HBVdb

Dataset for protein LHBs of genotype C

[Download (right click)] [Edit] [Sequences] [Repertoires]

2639 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


DQ089795_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB115417_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGSFPEHQLDPATGANTNNPDWDFNP
EU498227_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
AY206376_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY206379_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014378_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ410492_LHBs_P-C      -MGGR--YSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ410499_LHBs_P-C      -MGGR--YSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG571359_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ717839_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ803823_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801491_LHBs_P-C      -MGGW--SSKPPQGMGANLSVPNPLGFFPDHQLDPAFGANSNNPDWDLNP
GQ924636_LHBs_P-C      -MGGW--YSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSDNPDWDLNP
JQ027318_LHBs_P-C      -MGGW--SSKPRRGMGTNLSVPNPLGFFPGHQLDPAFRANSNNPDWDFNP
KF053173_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ803766_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN827424_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JN827425_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MG826140_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
KC793046_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ089785_LHBs_P-C      -MGGW--SAKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX276841_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JN604243_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ089780_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
DQ089771_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFRANSNIPDWDFNP
KY470914_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ341626_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KF053164_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
KJ803757_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
KY363254_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
JQ027321_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDXAFRANSNNPDWDXNP
HM011495_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089803_LHBs_P-C      -MGGW--SSKPRQGMGTNLSIPNPLGFFPSHQLDPAFRANSNNPDWDFNP
DQ089762_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB112471_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
MF925403_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX276854_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KR013822_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
KJ803818_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPHPLGFFPGHQLDPAFGINSNNPDWDFNP
JN827421_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674390_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276848_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
KX276846_LHBs_P-C      -MGGP--SSKPRRGMGTNLSVPNPLGFFPGHQLDPAFXANSNXPDWDFNX
KJ410515_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173285_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GQ377605_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
FJ023648_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KR013835_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFSPGHQLDPAFGANSNNPDWDFNP
KR013836_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013839_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013838_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF674489_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013820_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ410494_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ341614_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
HM011491_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089804_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
DQ089786_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG826122_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF925395_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765823_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KR013837_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148481_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ410518_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KF214673_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPYWDFNP
KC315399_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JX870000_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JN604129_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN604121_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GQ924616_LHBs_P-C      -MGGR--YSQPRKGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AB112472_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
FJ023641_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
FJ023642_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
KR013856_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148526_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148476_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774284_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ801472_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGAYSNNPDWDFNP
JF899336_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
EF384206_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF925378_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765849_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ717791_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ410491_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC875264_LHBs_P-C      -MGSW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KC774285_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ801481_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ027317_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GQ924649_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF925394_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
MF674494_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470918_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KY470910_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765827_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765825_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX276847_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
KU051424_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KT987423_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013905_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013840_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KR013826_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013824_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013821_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KM875429_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ803779_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSENPDWDFNP
KJ410496_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ410495_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ410489_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ173324_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KF214667_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ341660_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JN604286_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
HM011472_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSHNPDWDFNP
HM011468_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPALGANSNNPDWDFNP
KX765850_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765848_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765845_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765821_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KR013902_LHBs_P-C      -MGGW--SSKPRQGMGTNRSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013770_LHBs_P-C      -MGGW--SSKPQQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KP148477_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148472_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ410504_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801501_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801497_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801495_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JN604232_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ341633_LHBs_P-C      -MGGX--XSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ341639_LHBs_P-C      -MGGX--XSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MK818227_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSHNPDWDFNP
MG571335_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765852_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX765842_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KR013899_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013819_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013817_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KM875428_LHBs_P-C      -MGGR--TSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KM875406_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ410519_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ173323_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF214670_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF053185_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KC875270_LHBs_P-C      -MGGW--SSKPRQGMGTNISVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KC774227_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774221_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG826123_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MG725248_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MG571332_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF925408_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674502_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674501_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674484_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674472_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674468_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674454_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674442_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674435_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674412_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674402_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674398_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674388_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674386_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KY470916_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
KX774503_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
KX765844_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765836_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765830_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANQNNPDWDFNP
KX765819_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX276851_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KU051423_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KR013857_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KR013854_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KM875404_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ803799_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
KJ803793_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ803761_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ803759_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ717810_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
KJ717803_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ410513_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ410501_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ410493_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KF053169_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KF053167_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KC774236_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX507212_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801522_LHBs_P-C      -MGGW--SSKPQQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ801519_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801513_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801511_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801505_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801475_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ688403_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ341663_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ027324_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JN604256_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN604182_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM011497_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MH220971_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF925374_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF925359_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674463_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF674418_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KM875424_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792927_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ801502_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801498_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
JQ341652_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM011488_LHBs_P-C      -MGGX--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF925410_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF925376_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF925375_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF674486_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF674471_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF674457_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF674429_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF674428_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
MF674417_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF674408_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674399_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX765824_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANLNNPDWDFNP
KX765822_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KT347089_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF053176_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ341669_LHBs_P-C      -MGGX--SSKPRQGMGTNLSVPNPLGFFPXHQLDPAFGANSNNPDWDFNP
JQ341621_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ341657_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNP
JQ341649_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG571345_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AB112348_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRAHSNSPDWDFNP
AB112065_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPYHQLDPAFRANSNNPYWDFNP
KF053187_LHBs_P-C      -MGGW--SSKPTKGMGTNLSVPIPLGFFHGHHLDPSFGPISNNPDWDFNP
KJ803780_LHBs_P-C      -MGGW--SSKPTKGMGTNLSVPIPLGFFHGHHLDPSFGPISNNPDWDFNP
AB112066_LHBs_P-C      -MGGW--SSNPRKGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
MF925409_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
KR013823_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
JQ341620_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFGDHQLDPTFRANSNNPDWDLNP
MF925398_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KF214671_LHBs_P-C      -MGGW--TCKPRQGMGTNLSFPNPLGFFPDHQLDPAFRANSNNPDWDFNP
EU305540_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
DQ089790_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDLNP
JQ801493_LHBs_P-C      -MGGW--SSKPPQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ027320_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFRANSNNPDWDFNP
FJ023645_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF674444_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148567_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148492_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ803812_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFRANSNNPDWDFNP
KJ717825_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFRANSNNPDWDFNP
KY470915_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNLDWDFNP
KY470913_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KR014021_LHBs_P-C      -MGGW--SSKPRQGMGTNLPVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148563_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148474_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ803813_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ717826_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ410511_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
KC875272_LHBs_P-C      -MGGW--SSKPRQGMGTNISVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KC875267_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ341622_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN827420_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
HM011486_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDLNP
KT364719_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDLNP
KC774189_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDLAFRANSNNPDWDFNP
JQ341650_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNSDWDFNP
JQ341624_LHBs_P-C      -MGGW--SSKPRXGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
KT366464_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFRANSNNPDWDFNP
MF674514_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
MF674504_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
MF674467_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFRANSNNPDWDFNP
MF674458_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDLNP
MF674430_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPTFRANSNNPDWDFNP
MF674425_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDLNP
KX765834_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFRANSNNPDWDFNP
KP148575_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDLAFGANSNNPDWDFNP
KP148566_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148560_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148559_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148557_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148546_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148532_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148524_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148521_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148513_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPSPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148512_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148489_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148475_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148466_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148465_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148464_LHBs_P-C      -KGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPALGANSNNPDWDFNP
