HBVdb

Dataset for protein HBx of genotype C

[Download (right click)] [Edit] [Sequences] [Repertoires]

3265 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KC774351_HBx_P-C      MAGPMGSRPEPPRGRPCIRRIGGETRGGPVSGPSGPFPSRCPCGAPGAPG
GQ184326_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHG
KC774357_HBx_P-C      MAVRGCCQLDPARDVLGLRPVGVESRGRPVSGPFGHLPSLSSSAVPADHG
KC774196_HBx_P-C      MEYRVCCQLDPAGDVLCLRPVAVESRGRPVSGPVGALRSPLLFAVPTDHG
KC774336_HBx_P-C      MEYRVCCQLDPAGDVLCLRPVAVESRGRPVSGPVGALRSPLLFAVPTDHG
KC163999_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC774244_HBx_P-C      MVARVCCQVDHARDVLSLRPVGAESRGRPISGPFGTLRSHCSFAVPADHG
KC774264_HBx_P-C      MDARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGALRSPSSFAVPADHG
HQ700574_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPPSSAVPANHG
KR013923_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013942_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPANHG
EU939546_HBx_P-C      MAGRVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSFFAVPANLG
AB900115_HBx_P-C      MAARLCCQLDPARDVLCLRPVGDESRGRPVAGPFGPLSSPSSAAVPADHG
KY470977_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSTAVPTDHG
KY470968_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470967_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPPPSSAAVPTDHG
KY470965_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470969_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470970_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470971_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470972_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470973_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470974_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470975_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470976_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470978_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470979_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
KY470966_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
AB367428_HBx_P-C      MAARVCCQLDPARDVLCLRPIGVESRGRPVSGPFGTLPSPSSPAVPADHG
KC774271_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSAAVPTDHG
EU939542_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ899767_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HM750131_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRRRPISGPFGSLPSPPSSALPADHG
KC814879_HBx_P-C      MAARVCCQLDPARDILCLRPVCAESRGRPVSGPFGTLPSPTSSAVPADHG
KU964189_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964190_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964191_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964192_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964199_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KC774217_HBx_P-C      MAARVCCQLDPARDILCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADNG
KC163906_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPASSAVPADHG
FJ386624_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPASSAVPADHG
GQ372968_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPASSAVPADHG
DQ089797_HBx_P-C      MAGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
AF355779_HBx_P-C      MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHG
KM229703_HBx_P-C      MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHG
AB198076_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVAGPFGPLSSPSSSAVPADHG
FJ386678_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRSVSGPFGALSSPSSSAVPANHG
FJ787449_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPSGTLPSPSSSAVPADHG
GQ377533_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGALPSPSPSAVPADHG
GQ377538_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPANHG
KC774242_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRSFSGPFGALSSPSSSAVPADHG
KJ803809_HBx_P-C      MAARVYCQLDPARDVLCLRPVGAESRGRSVSRPLGSLSSPSASAVPADHG
FJ787441_HBx_P-C      MAARMCCQLDPARDALCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY057947_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774199_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPTPSAVPTNHG
KC814898_HBx_P-C      KAARVCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPTSSAVPADHG
KC814904_HBx_P-C      KAARVCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPTSSAVPADHG
AB300362_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESSGRPVSGPLGPLPSPTSSAVPADHG
MG893560_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSAAVPADHG
KY881915_HBx_P-C      MAARMCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881937_HBx_P-C      MAARMCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KU963992_HBx_P-C      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963996_HBx_P-C      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963997_HBx_P-C      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU964002_HBx_P-C      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KR014013_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPATHG
KR013852_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013853_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013874_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013815_HBx_P-C      MAARVCCQLDPARNVLCLRPVDTESRGRPVSGPFETLPSPSSSAVPADHG
KJ598741_HBx_P-C      MAARMCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598744_HBx_P-C      MAARMCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598745_HBx_P-C      MAARMCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ173395_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KJ173396_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KJ173317_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLSSPSASAVPADHG
KC774348_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRRRPVSGPFGSLPSPSSSAVPATHG
KJ173446_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADHG
KC774309_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KC774270_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KC774261_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGALPSPSLSAVPADHG
KC774262_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGALPSPSSSAVPADHG
JX661493_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHG
KC774318_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX429916_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
KC774192_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
JX026878_HBx_P-C      MAARMCCQLDPARDVLCIRPVGAESRGRPVSGPFGGIPSPASSAVPADHG
JN418554_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPLSGPFGPLPSPSSSAVPAVHG
HQ700517_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTVPSPSSSAVPTDHG
GQ377529_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGAIPSPSPSAVPADHG
GQ377527_HBx_P-C      MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPSGSLPSPSSSAVPADHG
KJ173287_HBx_P-C      MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ358158_HBx_C-C      MAARVCCQLDPARDVLCLRPIGAESRGRPVSRSLGTLPSPSSSAVPADHG
FJ562255_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
FJ386662_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSPAVPADHG
FJ386597_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ032360_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
EU939597_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPADHG
EU939578_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTVHG
EU916226_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGPLSSPSSSAVPADHG
EU916210_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADHG
KR013915_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGQPVSGSLGTLPSPSSSAVPADHG
KR013919_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLPSPSSSAVPANHG
EU589340_HBx_P-C      MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
EU589341_HBx_P-C      MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
EU589342_HBx_P-C      MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
FJ562276_HBx_P-C      MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
FJ787481_HBx_P-C      MAARMCCQLDTARDVLCLRPVSAESRGRSLSGPFGTLPSPSSSAVPADHG
EF494377_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
AF326587_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AF326585_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AF326586_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
GQ377528_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
GQ475311_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPTDHG
JX429905_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSTVPTDHG
JX429917_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JX504544_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KC774202_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGTLPSPSPSAVPTDHG
KC774274_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPTDHG
KC774303_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPTDHG
KJ803800_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
AF286594_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AF182803_HBx_P-C      MAARMWCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
EU871969_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
AF182802_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
AB670305_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPXSGPFGPLPSPSSSAVPADHG
AB670269_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670261_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB670249_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB642099_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KJ598747_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB485808_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSDSAVPTDHG
AB367410_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB362932_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774315_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB205123_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGAIPSPSSSAVPADHG
AB113879_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSAAAVPADHG
AB106895_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB050018_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
KC774310_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSDSAVPADHG
KJ173291_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KJ173303_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KR013812_HBx_P-C      MAARVCCQLDPARNVLCLRPVDTESRGRPVSGPFGTLPSPSSSAVPADHG
EU562215_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSAVPADHG
EU562216_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSAVPADHG
EU562217_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVPEPFGPLSSPSSSAVPADHG
GQ475338_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSTVPADHG
AF324347_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU439010_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367412_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
JN418555_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB014386_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB014397_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB026811_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB026812_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB026813_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB026814_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB026815_HBx_P-C      MAARVCCKLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB033550_HBx_P-C      MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
AB198078_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB198079_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB198081_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
AB198082_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSSSAVPADHG
AB205124_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB222714_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB299858_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB300359_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367404_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB426467_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB471851_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB471852_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB471853_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB640730_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSTSAVPADHG
AB642100_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB670237_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670247_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670267_HBx_P-C      MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
AB222715_HBx_P-C      HAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
KC774214_HBx_P-C      MDARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774334_HBx_P-C      MDARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU871971_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPANHG
EU871972_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
JN418558_HBx_P-C      MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB033551_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPAAHG
AB033553_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB033556_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367396_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSSSAVPADHG
FJ386576_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
JN418535_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AY251137_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
GQ377543_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774312_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KT364752_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KJ598778_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
FJ787485_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
FJ562273_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPANHG
FJ023648_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSASAVPTDHG
EU939617_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU939560_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF325701_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670278_HBx_P-C      MAARMCCQLDPARDVLCLRPVGDESRGRPVSGPFGPLPSPSSSAVPADHG
AB033552_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
AB365451_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB367427_HBx_P-C      MAARMCCQLDPARDVVCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU717218_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
FJ562331_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSLSAVPADHG
AB014364_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB014377_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSSAVPADHG
AB014378_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSDSAVPADHG
AB014394_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB111114_HBx_P-C      MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB367401_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB367430_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPANHG
AB367435_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB642095_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB642097_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB670238_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSTSAVPADHG
AB670242_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670256_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
HQ700529_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPISGPLGDLPSPSPSAVPADHG
GQ475337_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
GQ475320_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ377628_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ377617_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787487_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ787483_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
FJ787482_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
FJ787479_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787439_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562325_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSISAVPADHG
FJ562304_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ562269_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386672_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPFSGPFGPLSSPSASAVPANHG
FJ386592_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939642_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPIGSLPSPSSSAVPADHG
EU939568_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
DQ089795_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY028597_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY028298_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF325700_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF325199_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670304_HBx_P-C      MAARMCCQLDPARDVLCIRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670295_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670268_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670277_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964226_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964225_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964223_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964220_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964217_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964215_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ475356_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
GQ872211_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB014398_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB198083_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670287_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSASTVPADHG
AB670294_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSASTVPADHG
AB697500_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPANHG
AY251141_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089801_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
EU916224_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ032334_HBx_P-C      MAARMCCQLDPARGVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ032359_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ032361_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
GQ377514_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ377517_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPANHG
GQ475321_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JF899336_HBx_P-C      MAARMCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JN104433_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
KC774206_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774254_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774256_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774320_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774360_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173283_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ173284_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ173327_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013792_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPATHG
KR013795_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
KR013796_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
KU964020_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964021_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964022_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964023_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964024_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964025_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964026_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964027_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964029_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964030_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964031_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964032_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964033_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KR013794_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
KC774359_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HQ700564_HBx_P-C      MAARMCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
AB670258_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964028_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSESAVPADHG
KU964049_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964050_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964051_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964052_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964053_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964054_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964055_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964056_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964057_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964058_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964059_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964060_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964061_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964062_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KU964063_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
FJ562332_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
HM750132_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KC774223_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774241_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG826143_HBx_P-C      MVARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
AB112472_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
KC164036_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164037_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164038_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164040_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164041_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164042_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164044_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164046_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164047_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164048_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164049_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164050_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164051_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164052_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164053_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164054_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164055_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164056_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164057_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164058_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164059_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164060_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164061_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164062_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164063_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164065_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164066_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164067_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164068_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164069_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164070_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164071_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
KC164072_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
AB112063_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGAFGTLPSPSSSAVPTDHG
KJ803760_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSSSAVPTDHG
FJ023651_HBx_P-C      MAARLCCQLDPARDVLCLRPVRAESRGRPLSGPFGTLPSPSASAVPPDHG
KR811755_HBx_P-C      MAAMLCCQLDPARDILCLCLVGAESRGRPVSGPLGTLPSPSPSAVPVDHG
KF214672_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KF214673_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
DQ089785_HBx_P-C      MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JQ341893_HBx_P-C      MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPFGXLPSPSSSAVPTDHG
MF115897_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHG
MF115898_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHG
MF115899_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHG
KR811723_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADLG
HM011493_HBx_P-C      MAARLCCQLDPARDVLCLRPVGDESCGRPVPGPFGNLPSPSLSAVPADHG
GQ222210_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHG
GQ222211_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHG
GQ222212_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHG
KT347089_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPLPGPFGTLPSPSSSAVPTDHG
EU717217_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSPAVSADHG
DQ089766_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089759_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089758_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089763_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ997875_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KJ997876_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KJ997856_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
KJ803823_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
KJ803754_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSSSAISADHG
KC315399_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHG
JQ040133_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPSGTLPSPSSSAVPTDHG
GQ924658_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAIPADHG
GQ924623_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAFPADHG
GQ855541_HBx_P-C      MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPPDHG
EF594751_HBx_P-C      MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGPFGTVPSPSSSAVPTDHG
DQ089777_HBx_P-C      MAARLCCQLDPARDVLCLRPVRAESRGRPVSGPFGALPSPSSSAVPTDHG
AB105174_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB111946_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB300360_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367423_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB485809_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB485810_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF223961_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089760_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089761_HBx_P-C      MAARLCCPLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674471_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470914_HBx_P-C      MAARLCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY470911_HBx_P-C      MAARLCCQLDPAQDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811752_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811729_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163895_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163883_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163881_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFRTLPSPSSSAVPADHG
KC163880_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418515_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVTGPFGSLPSPSSSAVPADHG
GQ924615_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
GQ855543_HBx_P-C      MAARLYCQLDPARDVLCLRPLDAESRGRPVSGPFGALPSPSSSAVPADHG
EF494379_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHG
DQ089784_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPFGTLPSPSSSAVPADHG
KY470915_HBx_P-C      MAARLCCQLDPARDALCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811730_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811725_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811722_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADLG
AB014390_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSTAVPANHG
MF925395_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPSDHG
MF925376_HBx_P-C      MAARLCCQLDPARDVLCLRPVDAESRGRPISGPFGTLPSPSSSAVPSDHG
KT366464_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSSSAVPTDHG
KF214675_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
KF214671_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KF214669_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
JX026880_HBx_P-C      IAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ801509_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPPDHG
JQ801499_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JQ801489_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801481_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGALPSPSSSAVPTDHG
JQ518364_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
JQ429078_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPTDHG
JQ341892_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHG
JQ027324_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPTDHG
HM011468_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
GQ924616_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
GQ855537_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
GQ855521_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPTDHG
EF594752_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGSLPSPSSSAVPTDHG
EF594750_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVSTDHG
DQ361534_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLSSPSSSAVPTDHG
DQ089779_HBx_P-C      MAARLCCQLDPARDVLXLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089776_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPTDHG
MG826139_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG571332_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHG
MF925367_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGSLPSPSSSAVPADHG
MF674514_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
MF674463_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674411_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674403_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KY470920_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470918_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470917_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470916_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY470913_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSDVPADHG
KY470912_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY470910_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470909_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470908_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470907_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470906_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276846_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KX276841_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
KR811764_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811757_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811753_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811751_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811745_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811744_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811743_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811742_HBx_P-C      MAARLRCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811741_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811740_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811739_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811736_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR811734_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR811733_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR811727_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811726_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KM875430_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLPSPSSSAVPADHG
KM875425_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KM875424_HBx_P-C      MAARLCCQLDPTRNVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ997786_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ997785_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ997766_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ598669_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598662_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ410498_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
KJ410493_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
KC875274_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875273_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875270_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163904_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163901_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163900_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163899_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163898_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163897_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163896_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163882_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163879_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163877_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163876_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163873_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPAAHG
KC163872_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163871_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JX504535_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ801498_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGTLPSTSSSAVPADHG
JQ801483_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPSSSAVPADHG
JQ801478_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
JQ341888_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341859_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
JQ341855_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418553_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418536_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ924655_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSASAVPADHG
GQ924619_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
GQ377555_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
DQ089796_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
DQ089791_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGTLPSPSSSAVPADHG
DQ089788_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089780_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089762_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSSSAVPXDHG
DQ089764_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGALPSPSSSAVPADHG
EU560438_HBx_P-C      MAARVCYQLDPARDVLCLRPVGAESRGRSVSGPFGSLSSPSSSAVPADHG
GQ377623_HBx_P-C      MAARMCCQLDPARNVLCLRPVDAESRGRSVSGPFGALSSPSSSAVPADHG
KC774319_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHG
FJ787490_HBx_P-C      IATRVCCQLDPARDVLCLRPVGAESRRQSVSGPFGPLPSPSSSAVPADHG
GQ377526_HBx_P-C      MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSAAVPADHG
DQ975272_HBx_P-C      MTARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670259_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFEHLPSPSASALPADHG
DQ975274_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSSFAVPADHG
FJ386620_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSAVPADHG
KR013828_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
JQ040143_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHG
GQ377621_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
KR013764_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KJ598762_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHR
JN418534_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHG
FJ386637_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
EU919169_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGTLPSPSSSAVPADHG
EU916218_HBx_P-C      MAARVCCQLDPARDVLCLRPISAESRGRPVSGPFGALSSPSSSAVPADHG
EU589345_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939558_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386603_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774338_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ173331_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013761_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013762_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013767_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013768_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KU963871_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963872_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963873_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963875_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963876_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963878_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963880_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963884_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU579443_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADHG
AY306136_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670273_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JF828915_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JF828917_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB014391_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGSLPSPPSSAVPAAHG
KC814884_HBx_P-C      MAARVCCQLSLTPEVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JN418541_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386677_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
MF059475_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013861_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173338_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KC814881_HBx_P-C      LAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ922649_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY881742_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881739_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881738_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881737_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881736_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KR014057_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB014367_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB014380_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB670307_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU882005_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSASAVPANHG
EU939640_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ032339_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386601_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386663_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562249_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562334_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787462_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377535_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ377553_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KY881873_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY470892_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470889_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470888_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470886_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470884_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470879_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470878_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470876_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470873_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLLSPSSSAVPADHG
KR013819_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KJ803769_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KF214651_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC814928_HBx_P-C      MAARVCCQLDPAREVLCLRPVGAESRGRPVSGPFGPLPSPSVSAVPADHG
KC814922_HBx_P-C      MAARVCCQLDPAREVLCLRPVGAESRGRPVSGPFGPLSSPSASAVPADHG
KC814907_HBx_P-C      MAARVCCQLDPAREVLCLRPVGAESRGRPVSGPFGPLPSPSVSAVPADHG
KC774358_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774207_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
JN418550_HBx_P-C      MAARVCCKLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JN418532_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JN418526_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418509_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSASAVPADHG
JN418508_HBx_P-C      MAARVCCKLDPARDVLCLRPVGAESRGRPVSGPVGPLSSPSSSAVPADHG
JN418506_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPANHG
GQ475325_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
KR013862_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAAHG
KJ598753_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ598746_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ040167_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040168_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014059_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013860_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013859_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KP784761_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173430_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173429_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173290_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
KC774314_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774281_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
GQ377575_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAXHG
GQ377619_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY881743_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881744_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881748_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881749_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881750_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881751_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881754_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881755_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881758_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881762_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881763_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881764_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881765_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881766_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881767_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881768_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881769_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881770_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881771_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881772_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881773_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881774_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881775_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881776_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
KY881777_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
AB367405_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGPLPSPSSPAVPADHG
DQ089799_HBx_P-C      MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU871976_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
EU939564_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
EU939569_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
EU939605_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386689_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLSSPSSSAVPADHG
FJ787463_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
MF059652_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVPRPFGALSPPSSSAVPADHG
KR013998_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ598761_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHR
KJ598766_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHR
KJ598767_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
KJ598768_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
KJ598769_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHR
KJ598770_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHR
KJ598771_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHR
KJ598772_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHR
KJ598773_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
KJ598774_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHR
KJ598775_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHR
KJ598776_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
KJ598777_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
KJ598779_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHR
KJ598780_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHR
KJ598756_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPTSSAVPADHR
KJ598757_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPTSSAVPADHR
KJ598760_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPTSSAVPADHR
KJ598765_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPTSSAVPADHR
KJ173318_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLSSPSASAVPADHG
KC814905_HBx_P-C      MAARVCCQLDDAREVLCLRPVCAESRGRPVSGPFGTLPSPTSSAVPADHG
KC814903_HBx_P-C      MAARVCCQLNYAREVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814927_HBx_P-C      MAARVCCQLNYAREVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814902_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774311_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSLTSSAVPADHG
JX560520_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
HQ700506_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLGALPSPPSSAVPADHG
FJ787470_HBx_P-C      MAARVCCQLGPARDVLYLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386616_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPADHG
FJ386605_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPPASAVPADHG
EU919168_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGTLPSPSSSAVPADHG
EU570072_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLSSPSSSAVPADHG
EU560439_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLSSPSSSAVPADHG
EU522071_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGHLSSPSVSAVPANHG
AF461358_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF461359_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB670311_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSAAVPTDHG
AB670298_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLSSPSSSAVPADHG
AB300372_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPTDHG
AB014388_HBx_P-C      MAARVRCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHG
D23684_HBx_P-C        MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFRSLPSPSSSAVPADHG
KT284758_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRPLSSPSSSAVPADHG
AB670270_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLSSPSSSAVPADHG
EU939540_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
GQ377563_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSLSSSAVPADHG
EU939603_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGTFGTLPSPSSSAVPADHG
KC774195_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGTFGTLPSSSSSAVPADHG
EU939579_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSFAVPANHG
FJ899774_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSFAVPANHG
JN418525_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPVGPIPSPSSSAVPADHG
KR013818_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTIPSPSPSAVPADHG
FJ787454_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSFAVPADHG
KJ173305_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSFAVPADHG
KJ173306_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSFAVPADHG
FJ562248_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSSSAVPADHG
GQ377585_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGPLSSPSSSAVPADHG
KR013791_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSSSAVPADHG
EU939652_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
FJ032332_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787468_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787469_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787471_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU916219_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHG
EU939615_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHG
FJ386671_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHG
KR014008_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPANHG
KR014010_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPADHG
KR014012_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPADHG
KR014014_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPANHG
KR014015_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPANHG
KR014016_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPANHG
KR014017_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPADHG
KR014018_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPANHG
AB367403_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSPAVPADHG
KC774279_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSPAVPANHG
AB675677_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSPAVPADHG
KC774215_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSPAVPADHG
KC774216_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSPAVPADHG
KJ598654_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPASAAVPADHG
KJ598657_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPASAAVPADHG
