLP
KU964190_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964189_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964188_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964187_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964186_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964185_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964176_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964076_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964075_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964074_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964073_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964072_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964071_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964070_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964069_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964068_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964067_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964066_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964065_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964064_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964063_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964062_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964061_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964060_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964059_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964058_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964057_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964056_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964055_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964054_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964053_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964052_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964051_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964050_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964049_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964048_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964047_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964045_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964044_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964043_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964042_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964041_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964040_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964039_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964038_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964037_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964036_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964035_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964034_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964033_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964032_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964031_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964030_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964029_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964028_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964027_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964026_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964025_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964024_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964022_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964021_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964020_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963992_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963914_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963913_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963912_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963911_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963910_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963909_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963908_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963907_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963906_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963905_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963904_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963903_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963902_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963901_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963900_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963899_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963898_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963897_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963896_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963895_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963894_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963893_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963892_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963890_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963889_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963888_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963887_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963886_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU679936_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDXYKEFGASVELLS-FLP
KU051427_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU051426_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU051425_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU051424_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT987426_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT987425_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT987424_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT987423_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT366463_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT364752_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT364751_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT364721_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT364720_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT364719_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT364718_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT307718_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT284758_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT284756_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT284755_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT284754_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT284753_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR014098_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
KR013969_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
KR013942_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013909_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013908_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013877_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013875_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013873_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013871_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013858_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013851_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLS-FLP
KR013850_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLS-FLP
KR013834_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013833_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013832_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013830_HBe_P-C      MQLFHLCLINSCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013829_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013828_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013815_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013813_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013812_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013811_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013810_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013809_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013799_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013798_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013797_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013794_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013793_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013792_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013791_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013790_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013789_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013788_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS-FLP
KR013787_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013786_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013785_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013784_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013783_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013782_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013781_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVESLS-FLP
KR013779_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013776_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013774_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP784761_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148574_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148573_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148571_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148562_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148561_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148560_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148555_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148551_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148549_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148546_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148545_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148538_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148535_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148531_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148529_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148524_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148521_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148520_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGVSVELLS-FLP
KP148517_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148512_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148493_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148492_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148488_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148482_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148481_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148480_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148475_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148473_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCFGWLWGMDIDPYKEFGASVELLS-FLP
KP148471_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148470_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148469_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148468_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148466_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148463_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP027477_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KM229703_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KM213037_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803818_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803811_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803799_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803793_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803792_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803759_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ790199_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598772_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598753_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598752_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598749_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598740_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598719_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS-FLP
KJ598718_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS-FLP
KJ598717_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS-FLP
KJ598716_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598715_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS-FLP
KJ598714_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS-FLP
KJ598713_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS-FLP
KJ598712_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS-FLP
KJ598711_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS-FLP
KJ598710_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598709_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS-FLP
KJ598708_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS-FLP
KJ598707_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS-FLP
KJ598706_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS-FLP
KJ598705_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS-FLP
KJ598701_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598698_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598697_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598696_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598695_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598694_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598690_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598689_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598688_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598686_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASAELLS-FLP
KJ598679_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASAELLS-FLP
KJ598659_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598641_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598640_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598639_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598636_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598635_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ410513_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ410501_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ410496_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ410495_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173446_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173445_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
KJ173444_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173443_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173442_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173441_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173440_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173439_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173438_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173437_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173436_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173435_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173434_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173433_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173430_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173429_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173428_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173427_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173426_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173396_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173395_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173392_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173391_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173336_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173335_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173333_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173332_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173331_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173328_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173327_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173324_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173321_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173317_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173315_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173314_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173313_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173312_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173311_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173310_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173309_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173308_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173307_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173306_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173305_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173304_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173303_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173302_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173301_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173296_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173295_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173294_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173293_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173292_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173291_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173289_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173288_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173287_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173284_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173283_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173282_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173281_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KF495606_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964023_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KF485390_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKESGASVEILS-FLP
KP148563_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLP-FLP
KC774179_HBe_P-C      MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS-FLP
KC774297_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS-FLP
MF925403_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
KJ803757_HBe_P-C      MQLFHLCLIISCSCPTVQASRLCLGWLWGMDIDPYKEFGASVELLS-FLP
KF214670_HBe_P-C      MQLFHLCLIISCSCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS-FLP
DQ975272_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
AB014373_HBe_P-C      MXLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KF214677_HBe_P-C      MQLFPLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
GQ377623_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089788_HBe_P-C      MQLFHLCLIISCSCSTVQASKLCLGWLWSMDIDPYKEFGASLELLS-FLP
AB900115_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS-FLP
AB182589_HBe_P-C      MQLFHLCLIISCSCPTVQASKLVLGWLGGMDIDPYKEFGASVELLS-FLP
KJ410505_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ410508_HBe_P-C      MQLFHLCIIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707768_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707769_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707770_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707771_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707772_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707773_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707774_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB195942_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB195943_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB195944_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367401_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
FJ787456_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
AB111118_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
AF223961_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939573_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470913_HBe_P-C      MQLFYLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470908_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ040164_HBe_P-C      MQIFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASXELLS-FLP
HM750135_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HM042269_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS-FLP
HM011491_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
GQ924658_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELIS-FLP
FJ023677_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AY306136_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIGPYKEFGASVELLS-FLP
AY167091_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELIS-FLP
AB670268_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
AB074755_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ924620_HBe_C-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700522_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715404_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELPS-FLP
FJ715406_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELPS-FLP
AY167099_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS-FLP
EU562218_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS-FLP
AF461357_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF461363_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF384367_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ536410_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367412_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB471849_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670290_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB300361_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGGSVEPLS-FLP
AB195952_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
AB195953_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB195954_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB112472_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPNKEFGASVELLS-FLP
AB112471_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPNKEFGASVELLS-FLP
AB112348_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGGLWGMDIDPYKVFGASVELLS-FLP
AB112065_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
AB111125_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
AB111124_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
AB246344_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
AB111117_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS-FLP
AB111123_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
AB367435_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB014363_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KM875412_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
JQ429078_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLP-FLP
FJ386640_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
FJ386617_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGGLWDMDIDHYKEFGASVELLS-FLP
EU939586_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDHYKEFGASVELLS-FLP
EU554541_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
AY206386_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
AB670285_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB205124_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB042285_HBe_P-C      TQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774306_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB014369_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
FJ562333_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KJ803823_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS-FLP
GQ377563_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLEWLWGMDIDPYKEFGASVELLS-FLP
FJ386626_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU796069_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774311_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ980551_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
DQ975273_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
DQ980550_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
DQ361526_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715366_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
D50517_HBe_P-C        MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FMP
D50518_HBe_P-C        MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FMP
AF458665_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
AB670309_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670241_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
AB014387_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLXDMDIDPYKEFGASAELLS-FLP
AB014368_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB014394_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB014395_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB026811_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB026812_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB026813_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB026814_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB026815_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB031262_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB033550_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB033551_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB033552_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB033556_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB050018_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB074756_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB111119_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB111120_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB113879_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB117758_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLCGMDIDPYKEFGASAELLS-FLP