KP148463_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148315_LHBs_P-C      -KGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPALGANSNNPDWDFNP
JX504535_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
JQ801488_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ341661_LHBs_P-C      -MGGW--SSKPRKGMGTNLAVPNPLGFFPDHQLDLAFRANSNNPDWDFNP
JQ341642_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
MF674475_LHBs_P-C      -MGGW--SSKPRTGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KY629637_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
KP148534_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148531_LHBs_P-C      -MRGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148525_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ173286_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
JX507214_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNQDWDFNP
JQ801515_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148548_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148537_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLNPAFGANSNNPDWDFNP
KJ410514_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ341630_LHBs_P-C      -MGGP--XSKPRKGMGTNLAVPNPLGFFPDHQLDLAFRANSDNPDWDFNP
MF925377_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNT
MF674474_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KR013900_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
KR013825_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
KP148574_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148573_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148572_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148571_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148570_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148568_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148564_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148562_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148561_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148558_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148555_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148554_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148552_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148551_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148549_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148547_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148545_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148543_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148540_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148538_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148535_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148530_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148529_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148528_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148523_LHBs_P-C      -MGGW--SSKPRQGVGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148520_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148519_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148517_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148514_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148488_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148482_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148480_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148479_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KP148471_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148469_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148468_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148462_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KM875405_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPHPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ173438_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
KJ173437_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
KC875274_LHBs_P-C      -MGGW--SSKPRQGMGTNISVPNPLGFFPGHQLDPAFGANSNNPDWDINP
JQ341664_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
JQ341655_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ341654_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ341653_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
JQ341644_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ341637_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765847_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFRANSNNPDWDFNP
KX276840_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPXHQLDPAFGANSNNPDWDFNP
KR013855_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148473_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KF053193_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFRANSNNPDWDFNP
JX507211_LHBs_P-C      -MGGW--SSKPRQGMGTNLAVPNPLGFFPDHQLDLAFRANSNNPDWDFNP
JQ341617_LHBs_P-C      -MGGW--SSKPRXGMGTNLSVPNPLGFFPXHQLDPAFGANSNNPDWDFNP
JN604118_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDLAFXANSNNPDWDFNP
JQ341618_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFXANSNNPDWDFNP
KX276853_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDLNP
JQ341641_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
MF674403_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFRANSNNPDWDFNP
KX765853_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
KX765826_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
KX276852_LHBs_P-C      -XGGW--SSKPRKGMGTNLSVPNPLGFFGDHQLDLXFRANSNNPDWDFNP
KJ717809_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
JQ801518_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFRANSNNPDWDFNP
JQ801490_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
JQ341659_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPXHQLDPAFGANSNNPDWDFNP
JQ341651_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
JQ801482_LHBs_P-C      -MGGW--SSKPRRGMGTNLAVPNPLGFFPDHQLDPAFRANSNNPDWDLNP
JQ341628_LHBs_P-C      -MGGW--SSKPRXGMGTNLAVPNPLGFFPXHQLDPAFRANSNNPDWDXNP
JQ341631_LHBs_P-C      -MGGW--SSKPRKGMGTNLXVPNPLGFFPDHQLDLAFRANSNNPDWDFNP
KJ803792_LHBs_P-C      -------MCKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765828_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KT364720_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MG826143_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
KY470936_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KY470920_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KY470917_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KY470909_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KY470907_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX774504_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765843_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KF214676_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KF214668_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KC875273_LHBs_P-C      -MGGW--STKPRQGMGTNISVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KC875269_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801523_LHBs_P-C      -MGRR--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801504_LHBs_P-C      -MGGW--YSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801503_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801470_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JN604153_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KY470912_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KY470906_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765855_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX276844_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSBNPDWDFNP
MF925406_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF925405_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF925387_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765851_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765846_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765840_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765838_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765837_LHBs_P-C      -MGGW--SSKPRHGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765833_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765832_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765831_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765829_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765820_LHBs_P-C      -MGGC--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765818_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KU051425_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KT987424_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KT366463_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KT364721_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ803815_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ803811_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ803800_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ717828_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ717823_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ717812_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ717811_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KC875271_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KC875265_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KC774228_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801520_LHBs_P-C      -MGGW--SSKPRHGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801500_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801496_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801486_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ801473_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JN827422_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JN604151_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KT364718_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KT987426_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KT987425_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KT307718_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KT307719_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KU051426_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KU051427_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF925367_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF925365_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX276850_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPXHQLDPAFXANSNNPDWDFNP
KX774506_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ341635_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KF053177_LHBs_P-C      -MGGP--SSKPRRGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ803770_LHBs_P-C      -MGGP--SSKPRRGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN604135_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KF053168_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ803760_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089767_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNSPDWDFNP
DQ089768_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KF053161_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ803754_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ717844_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ803826_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF053183_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ803776_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ478901_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPVFGANSNNPDWDFNP
DQ089773_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB117758_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148483_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KP148491_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GQ924643_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089778_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089775_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNXPDWDFNP
AB031262_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
EU305541_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089788_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDLNP
JN827423_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KR013841_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLRFFPGHQLDPAFGANSNNPDWDFNP
GQ184326_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
EF494379_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ089783_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPTFGANSNNPDWDFNP
AF223960_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GQ924612_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GQ924613_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JN827418_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JN604147_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GQ924650_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GQ924614_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
EU306691_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFSP
EU306689_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
EU306688_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
EU306685_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
EU306687_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
EU306690_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
EU306694_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ246215_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ089777_LHBs_P-C      -MGGW--SAKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ089776_LHBs_P-C      -MGGW--SAKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ089772_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089770_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089763_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AY862869_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AF473543_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDSNP
AF223958_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
FJ023643_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
FJ023644_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
FJ023654_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
FJ349225_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GQ358154_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AB074756_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AB247916_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AB300363_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AF068756_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
FJ023647_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
FJ023649_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
FJ023657_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
FJ023658_LHBs_P-C      -MGGW--SSKPRQGMGTNLSIPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GQ924604_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GQ924629_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GU563561_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JN827417_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JN827416_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GQ924609_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
EF384200_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ089760_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EF688062_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562337_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB246346_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ089764_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ089761_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089791_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AB205125_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GQ924655_LHBs_P-C      -MGGW--SSKPRQGMGTNFSVPNPVGFFPGHQLDPAFGANSNNPDWDFNP
JQ341611_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
FJ023639_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089784_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AB074755_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AB105173_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AF223954_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AF223955_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AF223957_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AF223961_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AP011097_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089765_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089769_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089779_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089781_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089782_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ341616_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ341615_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ341613_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ027333_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ040133_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JN604144_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GQ924615_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GQ377536_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
FJ023653_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089792_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
FJ023650_LHBs_P-C      -MGGW--SAKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
DQ089766_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANTNNPDWDFNP
GQ924642_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
HQ700516_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
AB014380_LHBs_P-C      -MGGP--SSKPRRGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792831_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNP
DQ089758_LHBs_P-C      -MGGW--SSKPRKGMGTNLAVPNPLGFFPDHQLDLAFRANTNNPDWDFNP
MG826129_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPEHQLDPAFRANSNNPDWDFNP
MG826138_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPRHQLDPAFGANSNNPDWDFNP
MG826136_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG826131_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276855_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANXNNPDWDFNP
MG826137_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNP
MG826134_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNP
MG826135_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNP
AP011106_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNP
MG826133_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNP
AP011107_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNP
AB670253_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ032336_LHBs_P-C      -MGGP--SSKPRRGMGTNLAVPNPLGFFPDHQLDLAFRANSNNPDWDFNP
FJ032338_LHBs_P-C      -MGGP--SSKPRRGMGTNLAVPNPLGFFPDHQLDLAFRANSNNPDWDFNP
FJ032339_LHBs_P-C      -MGGP--SSKPRRGMGTNLAVPNPLGFFPDHQLDLAFRANSNNPDWDFNP
DQ089789_LHBs_P-C      -MGGP--SSKPRRGMGTNLAVPNPLGFFPDHQLDLAFRANSNNPDWDFNP