KJ598661_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPASSAVPADHG
AB367421_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPSSSAVPADHG
AY220699_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939600_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ032333_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ386665_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
GQ475308_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KR013827_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013865_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR014007_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814899_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814926_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562327_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPPDHG
FJ562250_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGSLPSPSSSAVPTDDG
FJ386628_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSRPFGTLPSPSAPAVPADHG
AB250109_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHG
HQ622095_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPVGSLSSPSTAAVPADHG
JN418513_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHG
KC774299_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPADHG
JN418510_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHG
GQ475318_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSAAVPTDHG
GQ377580_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSAAAVPADHG
AB014383_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAIPADHG
AB014389_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAIPADHG
KR013844_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAIPADHG
S75184_HBx_P-C        MAARVCCQLDPARDVLCLRPVGAESRGQPVSGPFGTLPSPSSPAVPADHG
AY247031_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPLGTLPSPSSTAVPADHG
EU306713_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSTAVPADHG
KY363277_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSAAVPADHG
EU939616_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSXAVPADHG
GQ475343_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSAAVPADHG
AB367402_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSPAVPADHG
AB670300_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSPAVPADHG
D28880_HBx_P-C        MAARVCCQLDPARDVLCLRPVGAESRGQPVSGPFGTLPSPSSPAVPADHG
KR013839_HBx_P-C      MAVRLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
AB112066_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KR014021_HBx_P-C      MTARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013836_HBx_P-C      MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013837_HBx_P-C      MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013838_HBx_P-C      MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013840_HBx_P-C      MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013841_HBx_P-C      MAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KR013835_HBx_P-C      TAARLCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
MF925378_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPIPGPFGTLPSPSSSAVPTDHG
KU051424_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPPASAVPTDHG
KU051426_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPPASAVPTDHG
KU051423_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGSFGTLSSPSSSAVPTDHG
KT364721_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGTLPSPSSSAVPTDHG
KJ997846_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFETLPSPSPSAVPTDHG
KJ803818_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KJ803799_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPFTGPFGTLPSPSSSAVPTDHG
KF214668_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPLQGPLGTLPSPSPSAVPTDHG
JQ801490_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
JQ801515_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KJ410515_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSTVPTDHG
JN574724_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
KJ598727_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALQSPSVSAVPTDHG
KJ598736_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPTDHG
KJ598737_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPTDHG
KU964235_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALQSPSVSAVPTDHG
HQ700516_HBx_P-C      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDLSSPSSSAVPTDHG
GQ924650_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
KJ997840_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPTDHG
KJ997841_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPTDHG
GQ924609_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
KJ803794_HBx_P-C      MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
GQ358154_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGTLPSPSSSAIPTDHG
FJ349225_HBx_P-C      MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPFGTLPSPSSSAVPTDHG
FJ023645_HBx_P-C      MAARLCCQLDPARDVLCLRPIGAESRGRPISGPFGTLPSPSASAVPTDHG
FJ023642_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDYG
EF594753_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AF068756_HBx_P-C      MAARLCCQLDPARDVLCLRPFGAESRGRPISGPFGALPSPSSSAVPTDHG
AB117758_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHG
AB074756_HBx_P-C      MAARLCCQLDPARDILCLRPVGAESRGRPVSGPFGPLPSPSSSAVPTDHG
AB247916_HBx_P-C      MAARLCCQLDPARDILCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
AB031262_HBx_P-C      MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSPSAVPTDHG
AP011097_HBx_P-C      MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPTDHG
AB105173_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
AF223957_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EF594748_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGALPSPSPSAVPTDHG
FJ023639_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
FJ023640_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHG
FJ023649_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
FJ023657_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
GQ358153_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPTDHG
GQ855525_HBx_P-C      MAARLCCQLDPTRDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
GQ855534_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPTDHG
GQ924613_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPTDHG
GQ924629_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
GQ924636_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPTDHG
GQ924649_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
GU563561_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPTDHG
JN104437_HBx_P-C      MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JN827416_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
JN827417_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
JN827418_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
JN827420_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JN827421_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JN827422_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JN827424_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JN827425_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801470_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSASAVPTDHG
JQ801473_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
JQ801475_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801480_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
JQ801486_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801496_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801502_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
JQ801508_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
JQ801510_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGTLPSPSPSAVPTDHG
JQ801511_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHG
JQ801513_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSTSAVPTDHG
JQ801519_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JX507214_HBx_P-C      MAARLCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
KJ803812_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHG
KP148549_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KT235617_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVSTDHG
KT307718_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KT307719_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KT364718_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPVGTLPSPSASAVPTDHG
KT364719_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPTDHG
KT364720_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPTDHG
KT366463_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KT987423_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPTDHG
KT987424_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KT987425_HBx_P-C      MAARLCCQLDPARNVLCLRPVGAESSGRPISGPFGTLPSPSSSAVPTDHG
KU051425_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTAHG
KU051427_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
DQ089804_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPSASAVPTDHG
DQ089778_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB205125_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
DQ089803_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
DQ315781_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPTDHG
DQ315782_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
DQ315783_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPTDHG
EF594749_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
EF594754_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
EU717214_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU872005_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU939609_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU939646_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
FJ023652_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSASAVPTDHG
GQ924612_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPTDHG
JN827423_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
MF674418_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KY670782_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRRRPVSGPFGGLPSPSLSAVPTDHG
FJ023641_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
FJ023658_HBx_P-C      MAARLCCQLDPARDVLCLRPVRAESRGRPLSGPFGTLPSPSASAVPPDHG
GQ855523_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPPDHG
GQ855548_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
JN418500_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSASAVPPDHG
JQ801520_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
JQ801523_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPPDHG
MG571335_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
MF925403_HBx_P-C      MAARLFCQLDSARDVLCLRPVGAESCGRPLSGPIGDLPSSSSSAVPTVHG
MF674442_HBx_P-C      MAARLCCQLDPARDVLYLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674484_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KX765843_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGTLSSPSSSAVPTDHG
KX765840_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
KX765838_HBx_P-C      MAARLCCQLDPARDILCLRPVGAESRGRPISGPFGALPSPSASAVPPNHG
KX765837_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPISGPFGTLPSPSASAVPPVHG
MH220971_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGTLPSPSSSAVPTDHG
MG826122_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MG725248_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGTLPSPSPSAVPTDHG
MF925394_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALSSPSSSAVPTDHG
MF925365_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MF674504_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674501_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
MF674489_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674467_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674444_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
MF674428_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
MF674417_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674408_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPTDHG
MF674390_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674388_HBx_P-C      MAARLCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
KX765842_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
KX765822_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHG
MF925410_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPFGTLPSPSPSAVPTDHG
MF925408_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MF925406_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
MF925377_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGALPSPSSSAVPTDHG
MF925375_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674502_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPTDHG
MF674474_HBx_P-C      MAARLCCQLDPARDVVCLRPVSAESSGRPISGPFGPLPSPSSSAVPTDHG
MF674412_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
MF674402_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF488703_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX765851_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAKSRGRPLSRPFGTLPSPSSSTVPTDHG
KX765850_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX765848_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX765846_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
KX765844_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX765834_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISRPFGTLPSPSSSAVPTDHG
KX765833_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
KX765832_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPTDHG
KX765831_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX765826_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLSSPSASAVPTDHG
KX765825_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPTDHG
KX765821_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KX765818_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KX276847_HBx_P-C      MAARLCCQLDPARDXLCLRPVGAESRGRPXSGPFGXLPSPSSSAVPTDHG
KX276850_HBx_P-C      MAARLCCQLDPARDVLCLRPVXAESSGRPXSGPFGALPSPSSSAVPTDHG
KX765855_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFRSLPSPSSSAVPTDHG
GQ855531_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVAGPFGSLPSPSSSAVPTDHG
GQ855528_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSPSSFAVPTDHG
FJ023643_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVAGPFGSLPSPSSSTIPTDHG
FJ023644_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVAGPFGSLPSPSSSTIPTDHG
KX765819_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSPSSSAVPTDHG
KX765847_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGSLPSPSSSAVPTDHG
KC774235_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPSGALPSPSLSAVPADNG
EU570068_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSLSAVPADHG
DQ089765_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADYG
EU554537_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU554538_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU554539_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163958_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163959_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KJ803779_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964318_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964322_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964323_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964324_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964332_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KT235627_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPIPGPFGTIPSPSPSAVPSDHG
KT235628_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPIPGPFGTIPSPSPSAVPSDHG
AB670265_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPPSSAVPADHG
AB113878_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLSSPSSSAIPTDHG
FJ386604_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ787437_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB195931_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLSSPSSSAVPADHG
AB195932_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLSSPSSSAVPADHG
AB195930_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLSSPSSSAVPADHG
AB014371_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
AB042282_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB111119_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
AB111120_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
AB195953_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSCSAVPADHG
AB195954_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSCSAVPADHG
AB367407_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367804_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSTSAVPADHG
AB014365_HBx_P-C      MAARVCCQLDLARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KC814855_HBx_P-C      MAVRVCCQLDLARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939659_HBx_P-C      MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSASAVPADHG
EU939653_HBx_P-C      MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGALPSPSASAVPANHG
FJ386631_HBx_P-C      MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHG
FJ386652_HBx_P-C      MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHG
JQ040158_HBx_P-C      MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHG
EU939583_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSSSAVPADHG
FJ899788_HBx_P-C      MAARVCCQLDPARDVFCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHG
EU939563_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ518813_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787452_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ899771_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ986376_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGNLPSPSSSAVPADHG
FJ386595_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSSSAVPADHG
DQ089767_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVSADHG
KC163952_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163953_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
AB670262_HBx_P-C      MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AY641560_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB014361_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367416_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367803_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU939561_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB014376_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLPSPSSSAVPADHG
AB014382_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB014385_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB014393_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB111121_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB195947_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB195948_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB367399_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSCSAVPADHG
AB367406_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB367414_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367417_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367420_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB670239_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB670240_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB670243_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLPSPSSSAVPADHG
AB367413_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
HQ700457_HBx_P-C      MAARMCCQLDPSRDVLCLRPVGAESRGRPVAGPLGXLXSPSSSAVPANHG
JF828908_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSSSAVPADHG
KC163889_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPVAGPFGTLPSPSSSAVPADHG
DQ478900_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY028303_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRTFGALPSPSVSAVPANHG
AB042285_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB670279_HBx_P-C      MAARVCCQLDPSRDVICLRPVGAESRGRPVSGPFGPLXSPSSSAVPADHG
AF384364_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AF384365_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AF384366_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AF384367_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
DQ683578_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KC774345_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSLSAVPADHG
KC774296_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
GQ475357_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSASAVPADHG
EU939585_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386641_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU916227_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU872002_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTIPSPSSSAVPADHG
EU872000_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU872001_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU872003_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU872004_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU717215_HBx_P-C      MAARMCCQLDPARDVLCLRPVGVESRGRPVSGPSGTLPSPSSSAVPANHG
AB300368_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSPAVPADHG
AB014360_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ899793_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ899794_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB014363_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367431_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
AY206385_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
EU939545_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGNLPSPSSSAVPADHG
EU939595_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSVSAVPADHG
EU939647_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386594_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386670_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787488_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
AB697494_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418564_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KR013870_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGDLPSPSPSAVPADHG
KR013871_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGDLPSPSPSAVPADHG
KR014077_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGDLPSPSPSAVPADHG
KR014078_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGDLPSPSPSAVPADHG
KR014079_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPIPGSLGDLPSPSPSAVPADHG
KR014082_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPIPGSLGDLPSPSPSAVPADHG
KR014083_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPIPGSLGDLPSPSPSAVPADHG
HM011495_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
EU939539_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHG
FJ032336_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
FJ032338_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
JQ027318_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
JN418519_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSASAVPPDHG
JN418527_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPPDHG
GQ377618_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGSLPSASTSAVPAVHG
MF925409_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPSDHG
KJ803757_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPSDHG
EF394328_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPSDHG
EF384201_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPSDHG
EF384205_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPSDHG
AF182804_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSVSAVPADHG
EU939599_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386596_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHG
FJ386687_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHG
KY363280_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB115417_HBx_P-C      MAARMCCQLDPTRDVLCLRPVGAESRGRPVSRPFGPLSSPSWSAVPADHG
AY308741_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
DQ788835_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
EU871973_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
EU871974_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
EU939614_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386614_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386645_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828916_HBx_P-C      MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JF828919_HBx_P-C      MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418546_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSPSAVPANHG
JN418556_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPLSGPFGPLPSPSSSAVPAVHG
KJ173319_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964014_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPADHG
KU964216_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964218_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964221_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KJ598721_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGALPSPSVSAVPADHG
KU964242_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGALPSPSVSAVPADHG
GQ924620_HBx_C-C      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGALPSPSPSAVPADHG
JN827414_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGALSSPSPSAVPADHG
JN827415_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGALPSPSPSAVPADHG
GQ924622_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVPADHG
EU306690_HBx_P-C      MAARPCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
AF241410_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
EU306685_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
EU306687_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
EU306688_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
EU306689_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
EU306691_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVPGPFGTLPSPSSSAVPADHG
JN104440_HBx_P-C      VAARLCCKLDPARDVLCLRPVGAESRGRPVPGPFGTLSSPSSSTVPADHG
AB241110_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHG
AB241111_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHG
AP011099_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHG
AP011101_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPVSGALGDLSSPSPSAVPADHG
EU410081_HBx_P-C      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHG
AF241411_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLPSPSPSAVPADHG
AY862869_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHG
MG826135_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSFGALPSPSSSAVPADHG
AP011100_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVAGSLGDLSSPSPSAVPADHG
EU410080_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVAGSLGDLSSPSPSAVPADHG
AJ748098_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVAGPFGTLPSPSSSAVPADHG
KY629631_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGGLPSPSLSAVPADHG
KJ803790_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGALSSPSPSAVPADHG
DQ089792_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGSFGTLPSPSSSAVPADHG
D23682_HBx_P-C        MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHG
DQ986375_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRSVGALPSPSSSAVPADHG
EU939573_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGSFGTLSSPSSSAVPADHG
FJ562299_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHG
KC774306_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRSFGTLPSPSPSAVPADHG
KJ598723_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGALPSPSVSAVPADHG
KJ598729_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGALPSPSVSAVPADHG
KJ598731_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSFGALPSPSVSAVPADHG
KJ598734_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSFGALPSPSVSAVPADHG
KJ598735_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGALPSPSVSAVPADHG
KJ598738_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGALPSPSVSAVPADHG
KU964229_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSFGALPSPSVSAVPADHG
KU964231_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGALPSPSVSAVPADHG
KU964232_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGALPSPSVSAVPADHG
KU964233_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGALPSPSVSAVPADHG
KU964240_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSFGALPSPSVSAVPADHG
GQ855544_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGTLPSPSSSAVPTDHG
DQ089783_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSPSAVPADHG
EU410079_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGDLSSPSPSAVPADHG
AB198080_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGALPSPSSSAVPADHG
AB367426_HBx_P-C      MAARMCCQLDPARDVLCLRPVRAESRGRPVSGSFGPLPSPSSSAVPADHG
AB367801_HBx_P-C      MAARMCCQLDPARDVLCLRPVRAESRGRPVSGSFGPLPSPSSSAVPADHG
KJ173335_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
KJ173336_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGALPSPSPSAVPADHG
FJ562298_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRTFGPLSSPSASAVPADHG
D23683_HBx_P-C        MAARMCCQLDPARDVLCLRPVGAESRGRPIPGSFGTLPSPSSSAVPADHG
KC774211_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGALPSPSSSAVPADHG
JF828921_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESCGRPLSGSFGPLPSPSSSAVPADHG
AB670246_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGPLPSPSSSAVPADHG
AY066028_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPAHHG
AF411410_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSSSAVPPDHG
DQ089800_HBx_P-C      MAARVCCQLDPARDVLCLRPVDTESCGRPLTGPLGTLPSPSSSAVPAVHG
EU939544_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPTDHG
EU554535_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSFAVPTDHG
DQ922651_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGAFGTLPSPSSSAVPTDHG
EU554536_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
FJ032340_HBx_P-C      MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGTLPSPSSSAVPTDHG
FJ032341_HBx_P-C      MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGTLSSPSSSAVPTDHG
KR014000_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173337_HBx_P-C      MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSSSAVPANHG
KC163950_HBx_P-C      MAARVCCQLDPARDVLYLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
JQ707715_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707708_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
GQ475317_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESCRRPVSGPFGPLPSPSSSAVPADHG
GQ377636_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSTVPTDHG
GQ377579_HBx_P-C      MAARVCCQLDPARDVLCLRPLGAESRGRPVAGPFGTLPSPSSSAVPADHG
FJ899778_HBx_P-C      MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPVGALSSPSSSAVPADHG
EU939557_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
EU916234_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU717212_HBx_P-C      MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB014384_HBx_P-C      MAARVCCQLDPARDVLRLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHG
KU964321_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964326_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964327_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964333_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
FJ787455_HBx_P-C      MAARLCCQLDPARDVLCSRPVGAESRGRPISGPFGALPSPSSSAVPTGHG
KF214676_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSTVPTDHG
KJ997796_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPTDHG
KJ997801_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPTDHG
KJ997906_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPTDHG
MF488701_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGSLPSPSSSAVPTDHG
MF674425_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674458_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB111122_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB111123_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AY206381_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY206382_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU939536_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU939582_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALSSPSSSAVPADHG
EU939592_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ032350_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
FJ386623_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPANHG
FJ386657_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ899768_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
HM011500_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JF828913_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JF828918_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JF828920_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU939571_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHG
GQ377572_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPTDHG
GQ377624_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU939625_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
JN418542_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
AB367424_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU306722_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562256_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
JN418521_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418524_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418528_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418567_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KC163949_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163961_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSSSAVPADHG
KC163965_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
AB288026_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGNLPSPSASAVPADHG
AB367397_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
AB367434_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
FJ562293_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
KJ173292_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPLGTLPSPSSSAVPADHG
KJ173431_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173432_HBx_P-C      MAARVCCQLDPARDVLCLRPIGTESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341899_HBx_P-C      MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPVGTLPSPSSSAVPTDHG
EU916229_HBx_P-C      MAARVCCQLDPARDVLCLRPLGAESRGRPLSGPFGPLPSPSSSAVPADHG
GQ924633_HBx_P-C      MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
EU939588_HBx_P-C      MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPVGALSSPSSSAVPADHG
FJ386617_HBx_P-C      MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGPLSSPSSSAVPADHG
JQ707730_HBx_P-C      MAARLCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707713_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707712_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707711_HBx_P-C      MAARMCCKLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707710_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707707_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
GQ475353_HBx_P-C      MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ787484_HBx_P-C      MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787459_HBx_P-C      MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562333_HBx_P-C      MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562272_HBx_P-C      MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562245_HBx_P-C      MAAGVCCQLDPARDVLCLRPLGAESRGRPVSGPFGPLPSPSSSAVPADHG
KC774245_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ386627_HBx_P-C      MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLPSPSSSAVPXDHG
JQ707733_HBx_P-C      MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707716_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707717_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707718_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707719_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707720_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707721_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707722_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707723_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707724_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707725_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707726_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707727_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707728_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707729_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707731_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ707732_HBx_P-C      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
AY251132_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTNHG
KC814889_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KC814920_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
FJ787461_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562265_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
EU916233_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
DQ089772_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU939594_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPTDHG
DQ980550_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
AB670253_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPTDHG
DQ975273_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KC814919_HBx_P-C      MAARVCCQLDPARDVLCLRPVGVESCGRPISGPFGTLPSPFSSAVPPDHG
KC774292_HBx_P-C      MDARLCSQLDPARAILYLRPVGAESRGRPVSGQFGPLPSLFASAVPANHG
KC774180_HBx_P-C      MVPRVCGQLDPARDVRCLRPVGPESRGPPVSRPLGPLWSPFSFAVPANRG
KC774227_HBx_P-C      MGARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPFLFAVPTDHG
KC774191_HBx_P-C      MDDRVCCQLDPARDVLCLRPVGVESRGRPVSGPFGAFPSPSSFAVPADHG
EF594767_HBx_P-C      MSARLYCQLDSSRDVLCLRPVGAESRGRPLPRPLGTVSSPSPSAVPSDHG
EF594763_HBx_P-C      MAARLYCQLDPSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
JN574721_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
FJ876251_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPYPSAVPSDHG
FJ876238_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPYPSAVPSDHG
FJ876229_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876192_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876191_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876246_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594766_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAISSPSPSAVPSDHG
EF594758_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594764_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
FJ876190_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876202_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSVVPSDHG
FJ876204_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876205_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSVVPSDHG
FJ876252_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594760_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876239_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
KT235618_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPSDHG
FJ876203_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876206_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
FJ876230_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVPSDHG
EF594768_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRALARPLGAVSSPSPSAVPSDHG
EF594769_HBx_P-C      MAARLYCQLDSSRDVLCLRPVGAESRGRALARPLGAVSSPSPSAVPSDHG
KR811467_HBx_P-C      MDARLCCQLBPARDVLCLRPFGAESRGRPISGPFGNLPSPSSSAXPTDHG
KC814901_HBx_P-C      MGGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774200_HBx_P-C      MDARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPTLFAVPADHG
MF115871_HBx_P-C      MAARLCCQLDPARDVPCLRPVSAESRGRPLARSLGTLSSPSPSAVPSDHG
MF115873_HBx_P-C      MAGGLCCQLDSSRDVLCLRPVSAESRGRPLARSLGTLSSPSPSAVPSDHG
EU939543_HBx_P-C      MAGRLCCQMDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
AB112065_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPCSSAVPADHG
KR811476_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRSVSGPLGDLPSPSSSAGPADHG
KY881807_HBx_P-C      MAARVCCQPDPARDVLCLRPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KC774203_HBx_P-C      MDVRVCCQVDRARDVLCLRPVGVESRGRPISGPFGTLPSPSSSAVPADHG
JN418565_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLSSPPSSAVPADHG
HQ700522_HBx_P-C      MAARLCCQLDPTRDVLCLRPVSAESGGRSVSGPPGDLPSPSLPAVPADHG
HQ700543_HBx_P-C      MAARLCCQLDPTRDVLCLRPVSAESGGRSVSGPPGDLPSPSLPAVPADHG
DQ536414_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPAPSAVPADHG
DQ536413_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPAPSAVPADHG
DQ536410_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPAPSAVPADHG
DQ536412_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPAPSAVPADHG
DQ536411_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPAPSAVPADHG
HQ700495_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPANHG
HQ700496_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPANHG
KJ598641_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADNG
KJ598660_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADNG
KJ598642_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADNG
KU964015_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHG
KC774265_HBx_P-C      MAARMCCQLDPARDVLCLRPVRAESRGRPVSGPFGALPSPSSFAVPADHG
KC774197_HBx_P-C      MVARVCCQLDPARDVLCLRPVGAESRGRPVSGPCGALPSPCSSAVPADRG
GQ358157_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRSVSGPLGVVPSPSPSAVPAAHG
FJ562310_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPPSSAVPTDHG
FJ386651_HBx_P-C      MAARVCCQLDPARDVLCLRPVGPESRGRPVPRPFGTLPSPSASAVPADHG
EU306672_HBx_P-C      MAARLCCQLDPARNVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPANHG
AB493844_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANYG
AB111113_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB074047_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLAGPFGTLPSPSSSAVPADYG
KR013823_HBx_P-C      MAARLCCQLDPARDVLCLRPAGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX429914_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALSSPSPSAVPADNG
FJ904423_HBx_P-C      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
FJ562307_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGPLSSPSASAVPADHG
EU939584_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ980549_HBx_P-C      MAARLCCQLDPARDILCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367409_HBx_P-C      MAARVCCQLDPAGDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPADHG
AB112408_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDLG
KC163996_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163994_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVAGPFGTPPSPSSSAVPADNG
KC163985_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163981_HBx_P-C      MAARVCCRMDPARDVLCLRPVGAESRGRPVAGPFGTPSSPSSSAVPADNG
KC163982_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163983_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPANNG
KC163986_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163987_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163988_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163990_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163991_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163992_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163993_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163995_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC163997_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164000_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164003_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164005_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164006_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164007_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164008_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164009_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164010_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164011_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164012_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164013_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164014_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164015_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164016_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164017_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164018_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164019_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164020_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164021_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164022_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164024_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164025_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164026_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164027_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164028_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164029_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164030_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164033_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164004_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KC164023_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTPPSPSSSAVPADNG
KP148473_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KM875412_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESCGRPLSGSLGALPSPSPSAVPADHG
KJ803792_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPTDHG
KC774290_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774236_HBx_P-C      MAARLCCQLDTARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPTDHG
JX507211_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSSSAVPTDHG
HQ700569_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSPFAVPANHG
FJ386611_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ023677_HBx_P-C      MAARLCCQLDPTRDILCLRPVGAESSGRPLSGPLGDLPSPSSSAVPAIHG
EU871970_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADRG
AB493839_HBx_P-C      MAARLCCQLDTARDVLCLRPVGAESRGRPVAGPLGGLPSPSSSAVPADHG
AB115418_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSRPFGPLSSPSSSAVPADHG
AB112348_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDLG
AB049610_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSASAVPADHG
KC163998_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTPPSPSSSAVPADNG
FJ899777_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ899773_HBx_P-C      MAARVCCQLDPARDVLCLRPVGVESRGRPLSGPFGTLPSPSSSAVPADHG
EU939611_HBx_P-C      MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGTLPSPSTSAVPANHG
EU872013_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSSSAVPADHG
EU871980_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSSSAVPADHG
EU871998_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGALPSPSSSAVPADHG
EU872012_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598681_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598705_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598706_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598707_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598708_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598709_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598710_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598711_HBx_P-C      MAARVCCQLDPARNVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598712_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598713_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598714_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598715_HBx_P-C      MAARVRCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598716_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598717_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598718_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSLSAVPADHG
KJ598719_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
AB471849_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439015_HBx_P-C      MAARVCCHLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439016_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU881999_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU882000_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939570_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU939574_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU939576_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939590_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939591_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386598_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562239_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ562242_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562274_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562324_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562339_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
GQ377515_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470883_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ562266_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGSLPSPSSSAVPADHG
GQ377574_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ598693_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KC774249_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KC774347_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KJ598694_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598698_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598702_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598703_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598689_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSTTAVPADHG
KF873528_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLPSPSPSAVPADHG
KF873525_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGXXPSPSPSAVPADHG
KF873526_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLPSPSPSAVPADHG
KF873529_HBx_P-C      MAAXLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLPSPSPSAVPADHG
EU589336_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MH488822_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
MH488821_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881810_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY881815_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY470980_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470981_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470982_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470984_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470988_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY363284_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPTDHG
KX765828_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPFGTLPSPSSSAVPTDHG
KU963887_HBx_P-C      MAARVCCQLDPARDVLCLRPVGDESRGRHVSGPFGTLPSPSSSAVPADHG
KU963886_HBx_P-C      MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963888_HBx_P-C      MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963889_HBx_P-C      MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963890_HBx_P-C      MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963891_HBx_P-C      MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963892_HBx_P-C      MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963893_HBx_P-C      MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPANHG
KU963894_HBx_P-C      MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963895_HBx_P-C      MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963896_HBx_P-C      MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963897_HBx_P-C      MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963898_HBx_P-C      MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KU963899_HBx_P-C      MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
KT284756_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVEGPFGTLPSPSSSAVPADHG
KR811728_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADLG
KR013895_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013829_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAAPADHG
KR013776_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KP148472_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KR013854_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ997826_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ997829_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ997830_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ997831_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ803774_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSTVPAAHG
KJ598748_HBx_P-C      MAARMCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598742_HBx_P-C      MAARMCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598750_HBx_P-C      MAARMCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598754_HBx_P-C      MAARMCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPAAHG
KJ598730_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPIGALPSPSVSAVPPDHG
KU964230_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPIGALPSPSVSAVPPDHG
KJ598635_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598646_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598659_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ173309_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173310_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173293_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173294_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173315_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875262_HBx_P-C      MAARVCCQLDPAGDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814900_HBx_P-C      MAARVCCQLDDARDVVCLRAVGAESRGRPVSGPFGTLPSPSSSAVPADQG
KC814882_HBx_P-C      MAARVCCQLVLMPFVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814871_HBx_P-C      KAARVCCQLNSAGDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814863_HBx_P-C      MAARLCCQLGLARDVLCLRPVGAESRGRPVSGPFGLLPSPSSSAVPADHG
KC774329_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPVSSPSSSAVPADHG
KC774327_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAIPADHG
KC774268_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAIPADHG
KC774276_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGSLPSPSSSAIPADHG
KC774229_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSSSAVPADHG
KC774181_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGSFGSLPSPSASAVPADHG
KC163954_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRRRPVSGPFGTLPSPSSSAVPADHG
JX504541_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPANHG
JX429912_HBx_P-C      MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSSSSSAIPADHG
JX429904_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX026884_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTIPSPSSSAVPADHG
JQ040166_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGALPSPSSSAVPADHG
JQ027322_HBx_P-C      MAARXCCQLDTARDVLCLRPVGAESRGRPVAGPSGALPSPSSSAVPADHG
JN418530_HBx_P-C      MAARLCCQLDPARDVLCLRPVGTESRGRPVSGPFGPLPSPSSSAVPADHG
JN418498_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSSAVPADHG
HQ700571_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPISGPLGDLPSPASSAVPADHG
HQ700556_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSFAVPANHG
HQ700502_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPPSSAVPANHG
HQ700475_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPAXHG
HQ700504_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPADHG
HQ700558_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHG
HQ700559_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGXLPSPSPSAVPANHG
HQ700561_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHG
GU434374_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGTLPSPSSSAVPADHG
GQ377521_HBx_P-C      MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787456_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
FJ386644_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRSVSGPFGTLPSPSSSAVPADHG
FJ386640_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSTVPADHG
EU939657_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
EU939619_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPISGPFGPLPSPSSSAVPADHG
EU916223_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
EU916222_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGALSSPSSSAVPADHG
EU871982_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
EU939604_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
EU570067_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU547562_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPPSSAVPADHG
EU306725_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439005_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU305540_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ980551_HBx_P-C      MAARMCYQLDPARDVLCQRPVGAESRGRPVSGPFGALPSPSYSAVPADHG
DQ922650_HBx_P-C      MAARMCCQLDPARDVLCLRPVRSESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089802_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVPRPFGPLSSPSTSAVPADHG
DQ089787_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
DQ089771_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AY028593_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSPSAVPADHG
AP011107_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF473543_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF384372_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADHG
AF223956_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF223954_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341857_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB900113_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSTSAVPADHG
AB670274_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB367411_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPSDHG
AB300373_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB298720_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB298721_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB246346_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
AB241112_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHG
AB241113_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGALGDLSSPSPSAVPADHG
AB202071_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB202072_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB014387_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGHLSSPSSSAVPANHG
AB367802_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGPLPSPSSSAVPADHG
AB014369_HBx_P-C      MAARLCCQLDPARDVLCLRPVGTESRGRPVSRPFGTLSSPSASAVPADHG
AB014368_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
AB014372_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB014396_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AF223958_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ855533_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU498227_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276855_HBx_P-C      MAARLYCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
AB368297_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISRPFGPLSSPSTSAVPADHG
HM011472_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
AB195949_HBx_P-C      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089768_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367395_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
JQ040144_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY363281_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
MG893558_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
MF059688_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
KY882000_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAIPANHG
KY881968_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881967_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANRG
KY881961_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881959_HBx_P-C      MAARVCCQLDPARNVLCLRPVNTESRERPVSGPFGTLPSPSSSAVPANHG
KY881930_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881919_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881814_HBx_P-C      MAARVCCQLDPARDVLCLCPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY881811_HBx_P-C      MAARVCCQLDPARDVLCLCPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY470927_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFESLPSPSSSAVPADHG
KY363257_HBx_P-C      MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGPLPSPSCSAVPADHG
KU964004_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGNLPSPSSSAVPADHG
KU964011_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KU964012_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964013_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964016_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
KU964017_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964018_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964019_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KT987426_HBx_P-C      MAARLCCQLDPARNVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KT284755_HBx_P-C      MAARVCCQLDTARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
KT284753_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFRALPSPSSSAVPADHG
KR013877_HBx_P-C      MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013873_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013846_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
KR013786_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ803793_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPPDHG
KJ803761_HBx_P-C      MAARLCCQLDPARDVLWLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ598639_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KF873520_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF214670_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPTDHG
KC875263_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814913_HBx_P-C      MAVRVCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
KC814912_HBx_P-C      MAARVCCQLDPARECLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC814906_HBx_P-C      LAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSVSAVPADHG
KC814880_HBx_P-C      FAARVCCQLDDAEDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814877_HBx_P-C      MAARVCCQLTEAGDVLCLRPVGAESRGRPVSGPVGTLPSPSSSAVPADHG
KC774218_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHG
KC774185_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHG
KC163957_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
JX504545_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
JX429918_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSYSAVPTDHG
JX429909_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
JQ801493_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPTASAVPTDHG
JQ341883_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040172_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040152_HBx_P-C      MAARLCCQLDPARDVLCLRPLGAESGGRPVSGPFGSLPSASSSAVPADHG
JQ040129_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN104432_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
GQ924604_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAIPADHG
GQ475322_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPAVHG
GQ475309_HBx_P-C      MAARVCCQLDTARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ377576_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
GQ377552_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377518_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ899789_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRSVSGPFGALSSPSSSAVPADHG
FJ899765_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
FJ787445_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562306_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGSLPSPSDSAVPADHG
FJ562300_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRSVSGPFGGLPSPSLSAVPANHG
FJ562285_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSSSAVPADHG
FJ562238_HBx_P-C      MAARVCCQLDPARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562228_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
FJ562220_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSASTVPADHG
GQ475315_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
FJ386653_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ386618_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386612_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSFSAVPADHG
FJ386589_HBx_P-C      MAARVCCQLDPTRDVLCLRPVSAEPSGRPVSGPFGPLSSPSSSAVPADHG
FJ032346_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADLG
FJ032331_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
EU939610_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939554_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU916225_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHR
EU916211_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU916212_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU916213_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU916214_HBx_P-C      MAARVWCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
HM750141_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPADHG
EU547559_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAEXSGRPVSGPFGNLPSPSXSAVPADHG
EU522069_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439014_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EF536066_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPGDHG
DQ377160_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVLADHG
AY641559_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AF411412_HBx_P-C      MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGTFPSPSSSAVPADHG
AF182805_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
AB900099_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESCRRPVSGPFGTLPSPSSSAVPADHG
AB670301_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670266_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367429_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
FJ386650_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ246215_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB014379_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB074755_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
AB112471_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
AB113875_HBx_P-C      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB113876_HBx_P-C      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB113877_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSTSAVPADHG
AB670264_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSTSAVPADHG
AB670297_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB900109_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGHLSSPSASAVPADHG
AF223959_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF223960_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AP011106_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY167092_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY206386_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPAAHG
DQ089756_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089773_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089775_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
DQ089789_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377637_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
GQ377632_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
GQ377586_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
GQ227697_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
GQ227692_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
FJ562315_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
FJ562252_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023655_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939648_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939580_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EF197911_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089790_HBx_P-C      MAARLCCQLDXARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
DQ478901_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
KF873539_HBx_P-C      MAARLCCELDPARDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF873541_HBx_P-C      MAARLCCELDPTRDVLCLRPVGAEPRGRPVSRPLGXLPSPSSSAVPADHG
KJ173443_HBx_P-C      MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173444_HBx_P-C      MAARMCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG893553_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MH488839_HBx_P-C      MVARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSVVPADHG
MG826129_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPASSAVPADHG
MG826128_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPASSAVPADHG
MF925359_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MF674430_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KY881806_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY470929_HBx_P-C      MAARVCCQPDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
KY363260_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KY022423_HBx_P-C      MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
KX429625_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHG
KU964035_HBx_P-C      MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013863_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR013811_HBx_P-C      MAARVCCQLDPARNVLCLRPVDAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013789_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
KR013763_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KP148560_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
KP148532_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ803777_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KJ598655_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598637_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ410514_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ410508_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSASAVPAVNG
KJ173286_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KF873516_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KC814916_HBx_P-C      MAARVCCQLGPAEYVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814915_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814908_HBx_P-C      WAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC814897_HBx_P-C      LAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSVSAVPADHG
KC814888_HBx_P-C      IGGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KC814874_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC814866_HBx_P-C      MAARVCCQLDSMREVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774335_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPIGDLPSPSTSAVPAEHG
KC774333_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774316_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSFAVPANHG
KC774194_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSPAVPADHG
KC163947_HBx_P-C      MAARVCCQLDPARDVLYLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
KC163890_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPPPSSSAVPADHG
KC163886_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163875_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADYG
KC163869_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163868_HBx_P-C      MAARMCCQLDPARDVLCLRPVSPESRGRPVSGPFGTLPSPSSSAVPADHG
KC163866_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVLGPFGTLPSPSSSAVPADHG
KC163865_HBx_P-C      MAARMCCQLDTARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JX504542_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JQ040162_HBx_P-C      MAARMCCQLDPARDVLSLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ027323_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JN418539_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
JN418518_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JN418504_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN104435_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828937_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JF828925_HBx_P-C      MAARMCCQLDPARDVLCLRPVGTESCGRPLSGPFGPLPSPSSSAVPADHG
HQ700570_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
HQ700490_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
HQ700456_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPATHG
HM750136_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPLSGAFGDLPSPSSSAVPADHG
GQ475350_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSTAVPADHG
GQ475333_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
GQ377536_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ562241_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562235_HBx_P-C      MAARVCCQLDPARDVLCLRPVVAESRGRPIAGPFGTLPSPSSSAVPADHG
EU939596_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939556_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPANHG
EU439009_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306676_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB697502_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB300365_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPADHG
AB471848_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB471850_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF458664_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
AY206384_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
DQ980547_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU916217_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562270_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
FJ562275_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787447_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
FJ787448_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
GQ377546_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX429906_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774248_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173281_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
KJ173282_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
KJ173289_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
KJ173301_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
KJ173302_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
KJ173427_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173428_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173435_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173436_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KR013771_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013773_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013830_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013831_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013832_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013833_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013834_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013909_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KU963937_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
AB014362_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB014374_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
AB014381_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
AB014392_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB014399_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AB042283_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB042284_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB104892_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPANHG
AB111112_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB111115_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB111116_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB111117_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB111118_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
AB182589_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB195936_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB195937_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB195938_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB195942_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB195943_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB195944_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB195945_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB195952_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSCSAVPADHG
AB246345_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB300361_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB367392_HBx_P-C      MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB367394_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367398_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367408_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB367418_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AB367425_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPADHG
AB367432_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSTSAVPADHG
AB367433_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
AB670241_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670252_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB111124_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB111125_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB198077_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB246344_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB300363_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGALPSPSSSAVPADHG
AB931170_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSTSAVPADHG
AB931171_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSTSAVPADHG
AF223955_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY167099_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
AY251134_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
AY251135_HBx_P-C      MAAMLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
AY251140_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ089769_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089770_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
DQ089781_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089782_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089786_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPFGTLPSPSSSAVPADHG
EF688062_HBx_P-C      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU305541_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU305542_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU306671_HBx_P-C      MAARLCCQLDPARNVLCLRPVGAESRGRPVSGPFGALPSPSPSAVPANHG
EU306673_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU670263_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023646_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023647_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSPSAVPADHG
FJ023650_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023653_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023656_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386625_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGSLPSTSSSAVPADHG
GQ855530_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
GQ924643_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGPLPSPSSSAVPADHG
MK321266_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLXSPXSSAVPADHG
MG826137_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF925405_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925398_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925387_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925374_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925369_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
LC279276_HBx_P-C      MAARLCYQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KY470937_HBx_P-C      MAARPCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
KX765849_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPPASAVPTDHG
KX276839_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KU964214_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPISSPSSSAVPADHG
KU963919_HBx_P-C      MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963918_HBx_P-C      MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963917_HBx_P-C      MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963916_HBx_P-C      MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963915_HBx_P-C      MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KR811760_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811747_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPFSSAVPADHG
KR014060_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014055_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014005_HBx_P-C      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013937_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
KR013868_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
KR013864_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR013856_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013855_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013826_HBx_P-C      MAARLRCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013774_HBx_P-C      MAAGACCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013772_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013770_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KP148545_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148538_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148468_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KM213037_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ598752_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598751_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598749_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598743_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598740_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGALPSPSSSAVPADHG
KJ598687_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPADHG
KJ598645_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598644_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598640_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598638_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598636_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ410513_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ410501_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KJ173328_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875269_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774286_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSTVPANHG
KC774283_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KC164085_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163966_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163964_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163963_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163962_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSSSAVPADHG
KC163956_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163955_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163948_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163874_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163867_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPIGTLPSPSSSAVPTDHG
JX661495_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSPSAVPADHG
JX661491_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX661490_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX429903_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLETLPSPSSSAVPADHG
JQ801500_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
JQ040165_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
HQ700476_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHG
HM011497_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
GQ924642_HBx_P-C      MAARLCCQLDPARDVLCLRPVRAESRGRPISGPFGTLPSPASSAVPADHG
FJ899769_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ023654_HBx_P-C      MAARLCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939553_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
DQ377161_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY641561_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADYG
AB014395_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
JX870000_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSSSAVPADHG
HQ700567_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSPSAVPANHG
HQ700566_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGTLPSPSPSAVPANHG
HQ700565_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
HQ700563_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGGLSSPSSSAVPANHG
HQ700562_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
HQ700568_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPADHG
HQ700573_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLSSPSSSAVPANHG
X75665_HBx_P-C        MAARVCCQLDPTRDVLCLRPVGAESRGRPVSRPFGALPSPSLSAVPANHG
X04615_HBx_P-C        MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
MH891502_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
MH488850_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
MG826140_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
MG826136_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
MG826134_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
MG826133_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG826131_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MG826127_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
MG826124_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTVPSPSSSAVPADHG
MG571359_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
MG571345_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSASAVPADHG
MF674472_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MF674454_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MF674435_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674429_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674386_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC373512_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
LC373511_HBx_P-C      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
LC318703_HBx_P-C      MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSSSAVPANHG
LC279275_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
LC279249_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSYSAVPADHG
LC279248_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSYSAVPADHG
LC279247_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSYSAVPADHG
LC279246_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSYSAVPADHG
KY881999_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881998_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881996_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881995_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881993_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADRG
KY881992_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881987_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881986_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881985_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881983_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881982_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881978_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881977_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881976_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881975_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881973_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881970_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881969_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881965_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881964_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881963_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881943_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881942_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881941_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881940_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881939_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881938_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881936_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881935_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881934_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881933_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881932_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881931_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881929_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881928_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881927_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881926_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881925_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881924_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881923_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KY881922_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881921_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881920_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881918_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881917_HBx_P-C      MAARVCCQLDPARNVLCLRPVGTESRGRPVSGPFGTLPSPSSSAVPANHG
KY881892_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881883_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881882_HBx_P-C      MAARVCCQLGPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881877_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KY881876_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881817_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESSGRPVAGPLGTLPSPSSSAVPADHG
KY881813_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESSGRPLSGPLGTLPSPSSSAVPADHG
KY881812_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPLGTLPSPSSSAVPADHG
KY881805_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY881804_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY881803_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPLGTLPSPSSSAVPADHG
KY629637_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470991_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470990_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470987_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470986_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470985_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470983_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KY470936_HBx_P-C      MAARLCCRLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
KY470934_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470933_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470930_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470926_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470925_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470891_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470890_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470887_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470885_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470882_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470877_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470875_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY470874_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFRSLPSPSSSAVPADHG
KY363279_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFPGPFGPLPSPSTSAVPADHG
KY363278_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFPGPFGPLPSPSTSAVPADHG
KY363274_HBx_P-C      MAARVCCQLDPARDVLCLCPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KY363267_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGPLPSPSSSAVPADHG
KY363254_HBx_P-C      MAARVCCQLDPVRGVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPVNHG
KX765853_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
KX765845_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
KX765830_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KX765827_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESCGRPISGPFGTLPSPSSSAVPADHG
KX765824_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KX765823_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KX765820_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSASAVPPDHG
KX429658_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276854_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPISGPFGTLPSPSSPAVPADHG
KX276844_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPASSAVPADHG
KX276840_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
KX276838_HBx_P-C      MAARVCCQLDTARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964360_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964331_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964330_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964329_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964328_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964325_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964320_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964319_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KU964198_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964197_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964196_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964195_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964194_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964193_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964188_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964187_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964186_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964185_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSVSSPSSSAVPADHG
KU964184_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964179_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964176_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRRRPFSGPFGALPSPSSSAVPADHG
KU964064_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964048_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964047_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964046_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964045_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964044_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964043_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964042_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964041_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964040_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964039_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964038_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964037_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964036_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964034_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963914_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963913_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963912_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963911_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963910_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963909_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963908_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963907_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963906_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963905_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963904_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963903_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963902_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963901_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963900_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KU963885_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963882_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963881_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963879_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963877_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963874_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KT364751_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGSLPSPSPSAVPADHG
KR811763_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811762_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811758_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811756_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811750_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811749_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811748_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811746_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811737_HBx_P-C      MGARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811732_HBx_P-C      MGARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR811459_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014099_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014098_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014049_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014048_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014041_HBx_P-C      MAARVCCQLDPVRDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
KR014006_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013984_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013975_HBx_P-C      MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTPPSPSSSAVPADHG
KR013961_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KR013927_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013904_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013903_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013885_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPAAHG
KR013876_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGQPVSGPFGTLPSPSSSAVPADHG
KR013875_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013872_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013866_HBx_P-C      MAARVCCQPDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR013858_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013857_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013851_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013850_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013845_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPFPSSSAVPADHG
KR013822_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013817_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KR013814_HBx_P-C      MAARVCCQLDPARNVLCLRPVDAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013813_HBx_P-C      MAARVCCQLDPARNVLCLRPVDAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013810_HBx_P-C      MAARVCCQLDPARNVLCLRHVDAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013809_HBx_P-C      MAARVCCQLDPARNVLCLRPVDAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013808_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013807_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013805_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR013803_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013802_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013798_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KR013797_HBx_P-C      MAARVCCRLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KR013787_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KR013785_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013784_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013783_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013782_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013781_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013780_HBx_P-C      MAARVCCQLNPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013779_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KR013778_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLLSPSSSAVPADHG
KR013769_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013766_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KR013765_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KP148575_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148574_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
KP148571_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148570_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148568_HBx_P-C      MAARLCCRLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148566_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSVVPADHG
KP148564_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148562_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148561_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148558_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148557_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148555_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148554_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148552_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148548_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148547_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148546_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148540_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148537_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148535_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148534_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148531_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148530_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148529_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148526_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148525_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148524_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148523_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148521_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148520_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148519_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148517_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148514_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148513_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSVVPADHG
KP148512_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148493_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148488_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148482_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148481_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148480_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148479_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148477_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148476_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148475_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148474_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148471_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148470_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148469_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148464_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148463_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148462_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148315_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP027477_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KM359441_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KJ997816_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSAPFGTLPSPSSSAVPADHG
KJ997815_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSAPFGTLPSPSSSAVPADHG
KJ997811_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSAPFGTLPSPSSSAVPADHG
KJ803826_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSASAVPADHG
KJ803815_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSASAVPADHG
KJ803814_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSASAVPADHG
KJ803813_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSASAVPADHG
KJ803811_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSASAVPADHG
KJ803810_HBx_P-C      MAARLYCQLDPARDVLCLRPVGAESCGRPVSGPFGSLPSPSSSAVPADHG
KJ803780_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPTDHG
KJ803776_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
KJ803770_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSRPFGTLPSPSSSAVPADHG
KJ803762_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ803759_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ790199_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ410519_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ410510_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
KJ410505_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPAGHG
KJ410504_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ410499_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KJ410496_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPFGSLPSPSSSAVPADHG
KJ410495_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KJ410494_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KJ410492_HBx_P-C      MAARLRCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KJ410491_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KJ173445_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173442_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173441_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173440_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSSSSSAVPADHG
KJ173439_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSSSSSAVPADHG
KJ173438_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ173437_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ173434_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ173433_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KJ173426_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173394_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173393_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173392_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173391_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173334_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173333_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ173332_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173314_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173313_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173312_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSASAVPADHG
KJ173311_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSASAVPADHG
KJ173308_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173307_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173304_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173296_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ173285_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KF873514_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAEPRGRPFSGPLGALPSPSSSAVPADHG
KF495606_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGGLPSPSLSAVPADHG
KF485389_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
KF214677_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
KF214667_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLSSPSSSAVPTDHG
KF214655_HBx_P-C      MAARVYCQLDPPRDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KF214652_HBx_P-C      MAARVYCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
KC875271_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875267_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875264_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814925_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814923_HBx_P-C      MGGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814914_HBx_P-C      MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814911_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC814894_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814893_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC814892_HBx_P-C      MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814887_HBx_P-C      MGGRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814854_HBx_P-C      KAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774356_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KC774354_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774346_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774342_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSSSAVPADHG
KC774339_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774337_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSRPFGALPSPSSSAVPADHG
KC774325_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774313_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774298_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAHG
KC774295_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSSSAVPADHG
KC774293_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774287_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774285_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774284_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPANHG
KC774280_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774278_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSLSAVPADHG
KC774277_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774275_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774272_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774267_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
KC774260_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
KC774259_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774257_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774255_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774252_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHG
KC774247_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KC774239_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774238_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774237_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KC774233_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774232_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KC774231_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774228_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774224_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KC774220_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSTVPADHG
KC774213_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774210_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774209_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774205_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774204_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774190_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774189_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPFGDLPSPSSSAVPADHG
KC774187_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPANHG
KC774184_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSTVPADHG
KC774182_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC164151_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164150_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164149_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164148_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164147_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164146_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164145_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164144_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164143_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164142_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164141_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164140_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164139_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164138_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164137_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164136_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164135_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164134_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164133_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164132_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164131_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164130_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164129_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164128_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164127_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164126_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVRADHG
KC164125_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164124_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164123_HBx_P-C      MAAGLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164122_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164121_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164120_HBx_P-C      MAARLCCQLDPARDVLCLRPVCAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164118_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164117_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164116_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164115_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164114_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164113_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164112_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164111_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164110_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164109_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164108_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164107_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164106_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164105_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164104_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164103_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164102_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164101_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164100_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164089_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164088_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164087_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC164086_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSTSSSAVPADHG
JX661496_HBx_P-C      MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX661492_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
JX661489_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JX661488_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JX560519_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
JX504546_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX504537_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
JX429915_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX429913_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JX429907_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESGGRPVSGPFGTLPSPSSSAVPADHG
JX026888_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALSSPSSSAVPADHG
JQ801522_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPTDHG
JQ801521_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPTDHG
JQ801518_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
JQ801517_HBx_P-C      MAARLCCQLDPARDVLCLRPVDAESRGRPVSGPFGTLPSPSASAVPTDHG
JQ801505_HBx_P-C      MAARLCCQLDPTRNVLCLRPVSAESRGRPLSGPFGTLPSPSSSAVPADHG
JQ801504_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPFGALPSPSSSAVPADHG
JQ801503_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801497_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGPLSSPSSSAVPTDHG
JQ801491_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPIGTLPSPSASAVPPDHG
JQ801488_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGPLPSTSSSAVPADHG
JQ801482_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
JQ801472_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPSPSASAVPTDHG
JQ707773_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ688404_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341898_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ341890_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
JQ341889_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPTDHG
JQ341872_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ040163_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040141_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040131_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040127_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JQ027332_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
JQ027320_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPXSGPFGTLPSPSSSAVPADHG
JN418561_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JN418560_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JN418552_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418493_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSSSAVPADHG
JN400089_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
JN400088_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
JN400087_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
JN315779_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN104434_HBx_P-C      MAAWVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHR
HM750140_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
HM750139_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
HM750138_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HM750137_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
HM011489_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPAHHG
HM011465_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
GU721029_HBx_P-C      MAARVCCQLDPTRNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GU357845_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ872210_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
GQ475355_HBx_P-C      MAARVCCQLDPXRDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ475354_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
GQ475352_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ475351_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475349_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475348_HBx_P-C      MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ475347_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475346_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLGPLSSPSSSAVPADHG
GQ475345_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
GQ475344_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ475342_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475341_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ475339_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSFSAVPADHG
GQ475336_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475334_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475332_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475331_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
GQ475330_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPANHG
GQ475329_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLGPLSSPSSSAVPADHG
GQ475328_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475327_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475326_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
GQ475324_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475319_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475316_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475314_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475313_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475312_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475310_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
GQ475307_HBx_P-C      MAARVCCQLDPTRDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ475306_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
GQ475305_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPLGPLSSPSSSAVPADHG
GQ377620_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377616_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
GQ377609_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377608_HBx_P-C      MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
GQ377605_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377603_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPABHG
GQ377600_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377599_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377591_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
GQ377584_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
GQ377583_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
GQ377578_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377571_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377570_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ377562_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPAAHG
GQ377559_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ377557_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPANHG
GQ377554_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ377551_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377545_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPADHG
GQ377541_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ377531_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
GQ377530_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377524_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
GQ377523_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ259588_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
GQ227696_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
GQ227695_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
GQ227694_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
GQ227693_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
FJ899795_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ899783_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSPSAVPADHG
FJ899776_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ899775_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
FJ899772_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
FJ899764_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
FJ899763_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
FJ899761_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
FJ787489_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ787486_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787474_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787467_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGSLPSPSSSAVPADHG
FJ787466_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGSLPSPSSSAVPADHG
FJ787465_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGSLPSPSSSAVPADHG
FJ787464_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGSLPSPSSSAVPADHG
FJ787457_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
FJ787453_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
FJ787451_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
FJ787450_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
FJ787443_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ787442_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ751770_HBx_P-C      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562340_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPANHG
FJ562337_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562335_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPAIHG
FJ562330_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562329_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562326_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
FJ562323_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
FJ562320_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ562319_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSLSAVPADHG
FJ562318_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562313_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562308_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
FJ562301_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ562297_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562295_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
FJ562292_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562291_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
FJ562290_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562288_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562284_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ562283_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562282_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
FJ562281_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562280_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSVSAVPADHG
FJ562279_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ562268_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPAAHG
FJ562264_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ562261_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562258_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562251_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562244_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ562243_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ562233_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562232_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ562225_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ562221_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ562218_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPANHG
FJ518810_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSTSAVPADHG
FJ386685_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386679_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
FJ386673_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386667_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386664_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPSGTLPSPSPSAVPADHG
FJ386661_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
FJ386659_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ386647_HBx_P-C      MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
FJ386638_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSSSSSAVPANHG
FJ386632_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386630_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386629_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPANHG
FJ386626_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ386621_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
FJ386619_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386613_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
FJ386609_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386607_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ386602_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ386591_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386588_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
FJ386587_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FJ386579_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386577_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
FJ386575_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPAHHG
FJ386574_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ151413_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
FJ032356_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ032355_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ032351_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
FJ032347_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
FJ032345_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939658_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939656_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
EU939655_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
EU939654_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
EU939651_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU939649_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPANHG
EU939645_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
EU939644_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLSSPSSSAVPADHG
EU939643_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSVSAVPADHG
EU939641_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939618_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPLGSLPSPSSSAVPADHG
EU939613_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU939612_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
EU939607_HBx_P-C      MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSTSAVPADHG
EU939601_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939593_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
EU939587_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939572_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
EU939567_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939566_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
EU939562_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939555_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939552_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
EU939550_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU939549_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
EU939541_HBx_P-C      MAARVCCQLDPSRDVLCIRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
EU939538_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
EU939537_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU919165_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU919164_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU916238_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU916237_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU916216_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
EU916215_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
EU881996_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU872008_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
EU871979_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
EU871978_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSSSAVPADHG
EU871977_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU871975_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU796069_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPADHG
EU579442_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU570074_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
EU570073_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
EU562218_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLSSPSSSAVPADHG
EU560441_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU560440_HBx_P-C      MAARVCCQLDPPRDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU554542_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU554541_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU554540_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
EU522068_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439025_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439013_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439012_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU439011_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306729_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306728_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306727_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
EU306726_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU306724_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306721_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306720_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306719_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU306714_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EF536065_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EF137803_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EF137802_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
DQ993693_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ993692_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ993691_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ993690_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ993181_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPANHG
DQ890381_HBx_P-C      MAAGVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPATHG
DQ478899_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ478885_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ377165_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ377164_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ377163_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ377162_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
DQ089794_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
DQ089793_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSSSSSAVPADHG
DQ089757_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
D50520_HBx_P-C        MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
D50519_HBx_P-C        MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
D50518_HBx_P-C        MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
D50517_HBx_P-C        MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
D23681_HBx_P-C        MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
D12980_HBx_P-C        MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
D00630_HBx_P-C        MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AY641563_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY641562_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
AY641558_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AY596108_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY311588_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AY251142_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AY247032_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AY220702_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AY220701_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHG
AY220700_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY206392_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY206389_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
AY206388_HBx_P-C      MAAGVYCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY206379_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
AY206378_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
AY206376_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
AY167096_HBx_P-C      MAARVCCQLDPTRDVLCLRPVSAESRGRPVSGPFGALPSPSSSAVPADHG
AY167090_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY028299_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AP011098_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AF533983_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF461363_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF461357_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF458665_HBx_P-C      MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AF384371_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF363961_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AF355785_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB971715_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB971714_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB900116_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB697510_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB697490_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSSAVPADHG
AB675675_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
AB675674_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGALPSPSPSAVPADHG
AB670310_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670309_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670308_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB670306_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670302_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB670292_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
AB670291_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670290_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670289_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670288_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670283_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670282_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
AB670281_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPADHG
AB670272_HBx_P-C      MAARVCCQLDPSRDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670263_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGHLPSPSTSAVPADHG
AB670260_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB670255_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB367422_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AB195946_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
MK818227_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
MH488859_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
MH488831_HBx_P-C      MAARTCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
MF674475_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MF059725_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY881891_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881816_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLPSSSSSAVPADYG
KY363283_HBx_P-C      MATRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KY363276_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLPSPSSVAVPADHG
KY363268_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KY363252_HBx_P-C      MAARMCCQLDPARGVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KX276853_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276849_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGXLPSSSSXAVPTDHG
KU964243_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPADHG
KU964241_HBx_P-C      MAARLYCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSASAVPADHG
KU964239_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALSSPSLSAVPAAHG
KU964238_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPADHG
KU964237_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSASAVPADHG
KU964236_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPADHG
KU964234_HBx_P-C      MAARLYCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSASAVPADHG
KU679957_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSTSAVPADHG
KU679949_HBx_P-C      MAARLCCQLDPARDVLCLRPVXAESRGRPFSGPLGALPSPSSSAVPADHG
KU679947_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSTSAVPADHG
KR014011_HBx_P-C      MAARACCQLDPARDVLCLRPVGAESRGRSVSGPFGSLPSPSASAVPADHG
KR013849_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
KR013804_HBx_P-C      IAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013790_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013788_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
KM875428_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KJ598739_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALSSPSLSAVPAAHG
KJ598733_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598732_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALSSPSLSAVPAAHG
KJ598728_HBx_P-C      MAARLYCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSASAVPADHG
KJ598726_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPADHG
KJ598725_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSASAVPADHG
KJ598724_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALSSPSLSAVPAAHG
KJ598722_HBx_P-C      MAARLYCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSASAVPADHG
KJ598720_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSVSAVPADHG
KJ598667_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ410518_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173324_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814924_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814910_HBx_P-C      MAARVCCQLDPAREVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814896_HBx_P-C      WAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC814891_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814865_HBx_P-C      LAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814858_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814857_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814852_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774355_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774353_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPANHG
KC774352_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774326_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KC774300_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAYG
KC774297_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774225_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSSSAVPADHG
KC774221_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774179_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC163892_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC163888_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPADHG
KC163887_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLSSPSSSAVPADHG
KC163884_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX661497_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX507212_HBx_P-C      MAARMCCQLDPSRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ707774_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ707772_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ707771_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ707770_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ707769_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ707768_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341902_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341885_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPFGTLPSPSSSAVPADHG
JQ040164_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040156_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPANHG
JQ040151_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSXVPADHG
JQ040145_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040139_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040135_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPAAHG
JQ040132_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ027333_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ027321_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ027319_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JN418544_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
JN418543_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
JN418540_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGPLPSPSSSAVPADHG
JN418538_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
JN418533_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418523_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418514_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418512_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418511_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418507_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
JN418505_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSTSAVPADHG
JN418503_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JN418501_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418497_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPANHG
JN418496_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN418495_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPSSSAVPADHG
JN418494_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JF828931_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828930_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828929_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828928_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828926_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828924_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828923_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828922_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESCGRPLSGPFGPLPSPSSSAVPADHG
JF828912_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828911_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828910_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828907_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828906_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF828905_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JF436920_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HQ700555_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHG
HQ638218_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
HM750135_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HM750134_HBx_P-C      MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HM011502_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
HM011491_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
HM011488_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSPSAVPADHG
HM011486_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HM011481_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KU679951_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGXLXSPSPXAVPADHG
KX276836_HBx_P-C      MAARLXCQLDPARDVLCLRPVGXESRGRPVSRPFGTLSSPSASAVPADHG
MG826138_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVSADHG
MG826132_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
MG826126_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSVSAVPADHG
MG826125_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
MF674494_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674486_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF674468_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
MF674457_HBx_P-C      MAARLCCQLDPARDVLCLRPVDAESRGRPVSGPFGPLPSPSSSAVPADHG
MF674398_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC318702_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
LC279274_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KY881872_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY363261_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KY363258_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLSSPSSSAVPADHG
KX765852_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGPLPSTSSSAVPADHG
KX765839_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
KX429617_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPISGPFGTLPSPSSSAVPADHG
KX276852_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESXGRPVSGPFGTLPSPSSSAVPADHG
KX276851_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276833_HBx_P-C      MAARLCCQLDPARNVLCLRPVGAESXGRPVSRPFGPLSSPSASAVPADHG
KU964228_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964227_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964224_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964222_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KU964219_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KT284759_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KT284757_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KR819180_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPANHG
KR811754_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR014002_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013996_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013974_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013969_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013905_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013902_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013899_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013890_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAHG
KR013883_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAHG
KR013882_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAHG
KR013878_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPAAHG
KR013869_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
KR013867_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KR013848_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
KR013847_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
KR013842_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
KR013825_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013824_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013821_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013820_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESHGRPVSGPFGTLPSPSSSAVPADHG
KR013801_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013800_HBx_P-C      MAARVYCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAGHG
KR013799_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KP148572_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148563_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148551_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KP148466_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