AB014360_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
AB014362_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
AB014391_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
FJ715402_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLS-FLP
EU306727_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLS-FLP
AB670300_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
AB670265_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KF873544_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWXMDIDXYKEFGASXQLLS-FLP
JQ027320_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
FJ562293_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDHYKEFGASVELLS-FLP
FJ386631_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDSYKEFGASVELLS-FLP
FJ032345_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
EU939640_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
EU939600_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
EU939582_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
EU554542_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
DQ089796_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
AF223958_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF223957_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF223954_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF068756_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB697500_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB697494_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB697490_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB675677_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670307_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670305_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670304_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670294_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670292_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670287_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670283_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670282_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670281_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670267_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670261_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670254_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670252_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670247_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670238_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB642100_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB640730_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB485808_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB471853_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB471852_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB471850_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB471848_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB426467_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367417_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367413_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367411_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367409_HBe_P-C      MQLFHLCLIISCSCPTVLASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367403_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367402_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
AB367399_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367398_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367397_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367396_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367394_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB362932_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB300365_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB300363_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB300362_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB300359_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB299858_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB288026_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB250109_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB247916_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB246345_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB241111_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB241110_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB222715_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB222714_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB205123_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB198083_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB198082_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB198081_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB198080_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB198079_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB198078_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB198077_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB198076_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB176643_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLS-FLP
AB195949_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ410518_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ410511_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASMELLS-FLP
JQ341517_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFXASVELLS-FLP
JQ027324_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562327_HBe_P-C      MQLFHSCLIISCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386650_HBe_P-C      MQLFHLCLLISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939626_HBe_P-C      MKLFHLCLIISCSCPTIQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
EU939599_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939536_HBe_P-C      MELFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089756_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
AB670246_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367434_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB202072_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ478900_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB202071_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB014361_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KY881994_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881961_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881819_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX276844_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLXWLXGMDIDPYKEFGASVELLS-FLP
KJ803777_HBe_P-C      MQLFHLLLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
JX870000_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX661497_HBe_P-C      MQLFHLCLVISCSCPTVQASKLCLGWLWDMDIDHYKEFGASVELLS-FLP
JX026877_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS-FLP
JQ801472_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
JQ040165_HBe_P-C      MQIFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLX
FJ715344_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386594_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
EU939603_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
EU939562_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
EU939544_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
EU916233_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
EU570072_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLVWLWGMDIDTYKEFGASVELLS-FLP
EF494377_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
AF411410_HBe_P-C      MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670278_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLS-FLP
AB367392_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
AB014379_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLXDMDIDPYKEFGASVELLS-FLP
AB014380_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
AB300368_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
JX661489_HBe_P-C      MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX661492_HBe_P-C      MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX661496_HBe_P-C      MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386598_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803780_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881977_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881963_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881810_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470910_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013861_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASTELLS-FLP
KP148566_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148557_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148548_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148525_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KF214675_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774319_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774288_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX661495_HBe_P-C      MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX661491_HBe_P-C      MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX507212_HBe_P-C      MQLFHLCLIISCSCPTVQAYKLCLGWLWGMDIDPYKEFGASAQLLS-FLP
JQ801517_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
JQ801500_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
JQ040149_HBe_P-C      MQFFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ027333_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828937_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ924642_HBe_P-C      MQLFHLCLIIYCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
FJ787465_HBe_P-C      MQLFHLCLIISCSCPTVQASKLYLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787457_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELFS-FLP
FJ787455_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
FJ715391_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLQ
FJ715390_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLQ
FJ715351_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLQ
FJ715368_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLQ
FJ715418_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLQ
FJ562324_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ518810_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
FJ386603_HBe_P-C      LQLFHLCLIFSCSCPTGQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023655_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939652_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939625_HBe_P-C      MQLFHLCLIISCSCPTIQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
EU916227_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU589341_HBe_P-C      MQLFHLFLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU560438_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS-FLP
DQ089768_HBe_P-C      LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASSELLS-FLP
AY247032_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB074047_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS-FLP
MG571345_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
MF925395_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674471_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
MF488701_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY882003_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY882002_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881997_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881989_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881917_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881891_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881890_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881888_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881885_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881881_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881878_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470911_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY363266_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KU964208_HBe_P-C      MQLFYLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KU963926_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVQLLS-FLP
KU963917_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013974_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148559_HBe_P-C      MQLFHLCLIISCSCPSVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803814_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803779_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
KF873539_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
JX661493_HBe_P-C      MQLFHLCLVISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX026888_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801495_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS-FLP
GQ855541_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377518_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
FJ787469_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715375_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ032351_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ023652_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
EU871976_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
AY206385_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670277_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670269_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670249_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367414_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB014365_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS-FLP
FJ151413_HBe_P-C      MQLFHLCLIISCSCPTVQAFKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ027323_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KF214676_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
MF925378_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674390_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881978_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881973_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881892_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881886_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881883_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881882_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881877_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881876_HBe_P-C      ILLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470975_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
KY470967_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470920_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KY470917_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KY470907_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KU964343_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964077_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR014060_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KR014055_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KR013860_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS-FLP
KR013859_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS-FLP
KR013853_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013831_HBe_P-C      MQLFHLCLIISCSCPTVQTSKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013814_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013803_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803776_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
KJ803761_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803754_HBe_P-C      LQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KF214651_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774286_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS-FLP
JQ801522_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ040168_HBe_P-C      MQXFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ040156_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGXDIDPXKEFGASSELLS-FLP
JQ040151_HBe_P-C      MQIFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASAELLS-FLP
GQ855543_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS-FLP
GQ377620_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDLDPYKEFGASVELLS-FLP
FJ787461_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ715392_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
FJ562304_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562266_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
FJ023640_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939571_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939550_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
EU871998_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU871980_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU439005_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU306722_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089795_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
DQ089772_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089767_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGAXVELLS-FLP
DQ089760_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670291_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
AB670289_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670266_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLS-FLP
HM011488_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLXXMDIDPYKEFGASXELLS-FLP
AB367410_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB642099_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670253_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AF533983_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB111112_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASXELLS-FLP
AB014377_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MG826122_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS-FLP
MF925409_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF925405_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF925398_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF925387_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674504_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674417_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
KY882001_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY882000_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881999_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881998_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881995_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881992_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881986_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881985_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881983_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881982_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881975_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881969_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881968_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881965_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881959_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881937_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881936_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881935_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881934_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881933_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881932_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881931_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881930_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881929_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881927_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881926_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881925_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881924_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881923_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881922_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881921_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881919_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881918_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881916_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881915_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY689435_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470972_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470971_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470918_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGVSVELLS-FLP
KY470915_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470914_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470912_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470909_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470906_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470887_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY363284_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLRGMDIDPYKEFGASVELLS-FLP
KY363274_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KT284759_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013935_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013852_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KR013802_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148570_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148554_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148534_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148528_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148523_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148513_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KM875425_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KM875424_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803826_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
KJ803813_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598645_HBe_P-C      RQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173432_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173431_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ173337_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KF214678_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC875265_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC875264_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774355_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774354_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774345_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774340_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774338_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774326_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774301_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774296_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS-FLP
KC774282_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774279_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774278_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KC774269_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
KC774251_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX504542_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX504541_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
JX504536_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX429918_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYEEFGASVELLS-FLP
JQ801509_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ801483_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
JQ801481_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
JQ707733_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707732_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707731_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707730_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707729_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707728_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707727_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707726_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707725_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707724_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707723_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707722_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707721_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707720_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707719_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707718_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707717_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707716_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707715_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707713_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707712_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707711_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707710_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707709_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707708_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ707707_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ040154_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ040132_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ027322_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ027321_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ027317_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASMELLS-FLP