DQ089757_LHBs_P-C      -MGGX--SSKPRXGMGTNLSVPNPLGFFPDHQLDLAFRANSNNPDWDFNP
FJ023646_LHBs_P-C      -MGGW--SSKPRXGMGTNLXVPNPLGFFPDHQLDLAFRANSNNPDWDFNP
FJ023656_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
MG826139_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPRHQLDPAFGANSNNPDWDFNP
AB367411_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX661497_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939609_LHBs_P-C      -MGGP--SSKPRRGMGTNLAVPNPLGFFPDHQLDLAFRANSNNPHWDFNP
DQ089796_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KC793142_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700529_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
FJ562340_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013866_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377636_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562239_LHBs_P-C      -MGGW--SSKPRHGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU522068_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014399_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964243_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964238_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964236_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598726_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598720_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598662_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750141_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750131_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562304_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562276_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014389_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014374_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787458_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964173_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792853_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792691_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDLAFRANSNNPDWDFNP
KC792672_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ899769_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939616_LHBs_P-C      -MGGW--SSKPRRGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
EU560438_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY206392_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173432_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173431_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173334_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792682_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774313_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774245_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX026880_LHBs_P-C      -MGDW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN604258_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ622095_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM011500_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDLAFRANSNNPDWDFNP
GU357845_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787457_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670249_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013943_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013791_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013780_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598670_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793108_LHBs_P-C      -MGGW--SAKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774353_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774244_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774203_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040161_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562273_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093903_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040139_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLBPAFGANSNNPDWDFNP
KY881809_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792790_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774356_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040145_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF436920_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPALGANSNNPDWDFNP
KR014043_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013858_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013852_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013794_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013786_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598687_LHBs_P-C      -MGGQ--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173442_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173312_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173311_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173303_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173295_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173292_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173291_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792669_LHBs_P-C      -MGGW--SSKPRXGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774334_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774304_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX661493_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX429903_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040165_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040163_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040152_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040144_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040131_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN604246_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN604140_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750140_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750139_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750135_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750134_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750132_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM011493_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GU434374_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ924633_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014369_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013831_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013781_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013779_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173396_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774210_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX504536_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX504534_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040168_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040149_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM011489_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KT284755_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KT284753_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013798_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013797_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013784_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013783_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013782_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KM213037_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173395_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793187_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793039_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774326_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774310_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774295_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774279_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774275_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774259_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774257_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774252_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774232_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774223_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774180_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX429905_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX026878_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475356_LHBs_P-C      -MGGX--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM011465_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF053181_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ803774_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KF873516_LHBs_P-C      -MGGW--TSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679951_LHBs_P-C      -MGGW--XSXPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873526_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873528_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873529_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679947_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679957_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873514_LHBs_P-C      -MGGW--TSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873520_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679936_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873541_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679937_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGVFPDHQLDPAFGANSNNPDWDFNP
KF873539_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873536_LHBs_P-C      -MGGX--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679960_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB493839_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
AB112063_LHBs_P-C      -MGPW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ032345_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU554541_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU554542_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB111946_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276992_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367435_LHBs_P-C      -MGGS--TSKPRHGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB105174_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881883_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475351_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB365451_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881962_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881990_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881884_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881960_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881872_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY363281_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881991_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNLLGFFPDHQLDPAFGANSNNPDWDFNP
KY881886_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881987_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY363275_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276959_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562251_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881882_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881997_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939654_LHBs_P-C      -MGGW--YSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
D00630_LHBs_P-C        -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670241_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014381_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY882003_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881994_LHBs_P-C      -MGGW--SSKPRQGMGTNLFVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881989_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881981_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881892_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881887_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANPNNPDWDFNP
KY881880_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGAKSNNPDWDFNP
KY881871_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY363260_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386605_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881978_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881875_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY363274_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670301_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG893553_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881984_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881983_LHBs_P-C      -MGGW--SSKPRQGMGTNLSAPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881975_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881974_LHBs_P-C      -KGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881973_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881940_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881925_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881916_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881915_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470973_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470966_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470927_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470904_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470880_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470877_LHBs_P-C      -MGGW--SSKPRQGMGTDLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY363282_LHBs_P-C      -MGGY--STKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY363264_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276985_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276968_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964343_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPNHQLDPAFGANSNNPDWDFNP
MG826125_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279275_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY882001_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881993_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881980_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881979_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881971_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881966_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881891_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881889_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881885_LHBs_P-C      -MGGW--SSKPRQGMGMNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881881_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881879_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881878_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881877_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881874_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881870_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470974_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470969_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470965_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470903_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276981_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFTP
KU964341_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG893557_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881817_LHBs_P-C      -MGGW--SSKPRQGTGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWGFNP
KY470881_LHBs_P-C      -TGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964364_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
X04615_LHBs_P-C        -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MH891502_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MH887433_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG893560_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG826124_LHBs_P-C      -MGGS--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC318703_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279276_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279251_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY882000_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881999_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881998_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881996_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881995_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881992_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881986_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881985_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881982_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881977_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881976_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881972_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881967_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881965_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881963_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881959_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881943_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881942_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881939_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881938_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881937_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881936_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881935_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881934_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881933_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881932_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881931_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881930_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881929_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881928_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881927_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881926_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881924_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881923_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881922_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881921_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881920_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881919_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881917_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881777_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881776_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881775_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881774_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881773_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881772_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881771_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881770_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881769_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881768_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881767_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881766_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881765_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881764_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881763_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881762_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881758_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881755_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881754_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881751_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881750_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881749_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881748_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881744_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881743_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881742_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881739_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881738_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881737_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881736_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470977_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470975_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470968_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470905_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470902_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470901_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470900_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470897_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470896_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470890_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470888_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470887_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470886_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470884_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470882_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470878_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470876_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470874_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY363279_LHBs_P-C      -RGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276976_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276960_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964348_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964347_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964346_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964345_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964344_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964342_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964340_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964339_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964338_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964337_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964336_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964334_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964225_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964184_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964179_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964174_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964176_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964178_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964181_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964183_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
V00867_LHBs_P-C        -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MH094411_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWRFIP
LC318702_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279274_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279249_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279248_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279247_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279245_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881988_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881961_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881812_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881802_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470979_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNHLGFFPDHQLDPAFGANSNNPDWDFNP
KY022423_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964182_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG893558_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279262_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279261_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPDPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279260_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279258_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279257_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279256_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279255_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279252_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279246_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470978_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470976_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470972_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470971_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470970_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGDNSNNPDWDFNP
KY470967_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470934_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470933_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470926_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470925_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276973_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276835_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964228_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964227_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964224_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964223_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964222_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MK321266_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC373512_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC373511_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY363284_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276836_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964221_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964358_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964349_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964363_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
D23682_LHBs_P-C        -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
D23683_LHBs_P-C        -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ717799_LHBs_P-C      -MGGY--SSQPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KJ803790_LHBs_P-C      -MGGY--SSQPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
FJ787442_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787443_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939568_LHBs_P-C      -MGGX--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093900_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367402_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB113875_LHBs_P-C      -MGGW--FSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
AB113876_LHBs_P-C      -MGGW--FSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
EU939579_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ899774_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDLNP
KU964323_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964326_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964327_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964333_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964329_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GU721029_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDLAFRANSNIPDWDFNP
AB014392_LHBs_P-C      -MGGW--SSKPRRGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNP
EU939539_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470980_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNSDWDFNP
KY470981_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNSDWDFNP
KY470982_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNSDWDFNP
KY470983_LHBs_P-C      -MGGW--SSKPRKGMGSNLSVPNPLGFFPDHQLDPAFGANSNNSDWDFNP
KY470984_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNSDWDFNP
KY470985_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNSDWDFNP
KY470986_LHBs_P-C      -MGGW--SSKPRKGMGSNLSVPNPLGFFPDHQLDPAFGANSNNSDWDFNP
KY470987_LHBs_P-C      -MGGW--SSKPRKGMGSNLSVPNPLGFFPDHQLDPAFGANSNNSDWDFNP
KY470988_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNSDWDFNP
KY470990_LHBs_P-C      -MGGW--SSKPRKGMGSNLSVPNPLGFFPDHQLDPAFGANSNNSDWDFNP
KY470991_LHBs_P-C      -MGGW--SSKPRKGMGSNLSVPNPLGFFPDHQLDPAFGANSNNSDWDFNP
EU939653_LHBs_P-C      -MGGR--YSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367406_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715404_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367392_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787449_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386631_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787453_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787454_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY066028_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB198082_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386652_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377601_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF411408_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF411411_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU796070_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU796072_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ899764_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377533_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY247032_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB642097_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB300368_LHBs_P-C      -MGGW--SSKPRQGMGTNLAVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670265_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670300_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367431_LHBs_P-C      -MGGR--TSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367407_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195942_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB182589_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195943_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195944_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670243_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367394_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367398_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367403_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670251_LHBs_P-C      -MGGP--YTKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367412_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB362932_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367804_LHBs_P-C      -MGGW--SSKPHQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367432_LHBs_P-C      -MGGW--SSKPQQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195949_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB198077_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB198078_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB202071_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB205124_LHBs_P-C      -MGGW--SSKPRQGMGTNPSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB222714_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670247_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB642095_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB640730_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB471853_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB471852_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB471851_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367422_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367414_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB300365_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB222715_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDXDFNP
AB300359_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828921_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828918_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828920_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828913_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828915_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828917_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828924_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828925_LHBs_P-C      -MGGW--SSKPRIGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828926_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828929_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828930_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715379_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562269_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ717833_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
GQ924620_LHBs_C-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
JQ341632_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KR014078_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KR013870_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KR014077_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KR014083_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KR013871_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KR014082_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
AF241410_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
AB241111_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
JN827414_LHBs_P-C      -MGGY--SAKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
EU410079_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
AF241411_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
JN827415_LHBs_P-C      -MGGY--SAKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
AB241110_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
AP011099_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
AP011100_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
AP011101_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
EU410080_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
EU410081_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
JN604226_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
GQ924622_LHBs_P-C      -MGGY--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
AB367395_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367396_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367424_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562250_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715377_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715378_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715380_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787470_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNSPDWDFNP
FJ787471_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNSPDWDFNP
FJ715374_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715375_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715376_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715389_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939586_LHBs_P-C      -MGGW--SSKPRQGMETNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367420_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828916_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828919_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367416_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367803_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU560440_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU579442_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562243_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU872000_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGATSNNPDWDFNP
EU570072_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093902_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPTFGANSNNPDWDFNP
AB367434_LHBs_P-C      -MGGY--STKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367399_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
AB367397_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014393_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
EU939542_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ899767_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB042282_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
AB042283_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KR013868_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQSDPAFGANSNNPDWDFNP
FJ032334_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939594_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939567_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939564_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU589336_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195937_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195938_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014367_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014384_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670239_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670240_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774358_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ899770_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANLNNPDWDFNP
EU939536_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU554537_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
EU439015_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU306674_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLGPAFGANSNNPDWDFNP
EU306673_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLGPAFGANSNNPDWDFNP
AB670302_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670273_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670270_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670262_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB288026_LHBs_P-C      -MGGW--SSKPRQGXGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014362_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386685_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB298720_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB298721_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU075336_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB111121_LHBs_P-C      -MGVW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014376_LHBs_P-C      -MGGW--SFKPRRGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014394_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB111122_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB111123_LHBs_P-C      -MGGR--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013842_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013844_LHBs_P-C      -MGGW--SSKLRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013848_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013849_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB642099_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU872001_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU872003_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU872004_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU872002_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU916223_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF363961_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU916224_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939619_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377615_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377571_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377562_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562306_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562265_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562249_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386597_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386588_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939543_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670264_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367404_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB299858_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB426467_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB198076_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562307_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377632_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195936_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB642100_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB900116_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB049610_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB033551_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB033550_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670272_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB026815_LHBs_P-C      -MGGW--SSKPRHGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB300360_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB026811_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB026812_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB026813_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB026814_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014371_LHBs_P-C      -MGGW--SSKPRHGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014363_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013861_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013860_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
D50520_LHBs_P-C        -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB033552_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB033553_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB033556_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ089799_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562258_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562272_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562281_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB042284_LHBs_P-C      -MGGQ--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195947_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195952_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB198079_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB198080_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB198081_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB198083_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB300361_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367423_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB471848_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB471849_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB471850_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386596_LHBs_P-C      -MGGY--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386687_LHBs_P-C      -MGGY--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013859_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377580_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ899777_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939544_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU916237_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871978_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU570068_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU570067_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU554539_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
EU306675_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
D50519_LHBs_P-C        -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014383_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787439_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787479_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB113878_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195930_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195931_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195932_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475325_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367410_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939587_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939600_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939614_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475316_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475327_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475334_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KT284758_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040151_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MH818373_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881964_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQVDPAFGANSNNPDWDFNP
JQ040132_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774299_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787468_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFEANSNNPDWDFNP
FJ787469_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFEANSNNPDWDFNP
FJ386579_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787445_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939605_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ975272_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ478899_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB111120_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB050018_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU554538_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871980_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871998_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU916238_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939578_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562280_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377523_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377538_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU554536_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377603_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377593_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787441_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014396_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195953_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195954_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB246345_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377518_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ899771_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939563_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386659_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB205123_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB111114_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY363258_LHBs_P-C      -MGGQ--YSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774179_LHBs_P-C      -MGGW--SPTPRQGKGTNLSVPNPLGFFPDHQLDRAFGANSNNPDWDFNP
KC774297_LHBs_P-C      -MGGW--SSKPRQGKGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276980_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWNFNP
KC774269_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG826128_LHBs_P-C      -MGGW--TSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNP
KX276993_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013827_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KC792995_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM011479_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276837_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750136_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774211_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774256_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774277_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774335_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX036326_LHBs_P-C      -MGGW--SSKPRQGTGTNLSVPNPLGFFPDHQLDPAFGANSNSPDWDFNP
JX036327_LHBs_P-C      -MGGW--SSKPRRGTGTNLSVPNPLGFFPDHQLDPAFGANSNSPDWDFNP
KU964016_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964015_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964019_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY363252_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964011_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ410510_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPPFGANSNNPDWDFNP
FJ562221_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276991_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793119_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792902_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774296_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774214_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX026877_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY057947_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHHLDPAFGANSNNPDWDFNP
X52939_LHBs_P-C        -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792710_LHBs_P-C      -MGGW--SSKPRXGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792700_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774213_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU916225_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964017_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964013_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013874_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF214655_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793040_LHBs_P-C      -MGGW--SSKPRHGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774306_LHBs_P-C      -MGGS--YSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774281_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFLPGHQLDPAFGANSNNPDWDFNP
KC774217_LHBs_P-C      -MGGW--SSKPRQRMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939571_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU796069_LHBs_P-C      -MGGW--SSKPRQGMETNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377591_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377572_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY247031_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562282_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964330_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964325_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013882_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANPNNPDWDFNP
KR013846_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173335_LHBs_P-C      -MGGY--SSQPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KC875261_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774325_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774253_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX560520_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ089797_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670237_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964214_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964175_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964018_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KT364751_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR014010_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013815_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDSNP
KC875263_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793129_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFAANSNNPDWDFNP
KC792775_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774340_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774204_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX125372_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ341634_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU075315_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG826127_LHBs_P-C      -MRRR--TSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG826126_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964014_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964012_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964004_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KR819180_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KM359441_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSHNPDWDFNP
KJ598642_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793107_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793051_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792817_LHBs_P-C      -MGGW--SSKPRKGMGTNLAVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774191_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX504541_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX429914_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377624_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ259588_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ899765_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562323_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881970_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881876_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881815_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPEWDFNP
KY470879_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276979_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964332_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964331_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964328_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964324_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964322_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964321_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964320_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964319_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964318_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964213_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964212_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964211_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964210_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964209_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964208_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964207_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964206_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964204_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964201_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964171_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KT364752_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KT284757_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013876_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013799_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013776_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013767_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013766_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDLNP
KJ598769_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598768_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598659_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173328_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173327_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173305_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793201_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793019_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792759_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792746_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFXANSXNPDWDFNP
KC774346_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774330_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774319_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774303_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774300_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774280_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774242_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774231_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774225_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774208_LHBs_P-C      -MGSW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774207_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX560519_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX504542_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386647_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386627_LHBs_P-C      -MGGW--FSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC090200_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSHNPDWDFNP
KY881890_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470885_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470875_LHBs_P-C      -MGGW--SSKPRQGMGTNLSGPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470873_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964172_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR014011_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013809_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013795_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598713_LHBs_P-C      -MGGR--FSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598712_LHBs_P-C      -MGGR--FSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598709_LHBs_P-C      -MGGR--FSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598660_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPMGFFPDHQLDPAFGANSNNPDWDFNP