KM875423_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
KM875406_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KM875405_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
KM875404_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
KJ997866_HBx_P-C      MAAGLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KJ803766_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGALPSPSSSAVPADHG
KJ803765_HBx_P-C      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ598678_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSHSLSAVPAAHG
KJ598677_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLPSPSLSAVPAAHG
KJ598676_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598674_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPSGALPSPSLSAVPAAHG
KJ598673_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598672_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598671_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598670_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598668_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598666_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598665_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598664_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ598663_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
KJ410521_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESCGRPVSGPFGTLSSPSSSAVPADHG
KJ410511_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ410489_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPADHG
KJ173323_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173295_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ173288_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
KF485390_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KC875272_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875268_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875265_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC875261_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
KC814909_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC814862_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC774361_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774343_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSPSASAVPADHG
KC774340_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774331_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774330_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGNLPSPSSSAVPAAHG
KC774321_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSPSAVPADHG
KC774308_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPANHG
KC774304_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC774302_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPANHG
KC774301_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774289_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774288_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSSSAVPADHG
KC774282_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774269_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774266_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSSSSSAVPADHG
KC774253_HBx_P-C      MAARMCCQLDPARNVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPANHG
KC774251_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774250_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774243_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774240_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774226_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESSGRPVSGPFGTLPSPSSSAVPADHG
KC774219_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774208_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JX504539_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX504536_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX504534_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
JX026885_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX026877_HBx_P-C      MAARVYCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ801501_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
JQ801495_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
JQ688403_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341903_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JQ341900_HBx_P-C      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ341897_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
JQ341887_HBx_P-C      MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLXSPSSSAVPADHG
JQ341886_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
JQ341878_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPFGTLXSPSXSAVPADHG
JQ341863_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSASAVPADHG
JQ341860_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040161_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPAAHG
JQ040154_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HQ700572_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGALPSPSPSAVPANHG
AB176642_HBx_P-C      MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSXSAVPADHG
AB670276_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ386639_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
X52939_HBx_P-C        MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSVVPADHG
MH887433_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MH818373_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MH488838_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MH488810_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPANHG
MH488809_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPANHG
MH094411_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MG893557_HBx_P-C      MAARVCCQLDPARGVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG893556_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG826123_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGALPSPSSSAVPADHG
MG776414_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG776413_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF059674_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
LC279262_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279261_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279260_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279259_HBx_P-C      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279258_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
LC279257_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279256_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279255_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279254_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279253_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
LC279252_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
LC279251_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
LC279250_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
LC279245_HBx_P-C      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSYSAVPADHG
LC090200_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY882003_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY882002_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY882001_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881997_HBx_P-C      MAARVCCQLDPARYVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881994_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881991_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881990_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881989_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881988_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881984_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881981_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881980_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881979_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881974_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881972_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KY881971_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881966_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881962_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881960_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881890_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881889_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881888_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881887_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881886_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KY881885_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881884_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881881_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881880_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881879_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881878_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
KY881875_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881874_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881871_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881870_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KY881819_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
KY881818_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPLGTLPSPSSSAVPADHG
KY881809_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPLGTLPSPSSSAVPADHG
KY881802_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESSGRPVSGPLGTLPSPSSSAVPADHG
KY470905_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470904_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470903_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470902_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470901_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470900_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470899_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470897_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470896_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470895_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470894_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470881_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY470880_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KY363287_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KY363286_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KY363285_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KY363282_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KY363275_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPANHG
KY363266_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGPLPSPSSSAVPADHG
KY363264_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAIHG
KY363253_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KX276831_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964365_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964364_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964363_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964362_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964361_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964359_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964358_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964357_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964356_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964355_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964354_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964353_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964352_HBx_P-C      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964350_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964349_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964348_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964347_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964346_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964345_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964344_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964343_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964342_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964341_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KU964340_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964339_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964338_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964337_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964336_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964334_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964213_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964212_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964211_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964210_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964209_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964208_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964207_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964206_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964205_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964204_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964203_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964202_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964201_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964200_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSTSAVPADHG
KU964183_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964182_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964181_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964180_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHG
KU964178_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964177_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHG
KU964175_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHG
KU964174_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964173_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHE
KU964172_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHG
KU964171_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964170_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964169_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGALPSPSSSAVPADHG
KU964078_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964077_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964075_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964074_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964073_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964072_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964071_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964070_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964069_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964068_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964067_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964066_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
KU679960_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPPGDLPSPSSSTVPADHG
KU679937_HBx_P-C      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDXPSPSSSAVPAXHG
JQ341895_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341875_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
JQ341870_HBx_P-C      MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HQ700578_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPIGTLPSPSPSAVPANHG
AB670254_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HQ700576_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDXPSPSXSAVPANHG
KU679936_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
HQ700577_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLXSPSXXAVPANHG
HQ700575_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGXLSSPSPSAVPANHG
KF873544_HBx_P-C      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHG
KX276835_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPANHG
KU964065_HBx_P-C      MAARVCCQLDPARDVLCLRPVDAESRGRPVSGPFGTLSSPSSSAVPADHR
KU964076_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHR
JQ341896_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGTLPSPSSSAVPADHG
KF873536_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHG
JQ341865_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSPSAVPADHG
JQ341868_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KX276848_HBx_P-C      MAARLCCQLDPARBVLCLRPVSAESRGRPISGPFGTLPSPSSSAVPADHG
JQ341891_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341879_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ341877_HBx_P-C      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ027317_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPXSGPFGTLSSPSSSAVPADHG
HM011479_HBx_P-C      MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHG
KX276837_HBx_P-C      MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSASAVPADHG
JQ040149_HBx_P-C      MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLXSPSSSXVPADHG
KC163967_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163968_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163969_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163970_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163971_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163972_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163973_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163974_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163975_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163976_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163977_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163978_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KC163979_HBx_P-C      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPFGGLPSPSLSAVPADHG
KJ598647_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598648_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598649_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598650_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598651_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598652_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598653_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598656_HBx_P-C      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KJ598658_HBx_P-C      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
KU963920_HBx_P-C      MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963921_HBx_P-C      MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963922_HBx_P-C      MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963923_HBx_P-C      MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963924_HBx_P-C      MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963925_HBx_P-C      MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963926_HBx_P-C      MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963927_HBx_P-C      MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963928_HBx_P-C      MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
KU963929_HBx_P-C      MAARLCCQLDPARDVLCLRPVSSESRGRPVSGPFGTLPSPSSSAVPADHG
                                             :                          

KC774351_HBx_P-C      APRSSRGLPLCACSSAGPCTLRFTHADR--PETAVNPHQVFPQVVQKRTT
GQ184326_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLP-VLHKRTL
KC774357_HBx_P-C      AHLCLRGLPVGAFSFPGPCAVRFTFARR--METAVNPHQVFPKVLQKRTL
KC774196_HBx_P-C      AHLSIRGLPVCAVSSPGPCALRFTCARC--METTVNARQVLPKVLHKRTS
KC774336_HBx_P-C      AHLSIRGLPVCAVSSPGPCALRFTCARC--METTVNARQVLPKVLHKRTI
KC163999_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC774244_HBx_P-C      AHLSTRGLPVCPFSSAGPCALRLTSSRR--METTVNAHQVFPKVSHKRTS
KC774264_HBx_P-C      AHLSIRGLPVCALSSAGPCALRFTCARC--METTVNAHQVLPKVLHKRTR
HQ700574_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
KR013923_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013942_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939546_HBx_P-C      AHLSLRGLPVCALSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB900115_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQALPKVLHKRTL
KY470977_HBx_P-C      AHLSLRGLPVCAFSSAGPCAFRFTSARR--METTVNALQVLPKVLHKRTL
KY470968_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLHKRTL
KY470967_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLHKRTL
KY470965_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLHKRTL
KY470969_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLHKRTL
KY470970_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLHKRTL
KY470971_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLHKRTL
KY470972_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLHKRTL
KY470973_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLHKRTL
KY470974_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLHKRTL
KY470975_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLHKRTL
KY470976_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLHKRTL
KY470978_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLHKRTL
KY470979_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLHKRTL
KY470966_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLHKRTL
AB367428_HBx_P-C      AHLSLRGLPACAFSSAGPCALRFTSARR--METTVNAHKVLPKVLHKRTL
KC774271_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
EU939542_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTMNAHRALPKVLHKRTL
FJ899767_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTMNAHRALPKVLHKRTL
HM750131_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814879_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964189_HBx_P-C      AHLSLRGLPVCAFSCAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964190_HBx_P-C      AHLSLRGLPVCAFSCAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964191_HBx_P-C      AHLSLRGLPVCAFSCAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964192_HBx_P-C      AHLSLRGLPVCAFSCAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964199_HBx_P-C      AHLSLRGLPVCAFSCAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774217_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC163906_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386624_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
GQ372968_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
DQ089797_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRAL
AF355779_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KM229703_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB198076_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386678_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787449_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377533_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377538_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774242_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ803809_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787441_HBx_P-C      ARLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKGTL
AY057947_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNTRQVLPKVLHKRTL
KC774199_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814898_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC814904_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB300362_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
MG893560_HBx_P-C      AHFSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881915_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881937_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963992_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963996_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963997_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964002_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR014013_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013852_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013853_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013874_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013815_HBx_P-C      AHLSLRGLPVCAFSSAGPCVLRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598741_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598744_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598745_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173395_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173396_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173317_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774348_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173446_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774309_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTMNARQVLPKVLHKRTL
KC774270_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774261_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774262_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX661493_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774318_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
JX429916_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KC774192_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX026878_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JN418554_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
HQ700517_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377529_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNVHQVLPKVLHKRTL
GQ377527_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173287_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ358158_HBx_C-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ562255_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNVRQVLPKVLHKRTL
FJ386662_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386597_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ032360_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939597_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939578_HBx_P-C      ENLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU916226_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU916210_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013915_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013919_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU589340_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU589341_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU589342_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562276_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787481_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EF494377_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
AF326587_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF326585_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF326586_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377528_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475311_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JX429905_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX429917_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX504544_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774202_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774274_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774303_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ803800_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AF286594_HBx_P-C      AHLSLRGLPVCAFSSTGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF182803_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU871969_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF182802_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670305_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670269_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670261_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB670249_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB642099_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598747_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB485808_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AB367410_HBx_P-C      ANLSLRGLPVCALSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
AB362932_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774315_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB205123_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB113879_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB106895_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB050018_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774310_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173291_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAPQVLPKVLHKRTL
KJ173303_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAPQVLPKVLHKRTL
KR013812_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU562215_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU562216_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU562217_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475338_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AF324347_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU439010_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVDAHQVLPKVLHKRTL
AB367412_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JN418555_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB014386_HBx_P-C      AHLSLRGLPVCAFSSTGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB014397_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQLLPKVLHKRTL
AB026811_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB026812_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB026813_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB026814_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB026815_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB033550_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB198078_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB198079_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB198081_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB198082_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB205124_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AB222714_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AB299858_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB300359_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367404_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB426467_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB471851_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AB471852_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AB471853_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AB640730_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB642100_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNARQVLPKVLHKKTL
AB670237_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670247_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AB670267_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB222715_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
KC774214_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNATQVLPKVLHKRTL
KC774334_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTI
EU871971_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU871972_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JN418558_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB033551_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
AB033553_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
AB033556_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
AB367396_HBx_P-C      AHLSLRGLPVCAFSSTGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
FJ386576_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METSVNTHQVLPKVLHKRTL
JN418535_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
AY251137_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNVHQVLPKVLHKRTL
GQ377543_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNVHQVLPKVLHKRTL
KC774312_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNVRQVLPKVLHKRTL
KT364752_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNVHQVLPKVLHKRTL
KJ598778_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787485_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562273_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ023648_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU939617_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTMNAHQVLPKVLHKRTL
EU939560_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF325701_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670278_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB033552_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHLVLPKVLHKRTL
AB365451_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367427_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU717218_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562331_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB014364_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB014377_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLXKRTL
AB014378_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB014394_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB111114_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB367401_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB367430_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
AB367435_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB642095_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB642097_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB670238_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670242_HBx_P-C      AHLSLRGLPVCAFSSXGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB670256_HBx_P-C      AHLSLRGLPVCAFSSXGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
HQ700529_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARLVLPKVLHKRTL
GQ475337_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475320_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377628_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377617_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787487_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787483_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVMPKVLHKRTL
FJ787482_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787479_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ787439_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ562325_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ562304_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
FJ562269_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386672_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386592_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939642_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939568_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
DQ089795_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AY028597_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY028298_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF325700_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF325199_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670304_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB670295_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLYKRTL
AB670268_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVXPKVLYKRTL
AB670277_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964226_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964225_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964223_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964220_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964217_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964215_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475356_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAQQVLPKVLHKRTL
GQ872211_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB014398_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB198083_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670287_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670294_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB697500_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AY251141_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAQQVLPKVLHKRTL
DQ089801_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
EU916224_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQILPKVLHKRTL
FJ032334_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ032359_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ032361_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377514_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377517_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475321_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JF899336_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN104433_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774206_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774254_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNANQVLPKVLHKRTL
KC774256_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNANQVLPKVLHKRTL
KC774320_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774360_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173283_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173284_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173327_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATAVNAHQVLPKVLHKRTL
KR013792_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013795_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013796_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964020_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KU964021_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KU964022_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KU964023_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KU964024_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KU964025_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KU964026_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KU964027_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KU964029_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KU964030_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KU964031_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KU964032_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KU964033_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KR013794_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHRVLPKVLHKRTL
KC774359_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARRVLPKVLHKRTL
HQ700564_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
AB670258_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
KU964028_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHLVLPKVLHKRTL
KU964049_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
KU964050_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
KU964051_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
KU964052_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
KU964053_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
KU964054_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
KU964055_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
KU964056_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
KU964057_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
KU964058_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
KU964059_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
KU964060_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
KU964061_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
KU964062_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
KU964063_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
FJ562332_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHXVLPKVLHKRTL
HM750132_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
KC774223_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHHVLPKVLHKRTL
KC774241_HBx_P-C      ANLSLRGLPACAFSSAGPCALRFTSARR--METTVNAHHVLPKVLHKRTL
MG826143_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNVHQVLPQVLHKRTL
AB112472_HBx_P-C      AHLSLRGLPVCAFSSAGPGALRYTSARG--METTVNARQVLPKALHKRTL
KC164036_HBx_P-C      AHPSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164037_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164038_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164040_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164041_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METAVNARQVLPKVLHNRTL
KC164042_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164044_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164046_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164047_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164048_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164049_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164050_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164051_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164052_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164053_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164054_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164055_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164056_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164057_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164058_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164059_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164060_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164061_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164062_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164063_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164065_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164066_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164067_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164068_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164069_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164070_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164071_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC164072_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
AB112063_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ803760_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
FJ023651_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811755_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KF214672_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KF214673_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089785_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPQVLHKRTL
JQ341893_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF115897_HBx_P-C      AHLSLRGLPVCAFSSAGPRALRFTSARR--METTVNARQVLPKVLHKRTL
MF115898_HBx_P-C      AHLSLRGLPVCAFSSAGPRALRFTSARR--METTVNARQVLPKVLRKRTL
MF115899_HBx_P-C      AHLSLRGLPVCAFSSAGPRALRFTSARR--METTVNARQVLPKVLHKRTL
KR811723_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
HM011493_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
GQ222210_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ222211_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ222212_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KT347089_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU717217_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ089766_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089759_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089758_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089763_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAQQVLPKVLHKRTL
KJ997875_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRSTSARR--METTVNAHLVLPKVLHKRTL
KJ997876_HBx_P-C      AHRSLRGLPVCAFSSAGPCALRSTSARR--METTVNAHLLLPKVLHKRTL
KJ997856_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ803823_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ803754_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
KC315399_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--VETTVNAHQVLPKVLHKRTL
JQ040133_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METAVNARQVLPKVLHKRTL
GQ924658_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
GQ924623_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
GQ855541_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EF594751_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089777_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--LETTVNARQVLPKVLHKRTL
AB105174_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQALPKVLHKRTL
AB111946_HBx_P-C      AHLCLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB300360_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367423_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB485809_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB485810_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF223961_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089760_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089761_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQALPKVLHKRTL
MF674471_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MEATVNARQVLPKVLHKRTL
KY470914_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470911_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811752_HBx_P-C      AHLSLRGLPVCALSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811729_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163895_HBx_P-C      AHLSLRGIPVCAFSSAGPCAPRFTSARR--METTVNARQVLPKVLHKRTL
KC163883_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--IETTVNARQVLPKVLHKRTL
KC163881_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163880_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--MEPTVNARQVLPKVLHKRTL
JN418515_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ924615_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNVCQVLPKVLHKRTL
GQ855543_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
EF494379_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089784_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470915_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811730_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811725_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRSTSARR--METTVNARQVLPKVLHKRTL
KR811722_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB014390_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
MF925395_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF925376_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KT366464_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KF214675_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAPQVLPKVLHKRTL
KF214671_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KF214669_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JX026880_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQALPKVLHKRTL
JQ801509_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801499_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801489_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801481_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ518364_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ429078_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ341892_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ027324_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAXQVLPKVLHKRTL
HM011468_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQALPKVLHKRTL
GQ924616_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ855537_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ855521_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EF594752_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EF594750_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ361534_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089779_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089776_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MG826139_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAQQVLPKVLHKRTL
MG571332_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF925367_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674514_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674463_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674411_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674403_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470920_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470918_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470917_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVTARQVLPKVLHKRTL
KY470916_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470913_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470912_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470910_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470909_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470908_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470907_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470906_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX276846_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX276841_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811764_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811757_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811753_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811751_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811745_HBx_P-C      AHLSLRGLPVCAFSSAGPCALHFTSARR--METTVNARQVLPKVLHKRTL