JN315779_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828931_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828930_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828929_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828928_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828926_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828925_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828924_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828923_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828922_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF828921_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JF436920_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700571_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700570_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700476_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ638218_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HM750134_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ924616_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
GQ924613_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ924612_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
GQ872211_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
GQ475332_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475326_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475322_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ475318_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS-FLP
GQ377636_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377632_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377628_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377597_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377593_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377583_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
GQ377577_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ904423_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLS-FLP
FJ899789_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ899788_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787481_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787468_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787467_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787466_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787464_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787463_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787462_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787458_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787443_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ787442_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLSGMDIDPYKEFGASVELLS-FLP
FJ562334_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS-FLP
FJ562319_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
FJ562308_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562299_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562295_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562290_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562281_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562268_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562265_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386685_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASXELLS-FLP
FJ386672_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGSSVELLS-FLP
FJ386641_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASXELLS-FLP
FJ386637_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386629_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386627_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386620_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
FJ386605_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386601_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386589_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
FJ386579_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
FJ386576_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ032347_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939647_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939618_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939610_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
EU939592_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
EU939591_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939590_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939578_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939564_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939561_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
EU939560_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU939540_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
EU916218_HBe_P-C      MQLFHLCLIISCSRPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
EU717212_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
EU589342_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU498227_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU439015_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
EU305542_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU305541_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EF494379_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASTELLS-FLP
DQ993692_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ993691_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ144604_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ144603_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ144553_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089766_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AY641561_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB971715_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB971714_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670256_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
AB670255_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB471851_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367424_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367423_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367422_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367418_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367416_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB367408_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
AB367407_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB195945_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB111122_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB111121_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB111116_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS-FLP
AB033553_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB014390_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB014378_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB014374_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB014372_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
AB670239_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670240_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670243_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB014367_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HM011502_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASXELLS-FLP
DQ089770_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089792_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY689525_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700517_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ040152_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MG893558_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MG826131_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
MF925406_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF925374_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF925369_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674468_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674430_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674411_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
MF674399_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674398_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881993_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881991_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881981_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881979_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881974_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881971_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881960_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881940_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY881887_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881884_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881879_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881875_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881874_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881873_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY881870_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY689518_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDHYKEFGASVELLS-FLP
KY470966_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470936_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470933_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY363281_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY363267_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY363257_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KX765852_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765842_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765828_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964332_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KU964213_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KU964212_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KU964211_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KU964210_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KU964209_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KU964207_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964206_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KU964205_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KU964204_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KU964203_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KU964202_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KU964201_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964200_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-FLP
KU964180_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963929_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963928_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963927_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963925_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963924_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963923_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963922_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963921_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963920_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963919_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963918_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963916_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU963915_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148489_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148487_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148465_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598725_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598681_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598661_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598660_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598658_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598657_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598656_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598655_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598654_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598653_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598652_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598651_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598650_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598649_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598648_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598647_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598646_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ598644_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
JX560520_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX026885_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700575_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLXDMDIDPYKEFGASVELLS-FLP
EU916229_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU916223_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
S75184_HBe_P-C        MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
MF674514_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS-FLP
KY470979_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470978_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470977_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470976_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470974_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470973_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470970_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470969_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470968_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KY470965_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765834_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX765822_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU964237_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU577049_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KP148462_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KJ803762_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JQ027318_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASXELLS-FLP
GQ377526_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ562243_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
FJ386679_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS-FLP
EU939569_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
EU919165_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
DQ089761_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
AB670311_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU679937_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLS-FLP
MF674486_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MG826129_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
MF674463_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS-FLP
KY629637_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS-FLP
KF873526_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700577_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS-FLP
HQ700559_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
HQ700506_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089799_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
DQ089757_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KF873536_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS-FLP
AB670260_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KU668280_HBe_P-C      MQPFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKELGASVELLS-FLP
KP148472_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWFWGMDIDPYKEFGASVELLSLFLP
KP148477_HBe_P-C      MQLFHLCLIISCSCPTVQASKLCLGWFWGMDIDPYKEFGASVELLSLFLP
JX036339_HBe_P-C      ---FHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX036335_HBe_P-C      ---FHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX036336_HBe_P-C      ---FHLCLIISCSCPTVQASKLRLGWLWGMDIDPYKEFGASVELLS-FLP
JX036337_HBe_P-C      ---FHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
JX036338_HBe_P-C      ---FHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX774504_HBe_P-C      ---FHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
KX774503_HBe_P-C      ---FHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS-FLP
                             ::  *      :    :      *                   

JQ801523_HBe_P-C      SDFFPSLLDPLYTASALYREALKSPEHCSPHHTALRQAILCWGELMNLAA
KC774240_HBe_P-C      SDFFPSIRDLLDTASALYREALKSPEHCSPHHTALRQAILCWGELMNLAT
EU939541_HBe_P-C      SDFFPSIRDLLDTASALYREALKSPEHCSPHHTALRQAILCWGELMNLAT
GQ377552_HBe_P-C      SDLFPFIRDILDRGDALYREALECPEHCSPPHTALRQAILCWGELMNLTP
MF488703_HBe_P-C      SDFFPSVRDLLGTAAPLYREALKSPELCRPLRTGLRQAILCWGELMNLAT
FJ562329_HBe_P-C      SDFFPSIQDLLDTAWPLYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939552_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674425_HBe_P-C      SDFFPSVHDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
MF674458_HBe_P-C      SDFFPSVHDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
DQ089785_HBe_P-C      SDFFPTIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSLAT
DQ089775_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAIVCWGELMNLAT
AY269140_HBe_P-C      SDFFPSIRDLLDTASALYRDALESAEHCTAHHTALRQAILCWGELMNLAT
EU717214_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU872005_HBe_P-C      SDFFPPVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598762_HBe_P-C      SDFFPSIRDLLDTASALCREALESPGHCSPHHTALRQAILCCGELMNLAT
DQ089787_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGEVMNLAT
KR013996_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTTLRQAILCWGELMNLAT
JX507211_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939658_HBe_P-C      SDFFPSVRDLLDTASALYREALETPEHCSPHHTALRQAIVCWGELMNLAT
KX276846_HBe_P-C      SDFFPSIRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMNLAT
KR013819_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGEWMNLAT
AY596108_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
KR013837_HBe_P-C      SDFFPSIRDILDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803770_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGEVMNLAT
KR013823_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013820_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ410491_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSAHHTALRQAILCWGELMNLAT
HM011497_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMNLAT
AB670275_HBe_P-C      SDFFPSIRDLVDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
AF241411_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
AY247031_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
FJ386618_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
FJ562232_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
FJ562238_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAAVCWGELMNLAT
KX276841_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQQILCWGELMNLAT
MF925394_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
MF674475_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
KX276840_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHVSSHHTALRQAILCWGELMNLAT
KR013857_HBe_P-C      SDFFPSIRDLLGTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013840_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ410514_HBe_P-C      SDFFPNVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLAT
KC774357_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
KC774331_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
KC774316_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
AF363961_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013826_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013825_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013824_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013822_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013821_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KM875430_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
KM875404_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN104437_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG571335_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM011486_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNLAT
KX276853_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013854_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674457_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674442_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013856_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013855_HBe_P-C      YDSFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013770_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSLAT
KJ410519_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173286_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173285_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KC774330_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774329_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774312_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ341544_HBe_P-C      SDFFPSIRDLLDTASALYREALXSPEHCSPHHTALRQAILCWGELMNLAT
JQ341518_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNLAT
JQ341541_HBe_P-C      SDFFPSIRDLLDTASALXREALESPEHCSPHHTALRQAILCWXELMNLAT
MG826132_HBe_P-C      SAIFPSILDLLDTASALYLEGLESPEHCSPLHIALRRAILRWGELMNLAT
KY881972_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVALMNLAT
FJ562248_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTAVRQAIVCWGELMNLAT
AB105173_HBe_P-C      SDFFPSIRDLLDTASALYREALETPEHSSPHHTALRQAILCWGELMNLAT
KJ410510_HBe_P-C      SDFFPSIRDLLDTANALHREALESPEHCSPHHTAFRQDILCWGELMNLAT
D00630_HBe_P-C        SDFFPSIRDLLDTAFALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
AY206378_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAVVCWGELVNLAT
KR014059_HBe_P-C      SDFFPSIRDLVDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
AB014364_HBe_P-C      SDFFPSVRDLLDTASALHREALESPGHCTPHHTALRQAILCWVELMNLAT
FJ848339_HBe_P-C      SDFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAFVCWGELMNLAT
KY881987_HBe_P-C      SDFFPSVRDLLDTASALYREAFESPEHCSPHHTALRQAILCWVELMNLAT
KY881872_HBe_P-C      SDFFPSVRDLLDTASALNREALESPEHCSPHHTALRQAILCWVELMNLAT
KY363275_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
KC774253_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELSNLAT
JQ040143_HBe_P-C      SDFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAFVCWGELMNLAT
KX276852_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSXHHTALRQAIVCWGELXNLAT
EU939643_HBe_P-C      SDFFPSIRDLLDTAFALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
AB014376_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
AB105174_HBe_P-C      SDFFPSIRDLVDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
AB113875_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
AB113876_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
AB300372_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
FJ386638_HBe_P-C      SDFFPSIRDXLDTASALHREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013943_HBe_P-C      SDFFPSIRDLLDTATALHREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598638_HBe_P-C      SDFFPSIRDLVDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
KJ598637_HBe_P-C      SDFFPSIRDLVDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
KF214672_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
GQ377543_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
FJ562332_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
FJ562318_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
FJ562272_HBe_P-C      SDFFPSIRDLLDTATALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
FJ386609_HBe_P-C      SDFFPSIRDLIDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
FJ386595_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023648_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
EU939641_HBe_P-C      SDFFPSXRDLLDTASALHREALESPEXCTPHHTALRQAILCWVELMNLAT
AB670297_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIXCWGELMNLAT
DQ089759_HBe_P-C      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQATLCWGELMNLAT
HQ700544_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
V00867_HBe_P-C        SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367395_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
EU872013_HBe_P-C      ADFFPSIRDLLDTASALYRETLESPEHCSPHHTALRQAIVCWGELMNLAT
EU916234_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
FJ386632_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
FJ386647_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
FJ562285_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
GQ475342_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
KR013862_HBe_P-C      SDFFPSIRDLVDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
JQ040162_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881871_HBe_P-C      SDFFPSVRDLLDTASALSREALDSPEHCSPHHTALRQAILCWVELMNLAT
JQ040167_HBe_P-C      LDFFPSIRDLLDTASALXREALESPEHCSPHHTALRQAIXCWGELMNLAT
JQ040172_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089791_HBe_P-C      SDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089776_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
GQ924655_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089790_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLAT
DQ089777_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
DQ089781_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB246346_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY167092_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089778_HBe_P-C      SDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLAT
FJ386644_HBe_P-C      FEFFLSIRDLLDTASALYREPLESPEHCSPHHTALRQAILCWGELMNLAT