KJ598641_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPMGFFPDHQLDPAFGANSNNPDWDFNP
KJ173332_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173331_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC875262_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793202_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793123_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793050_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792834_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792799_LHBs_P-C      -MGGW--SSKPRQGMGTXLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774288_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774274_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774267_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX661491_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881969_LHBs_P-C      -MRGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470892_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470889_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY363287_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPGWDFNP
KY363253_LHBs_P-C      -MGGR--YSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276964_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276838_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964177_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964077_LHBs_P-C      -MRGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013877_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013875_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013872_LHBs_P-C      -MAGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF485390_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793100_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793097_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792857_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792740_LHBs_P-C      -MGGR--SSQPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774301_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774254_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX429913_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ341670_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279253_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276984_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964215_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964205_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964203_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964202_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964170_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964053_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964052_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964051_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964050_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964049_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KT284754_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR014015_LHBs_P-C      -MGGP--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013814_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013813_LHBs_P-C      -MGGW--SSKPRQGMGANLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013808_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013801_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013800_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013796_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013792_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013777_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013765_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013764_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013763_LHBs_P-C      -MGGW--SPKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013762_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KM229703_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ803762_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598753_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNLDWDFNP
KJ598716_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598710_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598703_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598686_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598681_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598679_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598661_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598639_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598636_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598635_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ410521_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173446_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173317_LHBs_P-C      -MGGW--SSKPRQGVGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173315_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173314_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173313_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF053170_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793110_LHBs_P-C      -MGGW--SSKPRRGMGTNLAVPNPLGFFPDHQLDLAFRANSNNPDWDFNP
KC792926_LHBs_P-C      -MGGR--TSXPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792792_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792680_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792658_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
KC774360_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774359_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774355_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774354_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774351_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774348_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774347_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774333_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774321_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774320_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774311_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
KC774298_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774282_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774278_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774276_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774271_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774270_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774268_LHBs_P-C      -MGGW--LSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774224_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774218_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774199_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX429916_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX125375_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX125374_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX125370_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX125366_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ341658_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279254_LHBs_P-C      -MGGW--SSKPRQGMETNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276839_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964039_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963929_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963928_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963927_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963926_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963925_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963924_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963923_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963922_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963921_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963920_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963919_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963918_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963917_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963916_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963915_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013834_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013773_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWGFNP
KJ598744_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KJ598719_LHBs_P-C      -MGGR--FSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598718_LHBs_P-C      -MGGR--FSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598717_LHBs_P-C      -MGGR--FSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598715_LHBs_P-C      -MGGR--FSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598714_LHBs_P-C      -MGGR--FSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598711_LHBs_P-C      -MGGR--FSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598708_LHBs_P-C      -MGGR--FSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598707_LHBs_P-C      -MGGR--FSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598705_LHBs_P-C      -MGGR--FSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ410508_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173444_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KJ173443_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KJ173282_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173281_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793003_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792961_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792911_LHBs_P-C      -MGGW--SSKPRKGMGTNLAVPNPLGFFPDHQLDLAFXANSNNPDWDFNP
KC792771_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774205_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774182_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX125371_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX125365_LHBs_P-C      -MGGR--FCKPRQGMGTNLSVSNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279259_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013833_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013802_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013793_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF485389_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793024_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792968_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792923_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792862_LHBs_P-C      -MGGW--SSKPRXGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792708_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774283_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279250_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470930_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFSP
KY470929_LHBs_P-C      -MGGW--SSKPRQGMGTNPSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY363286_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964220_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964218_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964217_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964216_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964200_LHBs_P-C      -MGGW--PSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964048_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964047_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964046_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964045_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964044_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964043_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964041_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964040_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964038_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964037_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964036_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964035_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964034_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964002_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963997_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963996_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963992_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KT284756_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR014012_LHBs_P-C      -MGGP--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013873_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013832_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013830_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013829_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013828_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013812_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013811_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013810_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013807_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPSPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013774_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013772_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013771_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013768_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013761_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KP784761_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KP027477_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ803765_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ790199_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598754_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598752_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598751_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598749_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598748_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598747_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598746_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598745_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598743_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598742_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598741_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598740_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598702_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598698_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598693_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598689_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598680_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173434_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173433_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173430_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173429_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173428_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173427_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173426_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173394_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173393_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173392_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173391_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173316_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173308_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173307_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173306_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173304_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173296_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173294_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173293_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173288_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF779242_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF053172_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793103_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793035_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792999_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792965_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792962_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792941_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792940_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792921_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792803_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792776_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792704_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792695_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792690_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792679_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792655_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774352_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774345_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774342_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774338_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774337_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774336_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774331_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774329_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774327_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774318_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774316_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774315_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774314_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774312_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774292_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774287_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774286_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774272_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774264_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774262_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774261_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774249_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774243_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774241_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774240_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774237_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774229_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774226_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774209_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774206_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774202_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774200_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774197_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774196_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774192_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774190_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774187_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX661495_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX661492_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX504545_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX504544_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX429918_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX429917_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX429912_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX429909_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX429906_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX125373_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX026888_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX026884_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ688404_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ341665_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ341648_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598706_LHBs_P-C      -MGGR--FSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793074_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792873_LHBs_P-C      -MGGX--XSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792716_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ341643_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ341610_LHBs_P-C      -XGXW--XSXXXQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964226_LHBs_P-C      -XXXX--XXXPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964054_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964055_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964056_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964057_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964058_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964059_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964060_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964061_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964062_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964063_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787448_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939655_LHBs_P-C      -MGGR--TSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939656_LHBs_P-C      -MGGR--TSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093896_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU670263_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDLAFRANSNNPDWDFNP
EF536066_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF053184_LHBs_P-C      -MGGW--SSKPRKGMGTNLAVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ803777_LHBs_P-C      -MGGW--SSKPRKGMGTNLAVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377608_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU570073_LHBs_P-C      -MGGW--SSKPRQGMGTNLTVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU570074_LHBs_P-C      -MGGW--SSKPRQGMGTNLTVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB493844_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
EU939588_LHBs_P-C      -MGGR--LSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ899778_LHBs_P-C      -MGGR--LSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU881996_LHBs_P-C      -MGGP--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939644_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367417_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014385_LHBs_P-C      -MGGR--YSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013869_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPDPLGFFPDRQLDPAFGANSNNPDWDFNP
FJ386589_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ032356_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367427_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377553_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787452_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562292_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386602_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU916234_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU579443_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU086837_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF458665_LHBs_P-C      -MGGR--SSKPRQGMGTDLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB113879_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU086847_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU086843_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU086844_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU086845_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU086846_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377628_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ899788_LHBs_P-C      -MGGS--YSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562255_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386620_LHBs_P-C      -MGGW--SSKPRRGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386611_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386603_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ032355_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871979_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093915_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ922649_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY167096_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377599_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ899789_LHBs_P-C      -MGGS--YSKPRQGMGTNLSVPNPLGSFPDHQLDPAFGANSNNPDWDFNP
FJ562266_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939607_LHBs_P-C      -MGGR--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU547562_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB900099_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377623_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377621_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377600_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377528_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ899776_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787486_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715397_LHBs_P-C      -MGGW--SSKPRQGMETNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715395_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562308_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562293_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562244_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562241_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939617_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939615_LHBs_P-C      -MGGW--YSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939604_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939562_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939545_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871977_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU717212_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFLDHQLDPAFGANSNNPDWDFNP
EU560441_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093914_LHBs_P-C      -MGGW--SSKPRQGMGTNLSAPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093912_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093898_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU082435_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EF536065_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ980547_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ975273_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDINP
DQ922651_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ478900_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY206381_LHBs_P-C      -MGGY--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF384371_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013867_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSSNPDWDFNP
GQ377570_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377517_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715372_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386689_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386577_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939546_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU916219_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ922650_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ478885_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013864_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013862_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013769_LHBs_P-C      -MGGW--SSKPRQGMGTDLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040155_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562301_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562242_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939612_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
D23681_LHBs_P-C        -MGGY--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881888_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475350_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475332_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475329_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475328_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475322_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475317_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475305_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377642_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377640_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377637_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377619_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377618_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377617_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377597_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377585_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377579_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377575_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377574_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377554_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377546_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377545_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377521_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377515_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715422_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715400_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPSPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715398_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715392_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715371_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715367_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715366_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715358_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715357_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANPNNPDWDFNP
FJ715355_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562329_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562327_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562318_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562275_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562274_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562238_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562235_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562233_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562218_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386678_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386639_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386625_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386618_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386576_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386574_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ032361_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ032359_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ032331_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939613_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939610_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939593_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939592_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939540_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939538_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU916233_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU916222_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU916210_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPALGANSNNPDWDFNP
EU871982_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU562218_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093918_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093917_LHBs_P-C      -MGGW--SSKPRQGTGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093916_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093913_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093911_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093910_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093909_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093908_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093907_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093895_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU093883_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU082432_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU082431_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU082430_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU082429_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU082428_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU075342_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU075338_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU075335_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU075334_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ993693_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ993692_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ993691_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY641560_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB675677_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670311_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670305_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013804_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX504539_LHBs_P-C      -MGGS--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040166_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ899761_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562284_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670289_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386657_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700569_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
X75665_LHBs_P-C        -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700504_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700502_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700545_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700556_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN604222_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700564_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700563_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700573_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700570_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700562_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPXFGANSNNPDWDFNP
HQ700565_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700577_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700457_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700490_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700456_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700475_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDXAFGANSNNPDWDFNP
HQ700571_LHBs_P-C      -MGGW--SSKPRKGXGTNLSVPNPLGFFPDHQXDPAFGANSNNPDWDFNP
HQ700575_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFRANPNNPDWDFNP
HQ700566_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700495_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700572_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700561_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700559_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700555_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDXQLDPAFGANSNNPDWDFNP
HQ700558_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700496_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700544_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700567_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700576_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB900113_LHBs_P-C      -MGGW--TSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSHNPDWDFNP
FJ787447_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792880_LHBs_P-C      -MGGRYSTPRPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY167099_LHBs_P-C      -MGGW--SSKPXQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562313_LHBs_P-C      -MGGW--SSKPLQGTGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386653_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB971714_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB971715_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562335_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386598_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY167091_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB111124_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB111125_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB246344_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB300362_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF458664_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475346_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792793_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY206386_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ089802_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU882005_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792713_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792739_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ089801_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562298_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964020_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964021_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964022_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964023_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964024_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964025_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964026_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964027_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964028_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964029_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964030_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964031_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964032_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964033_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792762_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386626_LHBs_P-C      -MGGW--SSKPRLGTGTNLSVPHPLGFFHDLDSDPAFGANSNNPDWDFNP