KR811744_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811743_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811742_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811741_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811740_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811739_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811736_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811734_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MGTTVNARQVLPKVLHKRTL
KR811733_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MGTTVNARQVLPKVLHKRTL
KR811727_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811726_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KM875430_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KM875425_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KM875424_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ997786_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ997785_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ997766_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598669_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ598662_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ410498_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ410493_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
KC875274_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC875273_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC875270_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163904_HBx_P-C      ANLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163901_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163900_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163899_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163898_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163897_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163896_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163882_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163879_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163877_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163876_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163873_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLRKRTL
KC163872_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163871_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JX504535_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801498_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801483_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801478_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
JQ341888_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ341859_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAXQVLPKVLHKRTL
JQ341855_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN418553_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN418536_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ924655_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
GQ924619_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
GQ377555_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089796_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ089791_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089788_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
DQ089780_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089762_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089764_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU560438_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377623_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774319_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNDHQALPKVLHKRTL
FJ787490_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377526_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ975272_HBx_P-C      AHLSLRGLPVCAFTSTGPCALRFTSARR--MEATVNAHQVLPKVLYKRTL
AB670259_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
DQ975274_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386620_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KR013828_HBx_P-C      AHLSLRGLPVCAFSSAGPCAFRFTSARR--METTVNAHQVLPKVLHKRTL
JQ040143_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377621_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013764_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598762_HBx_P-C      ANLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JN418534_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ386637_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU919169_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU916218_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU589345_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939558_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTI
FJ386603_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774338_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173331_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013761_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013762_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013767_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013768_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963871_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963872_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963873_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963875_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963876_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963878_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963880_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963884_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU579443_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AY306136_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRLTSVRR--METTVNAHQVLPKVLHKRTL
AB670273_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JF828915_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JF828917_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB014391_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814884_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JN418541_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
FJ386677_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYNRTL
MF059475_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLFMVLHKRTL
KR013861_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
KJ173338_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHRVLPKVLHKRTL
KC814881_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METSVNAHQVLPKVLHKRTL
DQ922649_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881742_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881739_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881738_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881737_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881736_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR014057_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
AB014367_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB014380_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB670307_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU882005_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939640_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ032339_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
FJ386601_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ386663_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ562249_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ562334_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ787462_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
GQ377535_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377553_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881873_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470892_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470889_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKKTL
KY470888_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470886_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470884_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470879_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470878_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470876_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470873_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013819_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ803769_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KF214651_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC814928_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KC814922_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814907_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KC774358_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774207_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JN418550_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JN418532_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
JN418526_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JN418509_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JN418508_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JN418506_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475325_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013862_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
KJ598753_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598746_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ040167_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ040168_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR014059_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
KR013860_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
KR013859_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
KP784761_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173430_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173429_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173290_HBx_P-C      ANLSLRGLPICAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KC774314_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774281_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377575_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQXLPKVLHKRTL
GQ377619_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881743_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881744_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881748_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881749_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881750_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881751_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881754_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881755_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881758_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881762_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881763_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881764_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881765_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881766_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881767_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881768_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881769_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881770_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881771_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881772_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881773_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881774_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881775_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881776_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881777_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367405_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ089799_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU871976_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939564_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU939569_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU939605_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386689_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787463_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
MF059652_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013998_HBx_P-C      AHLSLRGLPVCAFSSACPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598761_HBx_P-C      ANLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598766_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598767_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598768_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
KJ598769_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598770_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598771_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598772_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598773_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598774_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598775_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598776_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598777_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598779_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598780_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598756_HBx_P-C      ANLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598757_HBx_P-C      ANLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598760_HBx_P-C      ANLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598765_HBx_P-C      ANLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173318_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814905_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC814903_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814927_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814902_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774311_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX560520_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
HQ700506_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
FJ787470_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386616_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386605_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU919168_HBx_P-C      AHLSLRGLPVCAFSSADPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU570072_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU560439_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU522071_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF461358_HBx_P-C      AHLSLRGLPACAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF461359_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670311_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
AB670298_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AB300372_HBx_P-C      AHLSLRGLFVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB014388_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
D23684_HBx_P-C        AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KT284758_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670270_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939540_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
GQ377563_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939603_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLYKRTL
KC774195_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939579_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ899774_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JN418525_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KR013818_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787454_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173305_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173306_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562248_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377585_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013791_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939652_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ032332_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787468_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787469_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787471_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU916219_HBx_P-C      AHLSLRGLPVCAFSSAGPCALCFTSARR--METTVNAHQVLPKVLHKRTL
EU939615_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386671_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR014008_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR014010_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR014012_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSVRR--METTVNAHQVLPKVLHKRTL
KR014014_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR014015_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR014016_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR014017_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR014018_HBx_P-C      AHLSLRGLPVCAFSSAGPCTLRFTSARR--METTVNAHQVLPKVLHKRTL
AB367403_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774279_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB675677_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774215_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774216_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598654_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598657_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598661_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367421_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY220699_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939600_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ032333_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386665_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475308_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013827_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013865_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR014007_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KC814899_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814926_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562327_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562250_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386628_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB250109_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
HQ622095_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN418513_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774299_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JN418510_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
GQ475318_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
GQ377580_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB014383_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB014389_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013844_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METSVNAHQVLPKVLYKRTL
S75184_HBx_P-C        AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AY247031_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU306713_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY363277_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939616_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475343_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQALPKVLHKRTL
AB367402_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB670300_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
D28880_HBx_P-C        AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KR013839_HBx_P-C      THLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB112066_HBx_P-C      AHLSLRGIPVCACSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR014021_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQVLPKVLHKRTL
KR013836_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013837_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013838_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013840_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013841_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013835_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF925378_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU051424_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU051426_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNARQVLPKVLHKRTL
KU051423_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFPSARR--METTVNARQVLPKVLHKRTL
KT364721_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--KETTVNARQVLPKVLHKRTL
KJ997846_HBx_P-C      AHLPLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ803818_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ803799_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KF214668_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801490_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801515_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNARQVLPKVLHKRTL
KJ410515_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNARQVLPKVLHKRTL
JN574724_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ598727_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ598736_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ598737_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964235_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
HQ700516_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLQKRTL
GQ924650_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ997840_HBx_P-C      AHLPLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ997841_HBx_P-C      AHLPLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ924609_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ803794_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTI
GQ358154_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ349225_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ023645_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ023642_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EF594753_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVFHKRTL
AF068756_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB117758_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB074756_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB247916_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB031262_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AP011097_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNARQVLPKVLHKRTL
AB105173_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AF223957_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EF594748_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ023639_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ023640_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ023649_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ023657_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ358153_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ855525_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ855534_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQGLPKVLHKRTL
GQ924613_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ924629_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ924636_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ924649_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GU563561_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN104437_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN827416_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN827417_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN827418_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN827420_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN827421_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN827422_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN827424_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN827425_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801470_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801473_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801475_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801480_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801486_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801496_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801502_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801508_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801510_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801511_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801513_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801519_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTI
JX507214_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ803812_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148549_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KT235617_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KT307718_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KT307719_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KT364718_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KT364719_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KT364720_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KT366463_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KT987423_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNARQVLPKVLHKRTL
KT987424_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KT987425_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU051425_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU051427_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNARQVLPKVLHKRTL
DQ089804_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
DQ089778_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB205125_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089803_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ315781_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ315782_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
DQ315783_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EF594749_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EF594754_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU717214_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLYKRTL
EU872005_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLYKRTL
EU939609_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939646_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARH--METTVNAHQVLPKVLYKRTL
FJ023652_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ924612_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN827423_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674418_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTLNARQVLPKVLHKRTL
KY670782_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ023641_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ023658_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ855523_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ855548_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN418500_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801520_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801523_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MG571335_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPQVLYKRTL
MF925403_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLILPKVLHKRTL
MF674442_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674484_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765843_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765840_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765838_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765837_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MH220971_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQALPKVLHKRTL
MG826122_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MG725248_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF925394_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF925365_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674504_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674501_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674489_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674467_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674444_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674428_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQALPKVLHKRTL
MF674417_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674408_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674390_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674388_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765842_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
KX765822_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
MF925410_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF925408_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF925406_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF925377_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF925375_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674502_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674474_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674412_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674402_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARS--METTVNARQVLPKVLHKRTL
MF488703_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765851_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765850_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765848_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765846_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765844_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQILPKVLHKRTL
KX765834_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765833_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765832_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KX765831_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765826_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765825_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765821_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765818_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX276847_HBx_P-C      AXLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX276850_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLXKRTL
KX765855_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQVLPKVLHKRTL
GQ855531_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQVLPKVLHKRTL
GQ855528_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQVLPKVLHKRTL
FJ023643_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQVLPKVLHKRTL
FJ023644_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQVLPKVLHKRTL
KX765819_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQVLPKVLHKRTL
KX765847_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQVLPKVLHKRTL
KC774235_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQVLPKVLHKRTL
EU570068_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--LETTVNTRQVLPKVLHKRTL
DQ089765_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQVLPKVLHKRTL
EU554537_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQVLPKVLHKRTL
EU554538_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQVLPKVLHKRTL
EU554539_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQVLPKVLHKRTL
KC163958_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQALPKVLHKRTL
KC163959_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQALPKVLHKRTL
KJ803779_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARH--METTVNTRQVLPKVLHKRTL
KU964318_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964322_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
KU964323_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
KU964324_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
KU964332_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
KT235627_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KT235628_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB670265_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHRILPKVLYKRTL
AB113878_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386604_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787437_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB195931_HBx_P-C      AHLSLRGLPICAFSSAGPCALRFTSVRR--METTVNAHQVLPKVLHKRTL
AB195932_HBx_P-C      AHLSLRGLPICAFSSAGPCALRFTSVRR--METTVNAHQVLPKVLHKRTL
AB195930_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSVRR--METTVNAHQVLPKVLHKRTL
AB014371_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARRMGMETTVNAHQVLPKVLYKRTL
AB042282_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB111119_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB111120_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB195953_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB195954_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367407_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367804_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB014365_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814855_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939659_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939653_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ386631_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLXKRTL
FJ386652_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ040158_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939583_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ899788_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939563_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ518813_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787452_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ899771_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ986376_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386595_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ089767_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQVLPKVLHKRTL
KC163952_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQALPKVLHKRTL
KC163953_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQALPKVLHKRTL
AB670262_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY641560_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB014361_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLHKRTI
AB367416_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
AB367803_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
EU939561_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHRVLPKVLHKRTL
AB014376_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB014382_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB014385_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB014393_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB111121_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB195947_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB195948_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367399_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AB367406_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367414_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367417_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367420_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB670239_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB670240_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB670243_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367413_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
HQ700457_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
JF828908_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KC163889_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ478900_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY028303_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB042285_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AB670279_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF384364_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF384365_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVDAHQVLPKVLHKRTL
AF384366_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF384367_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ683578_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
KC774345_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774296_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475357_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSACR--METTVNAHQVLPKVLHKRTL
EU939585_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386641_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU916227_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU872002_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU872000_HBx_P-C      ANLSLRGLPICAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU872001_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU872003_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU872004_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU717215_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB300368_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQFLPKVLHKRTL
AB014360_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MEATVNAHQVLPKLLYKRTL
FJ899793_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARH--METTVNVHQVLPKVLHKRTL
FJ899794_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARH--METTVNVHQVLPKVLHKRTL
AB014363_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367431_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY206385_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939545_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939595_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939647_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386594_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386670_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787488_HBx_P-C      AHLSLRGLPACAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB697494_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHKVLPKVLHKRTL
JN418564_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
KR013870_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTMNANQVLPKVLHKRTL
KR013871_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTMNANQVLPKVLHKRTL
KR014077_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTMNANQVLPKVLHKRTL
KR014078_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTMNANQVLPKVLHKRTL
KR014079_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTMNANQVLPKVLHKRTL
KR014082_HBx_P-C      AHLSLRGLPVCAFSSTGPCALRFTSARR--METTMTANQVLPKVLHKRTL
KR014083_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTMNANQVLPKVLHKRTL
HM011495_HBx_P-C      THLSLRGLPVCAFTSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
EU939539_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ032336_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ032338_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ027318_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN418519_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN418527_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ377618_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
MF925409_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ803757_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
EF394328_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EF384201_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EF384205_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AF182804_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939599_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386596_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386687_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY363280_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB115417_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AY308741_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ788835_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU871973_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU871974_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939614_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ386614_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386645_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JF828916_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JF828919_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JN418546_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JN418556_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173319_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KU964014_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KU964216_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964218_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964221_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598721_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964242_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ924620_HBx_C-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNANLVLPKVLHKRTL
JN827414_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTLNANQVLPKVLHKRTL
JN827415_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTLNANQVLPKVLHKRTL
GQ924622_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU306690_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AF241410_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNANQVLPKVLHKRTL
EU306685_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
EU306687_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU306688_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU306689_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU306691_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN104440_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAYQVLPKVLHKRTL
AB241110_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB241111_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AP011099_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AP011101_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU410081_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF241411_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNANQVLPKVLHKRTL
AY862869_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLSKVLHKRTL
MG826135_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
AP011100_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU410080_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AJ748098_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY629631_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ803790_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTNLVLPKVLHKRTL
DQ089792_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
D23682_HBx_P-C        AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ986375_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
EU939573_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562299_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KC774306_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KJ598723_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ598729_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ598731_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ598734_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ598735_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ598738_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964229_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964231_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964232_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964233_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964240_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ855544_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQALPKVLHKRTL
DQ089783_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU410079_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB198080_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367426_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLYKRTL
AB367801_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLYKRTL
KJ173335_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNANQVLPKVLHKRTL
KJ173336_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNANQVLPKVLHKRTL
FJ562298_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
D23683_HBx_P-C        AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774211_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNANQVLPKVLHKRTL
JF828921_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
AB670246_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MEXTVNAHQVLPKVLYKRTL
AY066028_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AF411410_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLYKRTL
DQ089800_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939544_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU554535_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ922651_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
EU554536_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVSAHQVLPKVLHKRTL
FJ032340_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ032341_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KR014000_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173337_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHRVLPKVLHKRTL
KC163950_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQALPKVLHKRTL
JQ707715_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707708_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
GQ475317_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHPVLPKVLHKRTL
GQ377636_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLXNRTL
GQ377579_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ899778_HBx_P-C      AHLSLRGLPVCAFSSAGPRALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939557_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTCARR--METTVNAHQVLPKVLHKRTL
EU916234_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRLTSARR--METTVNAHQVLPKVLHKRTL
EU717212_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB014384_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KU964321_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964326_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964327_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964333_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787455_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KF214676_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ997796_HBx_P-C      AHLPLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ997801_HBx_P-C      AHLPLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ997906_HBx_P-C      AHLPLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF488701_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674425_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674458_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB111122_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB111123_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY206381_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY206382_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939536_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939582_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU939592_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ032350_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386623_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386657_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ899768_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
HM011500_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JF828913_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JF828918_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JF828920_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939571_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
GQ377572_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377624_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939625_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNVHQVLPKVLHKRTL
JN418542_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNVHQALPKVLHKRTL
AB367424_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
EU306722_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
FJ562256_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQVLPKVLHKRTL
JN418521_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
JN418524_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLYKRTL
JN418528_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLYKRTL
JN418567_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
KC163949_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQALPKVLHKRTL
KC163961_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQALPKVLHKRTF
KC163965_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQALPKVLHKRTL
AB288026_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367397_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367434_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
FJ562293_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173292_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAPQVLPKVLHKRTL
KJ173431_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173432_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ341899_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU916229_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ924633_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939588_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ386617_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ707730_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707713_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707712_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707711_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707710_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707707_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