AB112063_HBe_P-C      SDFFPNIRDLLDTASALFREALESPEHCTPHHTAIRQAILCWGELMNLAT
GQ924629_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715343_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLVT
AY641558_HBe_P-C      SDFFPSIQDRLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN400088_HBe_P-C      SDFFPSIQDRLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN400087_HBe_P-C      SDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN400089_HBe_P-C      SDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ922651_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSQHHATLRQAILCWGELMNLAT
AB112408_HBe_P-C      SDYFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB111946_HBe_P-C      SDFFPNIRDLLDTASALFREALESPEHCTPHHTAIRQAILCWGELMNLAT
AB042282_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMNLAT
JX661490_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ924636_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089786_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089780_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB205125_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF223955_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF223956_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF223959_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF473543_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY862869_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPRHTALRQAILCWGELMNLAT
DQ089779_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089782_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089783_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU562216_HBe_P-C      SDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801501_HBe_P-C      SDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX504539_HBe_P-C      SDFFPSIQDLRDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC875263_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774353_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLAT
KC774352_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774334_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801520_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN104434_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828910_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGGLMNLAT
JF828905_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ872210_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377609_HBe_P-C      SDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787454_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715424_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715422_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715389_HBe_P-C      SDFFPFIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715376_HBe_P-C      SDFFPSIRDLLDTTSALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715364_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715357_HBe_P-C      SGFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562282_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562273_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELTNLAT
FJ562264_HBe_P-C      SDFFPTIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386653_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ032356_HBe_P-C      SDFFPSIRDLLGTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939605_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU916212_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU916210_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU410079_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU306719_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU306687_HBe_P-C      SDFFPSIRDLLDTASALYREALEPPEHCSPHHTALRQAILCWGELMNLAT
DQ922649_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ536414_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ536413_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089801_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040127_HBe_P-C      XDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023624_HBe_P-C      SDFFPSFEDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
EU939554_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLAT
DQ478899_HBe_P-C      SDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMNLAT
DQ089773_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB042283_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148564_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803790_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598691_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774300_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774284_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040145_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ924609_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377631_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377605_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377559_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377521_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715372_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ032334_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939648_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
EU570074_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU570073_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EF688062_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ536411_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ246215_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089789_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089784_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670306_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ751770_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EF197911_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803766_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF485389_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF214673_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF214671_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC875272_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC875271_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC875270_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC875269_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
KC875268_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC875267_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC875262_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC875261_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774361_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMNLAT
KC774360_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774359_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774358_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774356_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774351_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774348_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774347_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774343_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774342_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774339_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774337_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774336_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774335_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774333_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774327_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774325_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774321_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMNLAT
KC774320_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774318_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774315_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774314_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774313_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774310_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774309_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774308_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774304_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774303_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774302_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774299_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774298_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774295_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774293_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774292_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774290_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774289_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774287_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774285_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774283_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774281_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774280_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774277_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774276_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774274_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774272_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774271_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774270_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774268_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774267_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774261_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774260_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774255_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774254_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774252_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774250_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774244_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774242_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774241_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774239_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774238_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774237_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774236_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774235_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774233_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774216_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774215_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774214_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774213_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774206_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774196_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774187_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774185_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774184_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774182_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774181_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774180_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX661488_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX560519_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX504546_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX504545_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX504544_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX504537_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX429917_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX429916_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX429915_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX429913_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX429912_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSLAT
JX429909_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX429907_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX429906_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX429905_HBe_P-C      SDFFPSIRDLLDTASALYREALASPEHCSPHHTALRQAILCWGELMNLAT
JX429904_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX429903_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801519_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801513_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801511_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801505_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801504_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801502_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
JQ801497_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801496_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801490_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801489_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGESMNLAT
JQ801488_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801487_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801486_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801482_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801475_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801473_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801470_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ688404_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ688403_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040163_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040133_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ027319_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
JN827425_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN827424_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN827423_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN827422_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN827421_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN827420_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN827418_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN827417_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN827416_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN827415_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN827414_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN104440_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN104435_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN104433_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF899336_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828920_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828919_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828918_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828917_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828916_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828915_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828913_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828912_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828911_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828908_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828907_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828906_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HQ700574_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700573_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700572_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700569_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700568_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700567_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700566_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700565_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700564_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700563_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700562_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700561_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700558_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700556_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700555_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700516_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700504_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700502_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700496_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700495_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700456_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HM750141_HBe_P-C      SDFFPSIRDLLDAASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750140_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750139_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750138_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750137_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750136_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750132_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750131_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM011489_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM011465_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GU721029_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GU563561_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GU434374_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ924649_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ924633_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ924614_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ924604_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ855548_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ855544_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ855534_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ855528_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ855525_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ855523_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475355_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475354_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475347_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475346_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475345_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475344_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475339_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475338_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475334_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475333_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475331_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475330_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475329_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475328_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475327_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475325_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475321_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475320_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475319_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475317_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475316_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475315_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475314_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475313_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475312_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475311_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475310_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475309_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475308_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475307_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475306_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475305_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377642_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377640_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377637_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377624_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377619_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377618_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377617_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377616_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377615_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377601_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377600_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377598_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377585_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377584_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377580_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377579_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377578_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377576_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377574_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377572_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377571_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377570_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377562_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377555_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377554_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377553_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377551_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377545_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
GQ377541_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377540_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377538_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377536_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377535_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377533_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377531_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377528_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377527_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377524_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377523_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377517_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377515_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377514_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ358158_HBe_C-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ358157_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
GQ358154_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ259588_HBe_P-C      SDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ227696_HBe_P-C      SDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLTT
GQ227695_HBe_P-C      SDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ227694_HBe_P-C      SDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ227693_HBe_P-C      SDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ899777_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ899775_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ899763_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787479_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787471_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787453_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787449_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787447_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787441_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787439_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRRAILCWGELMNLAT
FJ751765_HBe_P-C      SDFFSSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ751764_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715409_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715407_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715405_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715403_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715400_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715398_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715397_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715395_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715383_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715382_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715381_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715380_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715379_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715378_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715377_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715374_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715371_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715370_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715367_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715365_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715359_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715358_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715355_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715353_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715352_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715350_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRRAILCWGELMNLAT
FJ715342_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562325_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562323_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562320_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562307_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562298_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562297_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562288_HBe_P-C      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562283_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562279_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562274_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562269_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562258_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562252_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562245_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562244_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562218_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ518813_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386678_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386673_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386667_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386664_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386659_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386657_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386652_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386651_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
FJ386639_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386628_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
FJ386619_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386616_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWVELMNLAT
FJ386612_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
FJ386607_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386591_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386588_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386587_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386577_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386575_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ349225_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ032361_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ032355_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ032350_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ032346_HBe_P-C      TDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
FJ032341_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ032340_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ032339_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ032332_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ032331_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023658_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023657_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023656_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023654_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023653_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023650_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023649_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023647_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023646_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023644_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023643_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023642_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023641_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023625_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
FJ023591_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
FJ023590_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
FJ023589_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
FJ023587_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
FJ023571_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023568_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
FJ023567_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
FJ023566_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
EU939642_HBe_P-C      LDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939619_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939615_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939611_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939609_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939604_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939597_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
EU939593_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939584_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLAT
EU939574_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939572_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939557_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939549_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU919168_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
EU916238_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU916237_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU916225_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU916224_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU916217_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU916215_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU881996_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU872010_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871982_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU796072_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU796070_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU670263_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU589345_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU579442_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU570068_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU570067_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU562217_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU562215_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU560440_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU554539_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPRHTALRQAILCWGELMNLAT
EU554538_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU554537_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU554535_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU522069_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU522068_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU410081_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU410080_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU306729_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU306721_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU306720_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU306714_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU306713_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU306694_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU306691_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU306690_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU306689_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU306688_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU306685_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU306673_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU305540_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EF536066_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EF536065_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EF384201_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EF137802_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ993693_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ993690_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ922650_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ683578_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ478901_HBe_P-C      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMNLAT
DQ377165_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ377164_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ377163_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLAT
DQ377162_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ377161_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ377160_HBe_P-C      SDFFLSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ315783_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ315782_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ315781_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089793_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089769_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089765_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089764_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089763_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089758_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
D50519_HBe_P-C        SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
D28880_HBe_P-C        SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
D23680_HBe_P-C        SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
D12980_HBe_P-C        SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY641560_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY596107_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY269099_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
AY220700_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLAT
AY220699_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLAT
AY206389_HBe_P-C      PDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY206384_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY206382_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY167090_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY066028_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY057947_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AP011107_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AP011106_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AP011101_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AP011100_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AP011099_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AP011098_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AP011097_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AJ748098_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF458664_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF411411_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF411408_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF384366_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF384365_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF384364_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF286594_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF241410_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF223960_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089762_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386662_HBe_P-C      SDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELINLAT
AB697510_HBe_P-C      TDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
AB112066_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
EU439013_HBe_P-C      SDFFPSIRDLLETASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279250_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881802_HBe_P-C      SDFFPSIRDLLDTASALCREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013961_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013817_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148476_HBe_P-C      SDFFPSIRDLLDTASALYREAFESPEHCSPHHTALRQAILCWGELVNLAT
HQ700543_HBe_P-C      SDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMNLAT
AB675674_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB675675_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715341_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377529_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377591_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MK321266_HBe_P-C      TDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY363277_HBe_P-C      SDFFPSIRDLLDTASALSREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013801_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013796_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670310_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF411412_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPRHTALRQAILCWGELMNLAT
KR013800_HBe_P-C      SDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ410494_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSAHHTALRQAILCWGELMNLAT
KJ410492_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSAHHTALRQAILCWGELMNLAT
KJ410489_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSAHHTALRQAILCWGELMNLAT
JX507214_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTTLRQAILCWGELMNLAT
FJ715421_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
X04615_HBe_P-C        SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279252_HBe_P-C      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881988_HBe_P-C      SDFFPSVRDLLDTASALYREAFESPEHCSPHHTALRQAILCWVELMNLAT
KY881889_HBe_P-C      SDFFPSVRDLLDTASALYRVALESPEHCSPHHTALRQAILCWVELMNLAT
KY470991_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470990_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470983_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470937_HBe_P-C      SDFFPSIRDLLDTASALYQEALESPEHCSPHHTALRQAILCCGELMNLAT
KY470925_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470900_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470882_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470874_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELVNLAT
KX276851_HBe_P-C      SDFFPTIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
KU964198_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964078_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTTLRQAILCWGELMNLAT
KU964002_HBe_P-C      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KU963997_HBe_P-C      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KU963996_HBe_P-C      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KU963891_HBe_P-C      SDFFPSIRDLLDTTSALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU051423_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT307719_HBe_P-C      SDFFPSIRDLLDTASALYREGLESPEHCSPHPTALRQAILCWGELMNLAT
KR013975_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013846_HBe_P-C      PDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013818_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013808_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013780_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013773_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCRGELMNLAT
KR013772_HBe_P-C      SDFFPSIRDLLDTASALYREALESPGHCSPHHTALRQAILCWGELMNLAT
KR013762_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148572_HBe_P-C      SDFFPSIRDLLGTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148568_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148558_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148540_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALGQAILCWGELMNLAT
KP148532_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148526_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148464_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLAT
KP148315_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLAT
KM359441_HBe_P-C      SDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803815_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803774_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598699_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598642_HBe_P-C      SDFFPSIRDLLDTASALYREAFESPEHCSPHHTALRQAILCWGELMNLAT
KF873541_HBe_P-C      SDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLAT
MH220971_HBe_P-C      SDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG826123_HBe_P-C      SDFFPSIRDFLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674428_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
KY881812_HBe_P-C      SDFFPSIRDLLDTASALYREVLESPEHCSPHHTALRQAVLCWGELMNLAT
KY881807_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
KY881806_HBe_P-C      SDFFPSIRDLLDTASALSREALESPEHCSPHHTALRQAVLCWGELMNLAT
KY881777_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881776_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881775_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881774_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881773_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881772_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881771_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881770_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881769_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881768_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881767_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881766_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881765_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881764_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881763_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881762_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881758_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881755_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881754_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881751_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881750_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881749_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881748_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881744_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881743_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881742_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881739_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881738_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881737_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881736_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY363256_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
KU964046_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013984_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148547_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148474_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ410498_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173394_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173393_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173316_HBe_P-C      SDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG826126_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
MF674444_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881814_HBe_P-C      SDFFSSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470885_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013904_HBe_P-C      SDFLPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013771_HBe_P-C      SDFLPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
X75665_HBe_P-C        SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
MH891502_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MH887433_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MH094411_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG893560_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG893557_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG893556_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPRHTALRQAILCWGELMNLAT
MG893553_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG826135_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG826134_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG826133_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG826128_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG826127_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG725248_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF925410_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF925408_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF925377_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF925376_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
MF925375_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF925367_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF925365_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF925359_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674502_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674501_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674494_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674489_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674484_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674474_HBe_P-C      SDFFPSIRDLLDTASALYREALGSPEHCSPHHTALRQAILCWGELMNLAT
MF674472_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674467_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674454_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674435_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674429_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674418_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674412_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674408_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674403_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674402_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674388_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674386_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC373512_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC373511_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC318703_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC318702_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279276_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279275_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279274_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279262_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279261_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEQCSPHHTALRQAILCWGELMNLAT
LC279260_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279259_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279258_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279257_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279256_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279255_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279254_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279253_HBe_P-C      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
LC279251_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279249_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279248_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279247_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279246_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279245_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC090200_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881984_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881980_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881970_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881967_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881928_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881920_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881880_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881818_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881815_HBe_P-C      SDFFSSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881803_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY689471_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAXLXWXELMNLAT
KY670782_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY629631_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470988_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470987_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470986_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470985_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470984_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470982_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470981_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470980_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470934_HBe_P-C      SDFFPSIRDLLDTASALYWEALESPEHCSPHHTALRQAILCWGELMNLAT
KY470929_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470916_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAFLCWGELMNLAT
KY470905_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470904_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470903_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470902_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470901_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470899_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470897_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470896_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470895_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470894_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470892_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470891_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470890_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470889_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470888_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470886_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470884_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470883_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470881_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470880_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470879_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470878_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470876_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470875_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470873_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY363279_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY363278_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY363276_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY022423_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX774506_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765855_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765853_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765851_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
KX765850_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765849_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765848_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765847_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765846_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765845_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765844_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765843_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765840_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765839_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765838_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765837_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765836_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765833_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765832_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765831_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765830_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765829_HBe_P-C      SDFFPSIRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGELMNLAT
KX765827_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765826_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765825_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765824_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765823_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765821_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765820_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765819_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765818_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964348_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964347_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964346_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964345_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964344_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964342_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964341_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964340_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964339_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964338_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964337_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964336_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964334_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964329_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
KU964326_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
KU964324_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
KU964323_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
KU964321_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
KU964228_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964227_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964226_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KU964225_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964224_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964223_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KU964222_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964221_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964220_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964218_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964217_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964216_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964214_HBe_P-C      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964199_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964197_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964196_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964195_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964194_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964193_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964192_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964191_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964190_HBe_P-C      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KU964189_HBe_P-C      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KU964188_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964187_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964186_HBe_P-C      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KU964185_HBe_P-C      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KU964176_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964076_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964075_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964074_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964073_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964072_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964071_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964070_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964069_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964068_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964067_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964066_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964065_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964064_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964063_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964062_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964061_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964060_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964059_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964058_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964057_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964056_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964055_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964054_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964053_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964052_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964051_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964050_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964049_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964048_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964047_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964045_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964044_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964043_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964042_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964041_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964040_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964039_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964038_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964037_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964036_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964035_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964034_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964033_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964032_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964031_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964030_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964029_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964028_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964027_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964026_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964025_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964024_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964022_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964021_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964020_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963992_HBe_P-C      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KU963914_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963913_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963912_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963911_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963910_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963909_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963908_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963907_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963906_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963905_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963904_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963903_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963902_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963901_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963900_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963899_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963898_HBe_P-C      SDFFPSIRDLLDIASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963897_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963896_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963895_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963894_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963893_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963892_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963890_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963889_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963888_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963887_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963886_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU679936_HBe_P-C      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU051427_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU051426_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU051425_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU051424_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT987426_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT987425_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT987424_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT987423_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT366463_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT364752_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT364751_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT364721_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT364720_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT364719_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT364718_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT307718_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT284758_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT284756_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT284755_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT284754_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT284753_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR014098_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013969_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013942_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
KR013909_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013908_HBe_P-C      SDFFPSIRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013877_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013875_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013873_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013871_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013858_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013851_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013850_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013834_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013833_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013832_HBe_P-C      PDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013830_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013829_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013828_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013815_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013813_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013812_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013811_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013810_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013809_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013799_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013798_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013797_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013794_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013793_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013792_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMDLAT
KR013791_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013790_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013789_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013788_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013787_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013786_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013785_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013784_HBe_P-C      SDFFPSIRDLPDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013783_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013782_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013781_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013779_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013776_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013774_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP784761_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148574_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148573_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148571_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148562_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148561_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148560_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148555_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148551_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148549_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148546_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148545_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148538_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148535_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148531_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148529_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148524_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148521_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148520_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148517_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148512_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148493_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148492_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148488_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148482_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148481_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148480_HBe_P-C      SDYFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148475_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148473_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148471_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148470_HBe_P-C      SDFFPSIRDLLDTASALYREALGSPEHCSPHHTALRQAILCWGELMDLAT
KP148469_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148468_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148466_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148463_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP027477_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KM229703_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KM213037_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803818_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803811_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803799_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803793_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803792_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803759_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ790199_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598772_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KJ598753_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598752_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598749_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598740_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598719_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598718_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598717_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598716_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598715_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598714_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598713_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598712_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598711_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598710_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598709_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598708_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598707_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598706_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598705_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598701_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598698_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598697_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598696_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598695_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598694_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598690_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598689_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598688_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598686_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598679_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598659_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598641_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598640_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598639_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598636_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598635_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ410513_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ410501_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ410496_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ410495_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173446_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173445_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173444_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173443_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173442_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173441_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173440_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173439_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173438_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173437_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173436_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173435_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173434_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173433_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173430_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173429_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173428_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173427_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173426_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173396_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173395_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173392_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173391_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173336_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173335_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173333_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173332_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173331_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173328_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173327_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173324_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173321_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173317_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173315_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173314_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173313_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173312_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173311_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173310_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173309_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173308_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173307_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173306_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173305_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173304_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173303_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173302_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KJ173301_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173296_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173295_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173294_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173293_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173292_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173291_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173289_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173288_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173287_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173284_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173283_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173282_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173281_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF495606_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964023_HBe_P-C      SDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF485390_HBe_P-C      SDFFPXIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148563_HBe_P-C      SDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774179_HBe_P-C      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KC774297_HBe_P-C      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
MF925403_HBe_P-C      SDFFPSVRDLLDTASALYREALESPDHCTPHHTALRQIVLCWGELMNLAT
KJ803757_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMNLAT
KF214670_HBe_P-C      SDFFPNVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
DQ975272_HBe_P-C      SDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB014373_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIICWGELMNLAT
KF214677_HBe_P-C      SDFFPSIRDLLDTAASLYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377623_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHVSHHHTALRQAILCWGELMNLAT
DQ089788_HBe_P-C      SDFFPSIRDLLETASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB900115_HBe_P-C      SDFFPNIRDLLDTASALYREALESSEHCSAHHTALRQAILCWGELMNLAT
AB182589_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHGSPHHTALRQAILCWVELMNLAT
KJ410505_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHVSPHHTALRQAILCWGELMNLAT
KJ410508_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHVSPHHTALRQAILCWGELMNLAT
JQ707768_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707769_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707770_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707771_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707772_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707773_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707774_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB195942_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB195943_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB195944_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367401_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787456_HBe_P-C      SDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
AB111118_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWAELMNLAT
AF223961_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
EU939573_HBe_P-C      SDFFPSVRELLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY470913_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGVLMNLAT
KY470908_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040164_HBe_P-C      SDFFPAIRDLXDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
HM750135_HBe_P-C      SDFFPSIRDLLDTASALYREALKSPEHCSPHHTALRQAILCWGELMNLAT
HM042269_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLVT
HM011491_HBe_P-C      SDFFPSIRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGELMNLAT
GQ924658_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023677_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLAS
AY306136_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLAT
AY167091_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670268_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB074755_HBe_P-C      SDFFPSIRDLLDTASALYREALESSEHCSPHHTALRQAILCWGEMMNLAT
GQ924620_HBe_C-C      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQATLCWVELMNLAT
HQ700522_HBe_P-C      SDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMNLAT
FJ715404_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715406_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY167099_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU562218_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF461357_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF461363_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF384367_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ536410_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367412_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB471849_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670290_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB300361_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB195952_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB195953_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB195954_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB112472_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB112471_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB112348_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB112065_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
AB111125_HBe_P-C      SDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB111124_HBe_P-C      SDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB246344_HBe_P-C      SDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB111117_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB111123_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367435_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
AB014363_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
KM875412_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQVILCWGELMNLAT
JQ429078_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQVILCWGELMNLAT
FJ386640_HBe_P-C      TDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
FJ386617_HBe_P-C      FDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
EU939586_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAFLCWGELMNLAT
EU554541_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEYCSPHHTALRQAILCWGELMNLAT
AY206386_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670285_HBe_P-C      SDFFPSIRDLLDTASALYXEALESPEHCSPHHTALRQAILCWGELMNLAT
AB205124_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB042285_HBe_P-C      TDFFPAVRDLLDTASALYLEALESPEHCSPHHTALRQAILCWDELMKLAT
KC774306_HBe_P-C      SDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB014369_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
FJ562333_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803823_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377563_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386626_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU796069_HBe_P-C      SDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774311_HBe_P-C      SDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ980551_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
DQ975273_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ980550_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ361526_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMNLAT
FJ715366_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
D50517_HBe_P-C        SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
D50518_HBe_P-C        SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF458665_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670309_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670241_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
AB014387_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB014368_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB014394_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLAT
AB014395_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLAT
AB026811_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB026812_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB026813_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB026814_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB026815_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB031262_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB033550_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB033551_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB033552_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB033556_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB050018_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB074756_HBe_P-C      SDFFPSIRDLLDTASALYREALESSEHCSPHHTALRQAILCWGELMNLAT
AB111119_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB111120_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB113879_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB117758_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB014360_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB014362_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB014391_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715402_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU306727_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLAT
AB670300_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670265_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873544_HBe_P-C      SDFFPSIRDLLDTASALYQEALESQEHCSPHHTALRQAILCWGELMNLAT
JQ027320_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562293_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
FJ386631_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ032345_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939640_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939600_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939582_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU554542_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089796_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF223958_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF223957_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF223954_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF068756_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB697500_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB697494_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB697490_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB675677_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670307_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670305_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670304_HBe_P-C      SDFFPSIRDLLDTAAALYREALESPEHCTPHHTALRQAILCWGELMNLAT
AB670294_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670292_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670287_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670283_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670282_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670281_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670267_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670261_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWVELMNLAT
AB670254_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELMNLAT
AB670252_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELMNLAT
AB670247_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670238_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB642100_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB640730_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB485808_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB471853_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB471852_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB471850_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB471848_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB426467_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367417_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367413_HBe_P-C      SDFFPSIRELIDTASALYREALESPEHCSPHHTALRQALLCWGELMNLAT
AB367411_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367409_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367403_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367402_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367399_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367398_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAFLCWGELMNLAT
AB367397_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367396_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367394_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB362932_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB300365_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB300363_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB300362_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB300359_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB299858_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB288026_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALREAILCWGELMNLAT
AB250109_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB247916_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB246345_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB241111_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB241110_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB222715_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB222714_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB205123_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB198083_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB198082_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB198081_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB198080_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB198079_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB198078_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB198077_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB198076_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB176643_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLAT
AB195949_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ410518_HBe_P-C      SDFFPSIRDLLDTASALYREALESPDHCSAHHTALRQAILCWGELMNLAT
KJ410511_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMNLAT
JQ341517_HBe_P-C      SDFFPNVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ027324_HBe_P-C      SDFFPSIRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMNLAT
FJ562327_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386650_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELLNLAT
EU939626_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939599_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVEVTNLAT
EU939536_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089756_HBe_P-C      NDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQGILCWGELMNLAT
AB670246_HBe_P-C      PDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAIVCWGELMNLAT
AB367434_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB202072_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ478900_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB202071_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIMCWGELMNLAT
AB014361_HBe_P-C      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881994_HBe_P-C      SDFFPSVRDLLDTASALYREAFESPEHCSPHHTALRQAILCWVELMNLAT
KY881961_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCLPHHTALRQAILCWVELMNLAT
KY881819_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
KX276844_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCXPHHTALRQAILCWGELMNLAT
KJ803777_HBe_P-C      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTAIRQAVLCWGELMNLAT
JX870000_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSLHHTALRQAILCWGELMNLAT
JX661497_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAFLCWGELMNLAT
JX026877_HBe_P-C      SDFFPSVRDLLDTASALYREALESPGHCSPHHTALRQAILCWGELMNLAT
JQ801472_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040165_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715344_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386594_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLAT
EU939603_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939562_HBe_P-C      SDFFPSIRDLLDTASALYREALKSPEHCSPHHTALRQAILCWGELMNLAT
EU939544_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU916233_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
EU570072_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EF494377_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTAFRQAILCWGELMNLAT
AF411410_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670278_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367392_HBe_P-C      PDFFPSVRDLIDTASALYREALESPEHHSPHHTALRQGILCWGELMNLAT
AB014379_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB014380_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB300368_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX661489_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX661492_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX661496_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386598_HBe_P-C      SDFFPSIRDLLDTASALXREALESPEHCSPHHTALRQAIVCWGELMNLAT
KJ803780_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
KY881977_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTTLRQAILCWGELMNLAT
KY881963_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881810_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHYTALRQAVLCWGELMNLAT
KY470910_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALGQAILCWGELMNLAT
KR013861_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRRAILCWGELMNLAT
KP148566_HBe_P-C      SDFFPSIRDLLDTASALYRGALESPEHCSPHHTALRQAILCWGELMNLAT
KP148557_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148548_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148525_HBe_P-C      SDYFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILRWGELMNLAT
KF214675_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774319_HBe_P-C      PDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
KC774288_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX661495_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX661491_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX507212_HBe_P-C      SDFFPSIRDLLDTAAALYREALESPEQCSPHHTALRQAILCWGELMNLAT
JQ801517_HBe_P-C      DDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLAT
JQ801500_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040149_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ027333_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLAT
JF828937_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ924642_HBe_P-C      NDFFPSMRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787465_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787457_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787455_HBe_P-C      SDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715391_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715390_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715351_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715368_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715418_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562324_HBe_P-C      SDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ518810_HBe_P-C      SDFFPSIQDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
FJ386603_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
FJ023655_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
EU939652_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
EU939625_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU916227_HBe_P-C      SDFFPSIRDLLDTASAPYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU589341_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU560438_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089768_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMNLAT
AY247032_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB074047_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG571345_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF925395_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVVCWAELMNLAT
MF674471_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
MF488701_HBe_P-C      KDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVEVTNLAT
KY882003_HBe_P-C      SDFFPSVRDLLDTASALYREAFESPEHCSPHHTALRQAILCWVELMNLAT
KY882002_HBe_P-C      SDFFPSVRDLLDTASALYRVALESPEHCSPHHTALRQAILCWVELMNLAT
KY881997_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881989_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHSSPHHTALRQTILCWVELMNLAT
KY881917_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881891_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881890_HBe_P-C      SDFFPSVRDLLDTASALYREAFESPEHCSPHHTALRQAILCWVELMNLAT
KY881888_HBe_P-C      SDFFPSVRDLLDTASALYRVALESPEHCSPHHTALRQAILCWVELMNLAT
KY881885_HBe_P-C      SDFFPSVRDLLDTASALYREAFESPEHCSPHHTALRQAILCWVELMNLAT
KY881881_HBe_P-C      SDFFPSVRDLLDTASALYRVALESPEHCSPHHTALRQAILCWVELMNLAT
KY881878_HBe_P-C      SDFFPSVRDLLDTASALYREAFESPEHCSPHHTALRQAILRWVELMNLAT
KY470911_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY363266_HBe_P-C      SDFFPSVRDLLDTASALYRKALESPEHCSPHHTALRQAILCWVELMNLAT
KU964208_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963926_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963917_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013974_HBe_P-C      SDFFPSIRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148559_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803814_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803779_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873539_HBe_P-C      SDFFPSIRDLLDTAXALYRDALESPEHCSPHHTALRQAILCWGELMNLAT
JX661493_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX026888_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801495_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ855541_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377518_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
FJ787469_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715375_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ032351_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023652_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871976_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLAT
AY206385_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLAT
AB670277_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670269_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670249_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367414_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB014365_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ151413_HBe_P-C      SDLFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ027323_HBe_P-C      SDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNLAT
KF214676_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF925378_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674390_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881978_HBe_P-C      SDFFPSVRGLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881973_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881892_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881886_HBe_P-C      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881883_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881882_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881877_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881876_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWVELMNLAT
KY470975_HBe_P-C      ADFFPSIRDLLDTASALYRGALESPEHCSPHHTALRQAILCWGELMNLAT
KY470967_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470920_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470917_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470907_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964343_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLAT
KU964077_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR014060_HBe_P-C      SDFFPSIRDLLDTASALYREALESPERCSPHHTALRQAILCWGELMNLAT
KR014055_HBe_P-C      SDFFPSIRDLLDTASALYREALESPERCSPHHTALRQAILCWGELMNLAT
KR013860_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013859_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013853_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013831_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013814_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013803_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803776_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLAT
KJ803761_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELLNLAT
KJ803754_HBe_P-C      QDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF214651_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774286_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801522_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040168_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040156_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040151_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ855543_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377620_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787461_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLAT
FJ715392_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEYCSPHHTALRQAILCWGELMNLAT
FJ562304_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLAT
FJ562266_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
FJ023640_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939571_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
EU939550_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871998_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLAT
EU871980_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLAT
EU439005_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
EU306722_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089795_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRRAILCWGELMNLAT
DQ089772_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSYHHTALRQAILCWGELMNLAT
DQ089767_HBe_P-C      SDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089760_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670291_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670289_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670266_HBe_P-C      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM011488_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367410_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB642099_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670253_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF533983_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
AB111112_HBe_P-C      SDFFPSXRDLLDTASALYREALESPEHXSPHHTALRQAILCWGELMNLAT
AB014377_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG826122_HBe_P-C      SDFFPSIRDLLDTAQALYREALESPEHCSYHHTALRQAILCWGELMNLAT
MF925409_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF925405_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
MF925398_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF925387_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674504_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674417_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY882001_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY882000_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881999_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881998_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881995_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881992_HBe_P-C      SDFFPSIRDLLDTASALYREALESSEHCSPYHTALRQAILCWGELMNLAT
KY881986_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881985_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881983_HBe_P-C      SDFFPSIRDLLDTASALYREALESPERCSPHHTALRQAILCWGELMNLAT
KY881982_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881975_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881969_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881968_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPPHTALRQAILCWGELMNLAT
KY881965_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881959_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881937_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881936_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881935_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881934_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881933_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881932_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881931_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881930_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881929_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881927_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881926_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881925_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881924_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881923_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881922_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881921_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881919_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881918_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881916_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881915_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY689435_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470972_HBe_P-C      ADFSPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470971_HBe_P-C      ADFSPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470918_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470915_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470914_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470912_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470909_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470906_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470887_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY363284_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY363274_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT284759_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013935_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