GQ475353_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787484_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787459_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562333_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ562272_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562245_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774245_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
FJ386627_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHXVLPKVLXKRTL
JQ707733_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707716_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707717_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707718_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707719_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707720_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707721_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707722_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707723_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707724_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707725_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707726_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707727_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707728_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707729_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707731_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JQ707732_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AY251132_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLHKRTL
KC814889_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814920_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ787461_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562265_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU916233_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKALHKRTL
DQ089772_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU939594_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METPVNAHQVLPKVLHKRTL
DQ980550_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METAVNAHQVLPKVLYKRTL
AB670253_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ975273_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METAVNAHQVLPKVLYKRTL
KC814919_HBx_P-C      AHLSLRGLPVCAFSFAGPCAFCFTSARR--METTVNAHQVLPKVLHKRTM
KC774292_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTYARR--METTVNAHQVLPKVLHKRTL
KC774180_HBx_P-C      AHGSLRGLPVCPFSSAGPCALRFTSSRC--METTVNPHQVLPKVLHKRTQ
KC774227_HBx_P-C      GHLSLRGLPVCAFSFAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC774191_HBx_P-C      AHLSLRGLPVCALLSAGPCALRFTCARC--METTVNAHQVLPKVLHKRTL
EF594767_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNALQVLPKVLHKKTL
EF594763_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
JN574721_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
FJ876251_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
FJ876238_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
FJ876229_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
FJ876192_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
FJ876191_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLYKRTL
FJ876246_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
EF594766_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
EF594758_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
EF594764_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSTRC--METTVNAHQVLPKVLHKRTL
FJ876190_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNARQVLPKVLHKRTL
FJ876202_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
FJ876204_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
FJ876205_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
FJ876252_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
EF594760_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
FJ876239_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNARQVLPKVLHKRTL
KT235618_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
FJ876203_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNARQVLPKVLHKRTL
FJ876206_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNARQVLPKVLHKRTL
FJ876230_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNARQVLPKVLHKRTL
EF594768_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
EF594769_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKFLHKRTL
KR811467_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFPSARR--METTVNARQVLPKVLHKRTL
KC814901_HBx_P-C      AHLSLRGFPVCAFSSAGPCAIRFTSARC--KETTVNAHQVLPKVLHKRTI
KC774200_HBx_P-C      AHLSFRGLPVCAFTSAGPCALRFTCARC--METTVNAHQVLPKVLHKRTS
MF115871_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRLTSARC--METTVNAHQILPKVLHKRTL
MF115873_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRLTSARC--METTVNAHQILPKVLHKRTL
EU939543_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB112065_HBx_P-C      VHLSLRGLPVCAFSSAGPCALRFTTARR--METTVNARQVLPKVLHKRTL
KR811476_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHHVLPKVLYKRTL
KY881807_HBx_P-C      AHLSLRGLPVCALSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774203_HBx_P-C      AHLSLRGLPVCAFSSAGPCAFCFTSARR--METTVNAHQVLPKVLHKRTI
JN418565_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNVRQVLPKVLHKRTL
HQ700522_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMILPKVLHKRTL
HQ700543_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMILPKVLHKRTL
DQ536414_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTMNAHLVLPKVLHQRTL
DQ536413_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTMNAHLVLPKVLHQRTL
DQ536410_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTMNAHLVLPKVLHQRTL
DQ536412_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTMNAHLVLPKVLHQRTL
DQ536411_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTMNAHLVLPKVLHQRTL
HQ700495_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HQ700496_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
KJ598641_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598660_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598642_HBx_P-C      AHLSLRGLPVCTFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964015_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNAHQVLPKVLYERTL
KC774265_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTCARC--METTVNAHQVLPKVLHKRTL
KC774197_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ358157_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMILPKVLHKRTL
FJ562310_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386651_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU306672_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVSPKVLHKRTL
AB493844_HBx_P-C      AHLSLRGLPVCAFSSADPCALRFTSARR--METTVNAHMVLPKVLHKRTL
AB111113_HBx_P-C      AHLSLRGLPVCAFSSAGPCAFRFTSARR--METTVNAHQVLPKVLYKRTL
AB074047_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
KR013823_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTFARR--METTVNARQVLPKVLYKRTL
JX429914_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ904423_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNVRQVLPKVLHKRTL
FJ562307_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939584_HBx_P-C      AHLSLRGLPVCAFSSANPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ980549_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB367409_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB112408_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163996_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRLTSARR--METTVNARQVLPKVLHKRTL
KC163994_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163985_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163981_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163982_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163983_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163986_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163987_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163988_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163990_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163991_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163992_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163993_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163995_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163997_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164000_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164003_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164005_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164006_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164007_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164008_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164009_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164010_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164011_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164012_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164013_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164014_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164015_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164016_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164017_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164018_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164019_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164020_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164021_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164022_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164024_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164025_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164026_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164027_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164028_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164029_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164030_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164033_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164004_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164023_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148473_HBx_P-C      AHPSLRGLPVCAFSPAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KM875412_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ803792_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC774290_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNGHQVLPKVLHKRTL
KC774236_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNARQVLPKVLHKRTL
JX507211_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACLVLPKVLYKRTL
HQ700569_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
FJ386611_HBx_P-C      AHLSLRGLPFCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ023677_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHLTLPKVLHKRTL
EU871970_HBx_P-C      AHLSLRGLPVCAFSSVGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB493839_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLHKRTL
AB115418_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB112348_HBx_P-C      AHHDLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB049610_HBx_P-C      AHLSVRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC163998_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ899777_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ899773_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939611_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU872013_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU871980_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU871998_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU872012_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KJ598681_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598705_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598706_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598707_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598708_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598709_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598710_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598711_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598712_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598713_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598714_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598715_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598716_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598717_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598718_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598719_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB471849_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU439015_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU439016_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU881999_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU882000_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939570_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939574_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939576_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939590_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939591_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ386598_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ562239_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562242_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ562274_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562324_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562339_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
GQ377515_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470883_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562266_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377574_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598693_HBx_P-C      AHLSLRGLPVCALSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774249_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774347_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598694_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598698_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598702_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598703_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598689_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KF873528_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHLILPKVLHKRTL
KF873525_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHLILPKVLHKRTL
KF873526_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHLILPKVLHKRTL
KF873529_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHLILPKVLHKRTL
EU589336_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
MH488822_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
MH488821_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--VETTVNAHQVLPKVLYKRTL
KY881810_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881815_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470980_HBx_P-C      AHLSLRGLPVYAFTSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470981_HBx_P-C      AHLSLRGLPVYAFTSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470982_HBx_P-C      AHLSLRGLPVYAFTSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470984_HBx_P-C      AHLSLRGLPVYAFTSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470988_HBx_P-C      AHLSLRGLPVYAFTSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY363284_HBx_P-C      AHLSFRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KX765828_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963887_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963886_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963888_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963889_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963890_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963891_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963892_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963893_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963894_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KU963895_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963896_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963897_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963898_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963899_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KT284756_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR811728_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013895_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013829_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013776_HBx_P-C      AHLSLRGLPICAFSSAGPCALRFTSARR--METTVNAHQVLPEVLHKRTL
KP148472_HBx_P-C      AHLSLRGLPVCAFSSAGPCAPRFTSARR--METTVNARQVLPKVLHKRTL
KR013854_HBx_P-C      AHLSLRGLPVCAFSSAGPCAPRFTSARR--METTVNARQVLPKVLHKRTL
KJ997826_HBx_P-C      AHHSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ997829_HBx_P-C      AHHSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ997830_HBx_P-C      AHHSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ997831_HBx_P-C      AHHSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ803774_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ598748_HBx_P-C      AHLSFRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598742_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598750_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598754_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598730_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964230_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ598635_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598646_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598659_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173309_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHRVLPKVLHKRTL
KJ173310_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHRVLPKVLHKRTL
KJ173293_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173294_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173315_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC875262_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC814900_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814882_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814871_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814863_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTP
KC774329_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KC774327_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774268_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774276_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774229_HBx_P-C      GHLSLRGLPVCAFSSAGPCALRFTSASC--METPVNAPQVLPKVLHKRTL
KC774181_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC163954_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQALPKVLHKRTL
JX504541_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHLVLPKVLYKRTL
JX429912_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX429904_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX026884_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ040166_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ027322_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN418530_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JN418498_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
HQ700571_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HQ700556_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HQ700502_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HQ700475_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HQ700504_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HQ700558_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HQ700559_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HQ700561_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
GU434374_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377521_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787456_HBx_P-C      VYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386644_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386640_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHRMLPKVLYNRTL
EU939657_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939619_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTMNAHQVLPKVLYKRTL
EU916223_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU916222_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MEATVNAHQVLPKVLHKRTL
EU871982_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939604_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU570067_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRSTSARR--METTVNTRLVLPKVLHKRTL
EU547562_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU306725_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU439005_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU305540_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--TETTVNARQVLPKVLHKRTP
DQ980551_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
DQ922650_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
DQ089802_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089787_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089771_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNVRQVLPKVLYKRTL
AY028593_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
AP011107_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF473543_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AF384372_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF223956_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AF223954_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ341857_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB900113_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHTRTL
AB670274_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367411_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB300373_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MEATVNAHQVLPKVLHKRTL
AB298720_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MEATVNAHQVLPKVLYKRTL
AB298721_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MEATVNAHQVLPKVLYKRTL
AB246346_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB241112_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB241113_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB202071_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MEATVNAHQVLPKVLYKRTL
AB202072_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MEATVNAHQVLPKVLYKRTL
AB014387_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB367802_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB014369_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB014368_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB014372_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB014396_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF223958_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ855533_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU498227_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
KX276855_HBx_P-C      AXLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB368297_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
HM011472_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAQQVLPKVLYKRTL
AB195949_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARS--METTVNAHQVLPKVLHKRTL
DQ089768_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARC--METTVNARQVLPKVLHKRTL
AB367395_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
JQ040144_HBx_P-C      AHLSLRGLPVCAFSXAGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
KY363281_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
MG893558_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTMNAHQVLPKVLHKRTL
MF059688_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY882000_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881968_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881967_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881961_HBx_P-C      AHLSLRGLPVCAFSSAGPCAPRFTSARR--METTVNAHQVLPKVLHKRTL
KY881959_HBx_P-C      AHLPLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881930_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881919_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHQVLPKVLHKRTL
KY881814_HBx_P-C      AHLSLRGLPVCAFSSAGPCVLRFTSARR--METTVNAHQVLPKVLHKRTL
KY881811_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470927_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KY363257_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
KU964004_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KU964011_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KU964012_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KU964013_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KU964016_HBx_P-C      AHLSLRGLPVCAFLPAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KU964017_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KU964018_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KU964019_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KT987426_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KT284755_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KT284753_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013877_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013873_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013846_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METSVNAHQVLPKVLYKRTL
KR013786_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ803793_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ803761_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
KJ598639_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KF873520_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRITSARR--METTVNTHMILPKVLHKRTL
KF214670_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC875263_HBx_P-C      AHLSLRGLPVCAFSSAGPCAIRFTSARR--METTVNAHQVLPKVLHKRTL
KC814913_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814912_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814906_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KC814880_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METSVNAHQVLPKVLHKRTL
KC814877_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774218_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774185_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC163957_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQALPKVLHKRTL
JX504545_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--VETTVNAHQVLPKVLHKRTL
JX429918_HBx_P-C      AHLSFRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX429909_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFPSARR--METTVNAHQVLPKVLHKRTL
JQ801493_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ341883_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHQRTL
JQ040172_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ040152_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ040129_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JN104432_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ924604_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
GQ475322_HBx_P-C      ENLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475309_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
GQ377576_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377552_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377518_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ899789_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ899765_HBx_P-C      AHLSLRGLPVCAFSSAGPYALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ787445_HBx_P-C      AHLSLRGLPVCAFSSAEPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562306_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562300_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
FJ562285_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562238_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562228_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562220_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
GQ475315_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386653_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386618_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386612_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386589_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ032346_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ032331_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939610_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHQRTL
EU939554_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU916225_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--TETTVNARQVLPKVLHKRTL
EU916211_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU916212_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU916213_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU916214_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
HM750141_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU547559_HBx_P-C      THLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
EU522069_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNIHQVLPKVLYKRTL
EU439014_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHRVLPKVLHKRTL
EF536066_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ377160_HBx_P-C      AHLSLRGLPVCAFSSAGPRALRFTSARR--METTVNAHQVLPKVLHKRTL
AY641559_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHPVLPKVLYKRTL
AF411412_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
AF182805_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB900099_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB670301_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AB670266_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLYKRTL
AB367429_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ386650_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ246215_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB014379_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB074755_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
AB112471_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
AB113875_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB113876_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB113877_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670264_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB670297_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB900109_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF223959_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AF223960_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AP011106_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY167092_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
AY206386_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
DQ089756_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQALPKVLHKRTL
DQ089773_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089775_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQALPKVLYKRTL
DQ089789_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ377637_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377632_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ377586_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
GQ227697_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ227692_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ562315_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562252_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ023655_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU939648_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939580_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EF197911_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQALPKVLHKRTL
DQ089790_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
DQ478901_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KF873539_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSACR--MATTVNAHMILPKVLHKRTL
KF873541_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSACR--MATTVNAHMILPKVLHKRTL
KJ173443_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173444_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
MG893553_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
MH488839_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MEITVNAHQVLPKVLHKRTL
MG826129_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAQQVLPKVLHKRTL
MG826128_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAQQVLPKVLHKRTL
MF925359_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674430_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNDRQVLPKVLHKRTL
KY881806_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470929_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KY363260_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY022423_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KX429625_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964035_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013863_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVFHKRTL
KR013811_HBx_P-C      AHLSLRGLPVCAFSSARPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013789_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTTARR--METTVNAHQVLPKVLHKRTL
KR013763_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KP148560_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MEATVNARQVLPKVLHKRTL
KP148532_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ803777_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARH--MATTVNAHQVLPKVLYKRTL
KJ598655_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSASR--METTVNAHQVLPKVLHKRTL
KJ598637_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ410514_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--VETTVNARQVLPKVLYKRTL
KJ410508_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173286_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTMNARQVLPKVLHKRTL
KF873516_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRVTSARR--METTVNTHMILPKVLHKRTL
KC814916_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814915_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814908_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KC814897_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KC814888_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814874_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KC814866_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774335_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774333_HBx_P-C      AYLSLRGLPVCAFSAAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774316_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774194_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METSVNAHQVLPKVLHKRTL
KC163947_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC163890_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163886_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTMNARQVLPKVLHKRTL
KC163875_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163869_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPRVLHKRTL
KC163868_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163866_HBx_P-C      ANLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163865_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
JX504542_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHNRTL
JQ040162_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ027323_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTLNAHQALPKVLHKRTL
JN418539_HBx_P-C      AHLSLRGLPVCALSPAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JN418518_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHNKTL
JN418504_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JN104435_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JF828937_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JF828925_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQALPKVLHKRTL
HQ700570_HBx_P-C      AHLSLRSLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HQ700490_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HQ700456_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HM750136_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475350_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475333_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377536_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ562241_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562235_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939596_HBx_P-C      AHLSLRGLPICAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939556_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTI
EU439009_HBx_P-C      AHLSSRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU306676_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
AB697502_HBx_P-C      AHLSLRGLPVCAFSPAGPCALRFTSVRR--METTVNAHQVLPKVLYKRTL
AB300365_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB471848_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB471850_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF458664_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY206384_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ980547_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARS--METTVNAHQVLPKVLHKRTL
EU916217_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562270_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562275_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787447_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787448_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377546_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX429906_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774248_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173281_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173282_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173289_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173301_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173302_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173427_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173428_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173435_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173436_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013771_HBx_P-C      AHLSLRGLPICAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013773_HBx_P-C      AHLSLRGLPICAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013830_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013831_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013832_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013833_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013834_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013909_HBx_P-C      AHLSLRGLPICAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963937_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB014362_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METSVNAHQVLPKVLYKRTL
AB014374_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB014381_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB014392_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB014399_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB042283_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB042284_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLYKRTL
AB104892_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB111112_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB111115_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB111116_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB111117_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB111118_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB182589_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AB195936_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
AB195937_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
AB195938_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
AB195942_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB195943_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB195944_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB195945_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB195952_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB246345_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB300361_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB367392_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367394_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AB367398_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB367408_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB367418_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB367425_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB367432_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB367433_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB670241_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB670252_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB111124_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB111125_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB198077_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB246344_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB300363_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
AB931170_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB931171_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF223955_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AY167099_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AY251134_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AY251135_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AY251140_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089769_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089770_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089781_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089782_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
DQ089786_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EF688062_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU305541_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU305542_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU306671_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
EU306673_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
EU670263_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ023646_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNASQVLPKVLHKRTL
FJ023647_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ023650_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ023653_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ023656_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ386625_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ855530_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ924643_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MK321266_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAQQVLPKVLHKRTL
MG826137_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
MF925405_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF925398_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF925387_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF925374_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF925369_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
LC279276_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470937_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765849_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX276839_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KU964214_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963919_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963918_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963917_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963916_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963915_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR811760_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811747_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR014060_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
KR014055_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
KR014005_HBx_P-C      AHLSLRGLPVCAFSSAGPGALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013937_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013868_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013864_HBx_P-C      AHLSLRGLPVRAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013856_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013855_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013826_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRIL
KR013774_HBx_P-C      AHLSLRGLPICAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013772_HBx_P-C      AHLSLRGLPICAFSSAGPCALRFTSARR--TETTVNAHQVLPKVLHKRTL
KR013770_HBx_P-C      AHLSLRGLLVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148545_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVMPKVLHKRTL
KP148538_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148468_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARRVLPKVLHKRTL
KM213037_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ598752_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598751_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598749_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598743_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598740_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598687_HBx_P-C      AHLSLRGLPICAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598645_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598644_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598640_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598638_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ598636_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ410513_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNVRQVLPKVLHKRTL
KJ410501_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNVRQVLPKVLHKRTL
KJ173328_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATAVNAHQVLPKVLHKRTL
KC875269_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC774286_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KC774283_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRIL
KC164085_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC163966_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQALPKVLHKRTL
KC163964_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQALPKVLHKRTL
KC163963_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQALPKVLHKRTL
KC163962_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQALPKVLHKRTL
KC163956_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163955_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQALPKVLHKRTL
KC163948_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTRQALPKVLHKRTL
KC163874_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC163867_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JX661495_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX661491_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX661490_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX429903_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ801500_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
JQ040165_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
HQ700476_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HM011497_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPQVLYKRTL
GQ924642_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLYKRTL
FJ899769_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ023654_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU939553_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
DQ377161_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRLTSARR--METTVNAHQVLPKVLHKRTL
AY641561_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB014395_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
JX870000_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
HQ700567_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HQ700566_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HQ700565_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HQ700563_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HQ700562_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVXAHMVLPKVLHKRTL
HQ700568_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
HQ700573_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
X75665_HBx_P-C        AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHMVLPKVLHKRTL
X04615_HBx_P-C        AHLSLRGLPVCAFSSAGPCALRFTSARS--METTVNAHQVLPKVLHKRTL
MH891502_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVCPKVLHKRTL
MH488850_HBx_P-C      AHLSLRGLPVCAFSSARPCALRSTSARR--METTVNAHQVLPKVLHKRTL
MG826140_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
MG826136_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNARQVLPKVLHKRTL
MG826134_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
MG826133_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
MG826131_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
MG826127_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MG826124_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
MG571359_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAQQVLPKVLYKRTL
MG571345_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674472_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674454_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674435_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674429_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
MF674386_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNARQVLPKVLHKRTL
LC373512_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
LC373511_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
LC318703_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
LC279275_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
LC279249_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
LC279248_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
LC279247_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
LC279246_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881999_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881998_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881996_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881995_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881993_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881992_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881987_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881986_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881985_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881983_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881982_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881978_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881977_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881976_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881975_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881973_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881970_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881969_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881965_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881964_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881963_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881943_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881942_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881941_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881940_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881939_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881938_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881936_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881935_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881934_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881933_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881932_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881931_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881929_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881928_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881927_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881926_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881925_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881924_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881923_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881922_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881921_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881920_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881918_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881917_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881892_HBx_P-C      AHLSLRGLPVCAFPSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881883_HBx_P-C      AHLSLRGLPVCAFSSAGPCVLRFTSARR--METTVNAHQVLPKVLHKRTL
KY881882_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881877_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVDAHQVLPKVLHKRTL
KY881876_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881817_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881813_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881812_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
KY881805_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MGTTVNAHQVLPKVLYKRTL
KY881804_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY881803_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY629637_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470991_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNASQVLPKVLHKRTL
KY470990_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNASQVLPKVLHKRTL
KY470987_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470986_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470985_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470983_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNASQVLPKVLHKRTL
KY470936_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KY470934_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVSARQVLPKVLHNRTL
KY470933_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KY470930_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KY470926_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KY470925_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHNRTL
KY470891_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470890_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KY470887_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470885_HBx_P-C      AHLSLRGLPVCAFPSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470882_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470877_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470875_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY470874_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY363279_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY363278_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY363274_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KY363267_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRLTSARR--METTVNARQVLPKVLYKRTL
KY363254_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KX765853_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765845_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765830_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
KX765827_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765824_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765823_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX765820_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX429658_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KX276854_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KX276844_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQALPKVLHKRTL
KX276840_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
KX276838_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964360_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964331_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964330_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964329_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964328_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964325_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964320_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964319_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964198_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964197_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964196_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964195_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964194_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964193_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964188_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964187_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964186_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964185_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU964184_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METSVNAHQVLPKVLHKRTL
KU964179_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METSVNAHQVLPKVLHKRTL
KU964176_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METSVNAHQVLPKVLHKRTL
KU964064_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
KU964048_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964047_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964046_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964045_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964044_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964043_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964042_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964041_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964040_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964039_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964038_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964037_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964036_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU964034_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963914_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963913_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963912_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963911_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963910_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963909_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963908_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963907_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963906_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963905_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963904_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963903_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963902_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963901_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963900_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KU963885_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963882_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963881_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963879_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963877_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KU963874_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KT364751_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR811763_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811762_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811758_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811756_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811750_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811749_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811748_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811746_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811737_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811732_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR811459_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR014099_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR014098_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR014049_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR014048_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR014041_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR014006_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
KR013984_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013975_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013961_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013927_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
KR013904_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013903_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013885_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013876_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013875_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013872_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013866_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013858_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013857_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013851_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013850_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013845_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METSVNAHQVLPKVLYKRTL
KR013822_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
KR013817_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013814_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013813_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013810_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013809_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013808_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013807_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013805_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013803_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013802_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013798_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013797_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013787_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013785_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013784_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013783_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013782_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013781_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013780_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013779_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KR013778_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013769_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013766_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KR013765_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KP148575_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148574_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148571_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148570_HBx_P-C      AHLSLRGLPVCTFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148568_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148566_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148564_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148562_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148561_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148558_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148557_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148555_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148554_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148552_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148548_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148547_HBx_P-C      AHLSLRGPPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
KP148546_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148540_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148537_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148535_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148534_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148531_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148530_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148529_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148526_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148525_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148524_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148523_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148521_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148520_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148519_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148517_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148514_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148513_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148512_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARRVLPKVLHKRTL
KP148493_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148488_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148482_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148481_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148480_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
KP148479_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148477_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148476_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148475_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148474_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148471_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLSKVLHKRTL
KP148470_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148469_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148464_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148463_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148462_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP148315_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KP027477_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KM359441_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MKTTVNAHQVLPKVLHKRTL
KJ997816_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ997815_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFPSARR--METTVNAHQVLPKVLHKRTL
KJ997811_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ803826_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
KJ803815_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNACQVLPKVLHKRTL
KJ803814_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNACQVLPKVLHKRTL
KJ803813_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNACQVLPKVLHKRTL
KJ803811_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNACQVLPKVLHKRTL
KJ803810_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ803780_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQILPKVLYKRTL
KJ803776_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ803770_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARH--MATTVNAPQVLPKVLHKRTL
KJ803762_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ803759_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
KJ790199_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ410519_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ410510_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ410505_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ410504_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ410499_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
KJ410496_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ410495_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
KJ410494_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
KJ410492_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
KJ410491_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNACQVLPKVLHKRTL
KJ173445_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173442_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173441_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173440_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173439_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173438_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173437_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173434_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173433_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173426_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173394_HBx_P-C      ANLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173393_HBx_P-C      ANLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173392_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173391_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173334_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ173333_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KJ173332_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173314_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173313_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173312_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173311_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173308_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173307_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQFLPKVLHKRTL
KJ173304_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173296_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KJ173285_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
KF873514_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNTHMILPKVLHKRTL
KF495606_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KF485389_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KF214677_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARS--METTVNAHQVLPKVLYKRTL
KF214667_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KF214655_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METPVNAHQVLPKVLYKRTL
KF214652_HBx_P-C      AHLSLRGLPICAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC875271_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC875267_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC875264_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814925_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814923_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814914_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814911_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814894_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814893_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814892_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814887_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC814854_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774356_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774354_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC774346_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774342_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774339_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774337_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774325_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHRVLPKVLHKRTL
KC774313_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774298_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774295_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774293_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774287_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774285_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774284_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774280_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774278_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774277_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNANQVLPKVLHKRTL
KC774275_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774272_HBx_P-C      AHLSLRGLPICAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774267_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774260_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774259_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774257_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774255_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774252_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774247_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774239_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774238_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC774237_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774233_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774232_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQILPKVLHKRTL
KC774231_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774228_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC774224_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQILPKVLHKRTL
KC774220_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774213_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNATQVLPKVLHKRTL
KC774210_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774209_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774205_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774204_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774190_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774189_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774187_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774184_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC774182_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
KC164151_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164150_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164149_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164148_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164147_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164146_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164145_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164144_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164143_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164142_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164141_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164140_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164139_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164138_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164137_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164136_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164135_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164134_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164133_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164132_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164131_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164130_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164129_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164128_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164127_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164126_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164125_HBx_P-C      AHLSLRGLPVCAFSSAGPCTLRFTSARR--METTVNARQVLPKVLHKRTL
KC164124_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164123_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164122_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164121_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNASQVLPKVLHKRTL
KC164120_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
KC164118_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164117_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164116_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164115_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164114_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164113_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164112_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164111_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164110_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164109_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164108_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164107_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164106_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164105_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164104_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164103_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164102_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164101_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164100_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164089_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164088_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164087_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
KC164086_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARC--METTVNAHQVLPKVLHKRTL
JX661496_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX661492_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX661489_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX661488_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX560519_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JX504546_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX504537_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JX429915_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX429913_HBx_P-C      AHLSLRGLPICAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX429907_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JX026888_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ801522_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801521_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801518_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQALPKVLHKRTL
JQ801517_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQALPKVLHKRTL
JQ801505_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801504_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801503_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801497_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801491_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
JQ801488_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ801482_HBx_P-C      AHLSLRGLPVCAFSSAGACALRFTSARL--METTVNARQVLPKVLHKRTL
JQ801472_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
JQ707773_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQALPKVLHKRTL
JQ688404_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ341898_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ341890_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JQ341889_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAQQXLPKVLHKRTL
JQ341872_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ040163_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ040141_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ040131_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JQ040127_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARS--METTVNAHQVLPKVLHKRTL
JQ027332_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTXARH--MATTVNAHQVLPKVLYKRTL
JQ027320_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
JN418561_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JN418560_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JN418552_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN418493_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
JN400089_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
JN400088_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
JN400087_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
JN315779_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
JN104434_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
HM750140_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
HM750139_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
HM750138_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
HM750137_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
HM011489_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
HM011465_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GU721029_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GU357845_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTI
GQ872210_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475355_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475354_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
GQ475352_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475351_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475349_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ475348_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
GQ475347_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475346_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475345_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475344_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475342_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475341_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475339_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475336_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475334_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475332_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475331_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475330_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475329_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475328_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475327_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475326_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475324_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475319_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475316_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475314_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475313_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475312_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475310_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475307_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475306_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ475305_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377620_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTI
GQ377616_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377609_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377608_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
GQ377605_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377603_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377600_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377599_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377591_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377584_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377583_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377578_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377571_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377570_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377562_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQILPKVLHKRTL
GQ377559_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377557_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MXTTVNAHQVLPKVLHKRTL
GQ377554_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377551_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377545_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377541_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377531_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377530_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377524_HBx_P-C      AHLSLRGLPVCAFSSTGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ377523_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
GQ259588_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ227696_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ227695_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ227694_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
GQ227693_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ899795_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ899783_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ899776_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ899775_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ899772_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ899764_HBx_P-C      AHLSLRGLPVCAFPSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ899763_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ899761_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ787489_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787486_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787474_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787467_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787466_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787465_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787464_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787457_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787453_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787451_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787450_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787443_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ787442_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ751770_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562340_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ562337_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQXLPKVLHKRTL
FJ562335_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ562330_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562329_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562326_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ562323_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562320_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562319_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562318_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562313_HBx_P-C      AYLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQXLPKVLHKRTL
FJ562308_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562301_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562297_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562295_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562292_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562291_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562290_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562288_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562284_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562283_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562282_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562281_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562280_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562279_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562268_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562264_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562261_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562258_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562251_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562244_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562243_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ562233_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562232_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562225_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562221_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ562218_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ518810_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLHKRTL
FJ386685_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ386679_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386673_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386667_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386664_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386661_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386659_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
FJ386647_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNALQVLPKVLYKRTL
FJ386638_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386632_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
FJ386630_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386629_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386626_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386621_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLYKRTL
FJ386619_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ386613_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ386609_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386607_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386602_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386591_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ386588_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386587_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386579_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386577_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386575_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ386574_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ151413_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
FJ032356_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
FJ032355_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
FJ032351_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
FJ032347_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
FJ032345_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939658_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939656_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939655_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939654_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939651_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939649_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939645_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939644_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLYKRTL
EU939643_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939641_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939618_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939613_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939612_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939607_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939601_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939593_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939587_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939572_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939567_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
EU939566_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939562_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU939555_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939552_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939550_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939549_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939541_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSPRR--METTVNAHQVLPKVLHKRTL
EU939538_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU939537_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
EU919165_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU919164_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU916238_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU916237_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU916216_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU916215_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVSAHQVLPKVLHKRTL
EU881996_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU872008_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU871979_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METAVNAHQVLPKVLHKRTL
EU871978_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU871977_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU871975_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU796069_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU579442_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU570074_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU570073_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU562218_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU560441_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU560440_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU554542_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU554541_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU554540_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU522068_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
EU439025_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU439013_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU439012_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU439011_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU306729_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU306728_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU306727_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU306726_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU306724_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU306721_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU306720_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU306719_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EU306714_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EF536065_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
EF137803_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METAVNAHQVLPKVLHKRTL
EF137802_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METAVNAHQVLPKVLHKRTL
DQ993693_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ993692_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ993691_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ993690_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ993181_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
DQ890381_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
DQ478899_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ478885_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ377165_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ377164_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ377163_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ377162_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ089794_HBx_P-C      AHLSLRGLPVCAFTSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ089793_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
DQ089757_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
D50520_HBx_P-C        AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
D50519_HBx_P-C        AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
D50518_HBx_P-C        AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
D50517_HBx_P-C        AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
D23681_HBx_P-C        AHLSLRGLPVCAFSSAGPCALRFTSARR--METSVNAHQVLPKVLYKRTL
D12980_HBx_P-C        AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
D00630_HBx_P-C        ARLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY641563_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY641562_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY641558_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AY596108_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY311588_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AY251142_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY247032_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AY220702_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AY220701_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY220700_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY206392_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY206389_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQALPKVLHKRTL
AY206388_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AY206379_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY206378_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY206376_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY167096_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY167090_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AY028299_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AP011098_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF533983_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF461363_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF461357_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF458665_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF384371_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF363961_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AF355785_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB971715_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB971714_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB900116_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLHKRTL
AB697510_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--MATTVNAHQVLPKVLHKRTL
AB697490_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB675675_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB675674_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670310_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB670309_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670308_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB670306_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB670302_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670292_HBx_P-C      AHLSLRGIPVCAFSSAGPCALRFTSARR--METPVNAHQVLPKVLHKRTL
AB670291_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670290_HBx_P-C      ANLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AB670289_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670288_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670283_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKLLHKRTL
AB670282_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLHKRTL
AB670281_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNARQVLPKVLXKRTL
AB670272_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYKRTL
AB670263_HBx_P-C      AHLSLRGLPVCAFSSAGPCALRFTSARR--METTVNAHQVLPKVLYK