KR013852_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013802_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPRHTALRQAILCWGELMNLAT
KP148570_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148554_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148534_HBe_P-C      PDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148528_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148523_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148513_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KM875425_HBe_P-C      SDFFPSIRALLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
KM875424_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
KJ803826_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803813_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598645_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173432_HBe_P-C      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173431_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173337_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF214678_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC875265_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC875264_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774355_HBe_P-C      SDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774354_HBe_P-C      SDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774345_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774340_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774338_HBe_P-C      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774326_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774301_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774296_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774282_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774279_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774278_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774269_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774251_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX504542_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX504541_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX504536_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX429918_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801509_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801483_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801481_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707733_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707732_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707731_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707730_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707729_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707728_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707727_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707726_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707725_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707724_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707723_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707722_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707721_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707720_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707719_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707718_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707717_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707716_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707715_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707713_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707712_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707711_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707710_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707709_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707708_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707707_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040154_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040132_HBe_P-C      SDFFPSVRDLIDTASALYXEALESPEHCSPHHTALRQAILCWVELMNLAT
JQ027322_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
JQ027321_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ027317_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN315779_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELLNLAT
JF828931_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828930_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828929_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828928_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828926_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828925_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828924_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828923_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828922_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828921_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF436920_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HQ700571_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700570_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700476_HBe_P-C      SDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ638218_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750134_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ924616_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ924613_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ924612_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ872211_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475332_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475326_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475322_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ475318_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
GQ377636_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377632_HBe_P-C      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377628_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377597_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377593_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377583_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377577_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ904423_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ899789_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ899788_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787481_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787468_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787467_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787466_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787464_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787463_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787462_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787458_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787443_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787442_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562334_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562319_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562308_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562299_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562295_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562290_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562281_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562268_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562265_HBe_P-C      SDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLAT
FJ386685_HBe_P-C      SDFFPSIRDLXDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386672_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386641_HBe_P-C      SDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386637_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386629_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386627_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386620_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386605_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386601_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386589_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
FJ386579_HBe_P-C      LDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386576_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ032347_HBe_P-C      TDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939647_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
EU939618_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939610_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939592_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939591_HBe_P-C      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939590_HBe_P-C      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939578_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939564_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939561_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939560_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939540_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU916218_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU717212_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU589342_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU498227_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU439015_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU305542_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU305541_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EF494379_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
DQ993692_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
DQ993691_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ144604_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ144603_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ144553_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089766_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY641561_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB971715_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB971714_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670256_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670255_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAVLCWGELMSLAT
AB471851_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367424_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367423_HBe_P-C      TDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367422_HBe_P-C      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367418_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
AB367416_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367408_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
AB367407_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB195945_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
AB111122_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGEMMNLAT
AB111121_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB111116_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB033553_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB014390_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB014378_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
AB014374_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB014372_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670239_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQXILCWGELMNLAT
AB670240_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQXILCWGELMNLAT
AB670243_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQXILCWGELMNLAT
AB014367_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM011502_HBe_P-C      SDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLAT
DQ089770_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089792_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLAT
KY689525_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HQ700517_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040152_HBe_P-C      SDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWXELMNLAT
MG893558_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG826131_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF925406_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF925374_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF925369_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
MF674468_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674430_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
MF674411_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674399_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674398_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881993_HBe_P-C      SDFFPSVRDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881991_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881981_HBe_P-C      SDFFPSVRDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881979_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881974_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881971_HBe_P-C      SDFFPSVRDLIDTASALYREALESPEHCSPHHTALRQAILCWVELMDLAT
KY881960_HBe_P-C      SDFFPSVRDLLDTASALYRETLESPEHCSPHHSALRQAILCWVELMNLAT
KY881940_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881887_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881884_HBe_P-C      SDFFPSVRDLLDTASALYRETLESPEHCSPHHSALRQAILCWVELMNLAT
KY881879_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881875_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881874_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSSHHAALRQAILCWVELMNLAT
KY881873_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY881870_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY689518_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY470966_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470936_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470933_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY363281_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY363267_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KY363257_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
KX765852_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765842_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMNLAT
KX765828_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964332_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
KU964213_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964212_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964211_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964210_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964209_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964207_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964206_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964205_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964204_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964203_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964202_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964201_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964200_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964180_HBe_P-C      SDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMKLAT
KU963929_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963928_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963927_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963925_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963924_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963923_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963922_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963921_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963920_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963919_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963918_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963916_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963915_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148489_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148487_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148465_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598725_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598681_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598661_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598660_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598658_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598657_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598656_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598655_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598654_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598653_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598652_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598651_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598650_HBe_P-C      LDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598649_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598648_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598647_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598646_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ598644_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX560520_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX026885_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HQ700575_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
EU916229_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU916223_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
S75184_HBe_P-C        SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF674514_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLAT
KY470979_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470978_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470977_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470976_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470974_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470973_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470970_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470969_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470968_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470965_HBe_P-C      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765834_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX765822_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLAT
KU964237_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU577049_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148462_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSLAT
KJ803762_HBe_P-C      SDFFPSIRDLLDTAAALYREALESPEHCTPHHTALRQAILCWGELMNLAT
JQ027318_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377526_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562243_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
FJ386679_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939569_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU919165_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
DQ089761_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
AB670311_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU679937_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCXXXHTALRQAILCWGELMNLAT
MF674486_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG826129_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
MF674463_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY629637_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873526_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HQ700577_HBe_P-C      SDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700559_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700506_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
DQ089799_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ089757_HBe_P-C      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873536_HBe_P-C      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB670260_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
KU668280_HBe_P-C      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148472_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148477_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX036339_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX036335_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX036336_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX036337_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX036338_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX774504_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX774503_HBe_P-C      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
                                     .     :            .            *..

JQ801523_HBe_P-C      WVGSNLEDPASRELLVSYVNVNTGLKIRQLLWFHITCLTLGRETVLEELV
KC774240_HBe_P-C      WVGSNLEDPASRELIFSYVNVNMGLKIKQLLGFHISCLTFGKKTVLEYLG
EU939541_HBe_P-C      WVGSNLENPASRELVVSYVNVNMGLKIKQLLWFHISCLTFGKKTVLEYLV
GQ377552_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MF488703_HBe_P-C      WVGSNLEDQASRDLVVSYVNVNMGLKLRQLLWFHVSCLTFGRDTVLEYLV
FJ562329_HBe_P-C      WVGSNLEDPASRELGVGYVNGNMGLKFRQIWWFHISCLTFGRETVLEYLV
EU939552_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIKQLLWFHISCLTFGKETVLEYLV
MF674425_HBe_P-C      WVGSNLEDPASRELVVSHVNVNMGLKIRQLLWFHISCLTFGKETVLEYLV
MF674458_HBe_P-C      WVGSNLEDPASRELVVSHVNVNMGLKIRQLLWFHISCLTFGKETVLEYLV
DQ089785_HBe_P-C      WVGGNLDDPASRDAVVSYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLV
DQ089775_HBe_P-C      WVGSNLDDPASREVVVNYVNVNMGLKIRQILWFHISCLTFGRQTVLEYLV
AY269140_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRQTVLEYLV
EU717214_HBe_P-C      WVGSNLEDQASRELVVSYVNVNMGLNFRQLLWFHISCLTFGRETVVEYLV
EU872005_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLNFRQLLWFHISCLTFGRETVVEYLV
KJ598762_HBe_P-C      WVGNNLEDQASRELVVSYVNANMGLKIRQLLWFHISCLTFGRETVLEYLV
DQ089787_HBe_P-C      WVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KR013996_HBe_P-C      WVGGNLEDPASRELVVSYVYVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JX507211_HBe_P-C      WVGGNLEDPASREAVVNYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLV
EU939658_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KX276846_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
KR013819_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY596108_HBe_P-C      WVGSNLEDPASRESVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KR013837_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ803770_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGREVVLEYLV
KR013823_HBe_P-C      WVGGNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KR013820_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
KJ410491_HBe_P-C      WVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HM011497_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB670275_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AF241411_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY247031_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ386618_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ562232_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLV
FJ562238_HBe_P-C      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KX276841_HBe_P-C      WVGGNLEDPASRDAVVSYVNVNMGLKLRQLLWFHISCLTFGREVVLEYLV
MF925394_HBe_P-C      WVGSNLEDPASRELVVSYVNGNMGLKIRQLLWFHISCLTFGRETVLEYLV
MF674475_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KX276840_HBe_P-C      WVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KR013857_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KR013840_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKTRQLLWFHISCLTFGRETVLEYLV
KJ410514_HBe_P-C      WVGSNLEDPASREAVVRYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774357_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774331_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774316_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AF363961_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KR013826_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
KR013825_HBe_P-C      WVGGNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KR013824_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
KR013822_HBe_P-C      WVGGNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KR013821_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
KM875430_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KM875404_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
JN104437_HBe_P-C      WVGSNLEDPASRELVVSYANVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MG571335_HBe_P-C      WVGSNLEDPASREXVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
HM011486_HBe_P-C      WVGSNLEDPASREXVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KX276853_HBe_P-C      WVGXNLBDQASRELVVXYVNVNMGLKIRQLLWFHISCLTFGRXTVLEYLV
KR013854_HBe_P-C      WVGSNLEGPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MF674457_HBe_P-C      WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
MF674442_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KR013856_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KR013855_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KR013770_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ410519_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ173286_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ173285_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774330_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774329_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774312_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ341544_HBe_P-C      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ341518_HBe_P-C      WVGXNLEDXXSRXLVVSY<