GQ358153_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNDPDWDFNP
EU871974_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANANNPDWDVNP
EU871970_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871972_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF182803_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871969_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700522_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFLPDHQLDPVFGANSNNPDWDFNP
HQ700543_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFLPDHQLDPVFGANSNNPDWDFNP
FJ562299_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386601_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF182802_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014365_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ717822_LHBs_P-C      -MGGR--YSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ803810_LHBs_P-C      -MGGR--YSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939596_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787450_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNL
EU871973_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSHNPDWDFNP
FJ715405_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715406_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
D28880_LHBs_P-C        -MGGW--SSKPRRGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
S75184_LHBs_P-C        -MGGW--SSKPRRGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939659_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ890381_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ717821_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ803809_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB675674_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB675675_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ027322_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787466_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF411412_LHBs_P-C      -MGGW--TSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670238_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014391_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014382_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377620_LHBs_P-C      -MGGR--YSTPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715360_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715416_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386613_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670274_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ372968_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGSFPDHQLDPAFGANSNNPDWDFNP
FJ899772_LHBs_P-C      -IGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787467_LHBs_P-C      -VGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715415_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386624_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ032350_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ089787_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367401_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598666_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDLNP
KJ598678_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNP
KJ598663_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598665_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598667_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598668_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598669_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598671_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598672_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598673_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598674_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598676_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598677_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598664_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KJ598731_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964229_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562300_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963904_LHBs_P-C      -MGGW--SAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964242_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964241_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964240_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964239_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964237_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964235_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964234_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964233_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964232_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964231_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964230_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598739_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598738_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598737_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598736_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598735_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598734_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598733_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598732_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598730_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598729_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598728_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598727_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598725_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598724_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598723_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598722_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598721_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173333_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ412089_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963914_LHBs_P-C      -MGGW--SAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963913_LHBs_P-C      -MGGW--SAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963912_LHBs_P-C      -MGGW--SAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963911_LHBs_P-C      -MGGW--SAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963910_LHBs_P-C      -MGGW--SAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963909_LHBs_P-C      -MGGW--SAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963908_LHBs_P-C      -MGGW--SAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963907_LHBs_P-C      -MGGW--SAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963906_LHBs_P-C      -MGGW--SAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963905_LHBs_P-C      -MGGW--SAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963903_LHBs_P-C      -MGGW--SAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963902_LHBs_P-C      -MGGW--SAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963901_LHBs_P-C      -MGGW--SAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963900_LHBs_P-C      -MGGW--SAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774235_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY670782_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX504537_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY629631_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG826132_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828923_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562228_LHBs_P-C      -MGGQ--YSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386623_LHBs_P-C      -MGGW--SSKPRHGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ032351_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939597_LHBs_P-C      -MGGS--YSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY220699_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDLAFGANSNNPDWDFNP
AB670259_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSXNPDWDFNP
AB106895_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN604231_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386604_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU919168_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ377164_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPAHQLDPAFGANSNNPDWDFNP
AB931170_LHBs_P-C      -MGGW--SSKPRQGLGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670279_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715351_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715368_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715390_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715391_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715418_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX276963_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715359_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562334_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562310_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562264_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386661_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939647_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU560439_LHBs_P-C      -MGGR--YSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY306136_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB931171_LHBs_P-C      -MGGW--SSKPRQGLGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB900109_LHBs_P-C      -MGGW--SSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB111119_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377631_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377526_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ899773_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787437_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715364_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715344_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562268_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562248_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ518813_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386673_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386644_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386614_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939657_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939649_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871975_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871971_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU086842_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF461358_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF461359_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670260_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670242_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB485810_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881968_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964064_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013851_LHBs_P-C      -MGGW--SSKPRQGMGTNLPVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KM875423_LHBs_P-C      -MGGW--SAKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173309_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377586_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377577_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ358158_LHBs_C-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715421_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFLDHQLDPAFGANSNNPDWDFNP
FJ715381_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715352_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715343_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562319_LHBs_P-C      -MRXW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386672_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386630_LHBs_P-C      -MGGP--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939648_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939618_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939601_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU919169_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU554535_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ683578_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
AY641561_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY596107_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY206382_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB697510_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB697490_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670306_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670298_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670277_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670275_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670267_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB176642_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014377_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB485808_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014360_LHBs_P-C      -MGGP--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB014379_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386670_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377557_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377555_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715365_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715342_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386592_LHBs_P-C      -MGGS--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386591_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ032340_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ536412_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY641559_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF533983_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470891_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173321_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173319_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774255_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774238_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ027323_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN604254_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN604133_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSHNPDWDFNP
JF828937_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475348_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377529_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ358157_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787465_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787464_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715353_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562320_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562315_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562261_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562252_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386664_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386662_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386595_LHBs_P-C      -LGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ032341_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939651_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939626_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939625_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939570_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871976_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
D12980_LHBs_P-C        -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF286594_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB697502_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670295_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367418_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY363283_LHBs_P-C      -MGGY--STKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013853_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598638_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173436_LHBs_P-C      -MGGW--SSKPRSGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173435_LHBs_P-C      -MGGW--SSKPRSGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173302_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173301_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774343_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774309_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774290_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774289_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX661489_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX429915_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN604281_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN604131_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN315779_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828928_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828922_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750137_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ872211_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475339_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475338_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475336_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475321_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475318_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475310_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475309_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377609_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377584_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377578_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377559_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377541_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377540_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715409_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715402_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562325_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562291_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562288_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562232_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386679_LHBs_P-C      -MGGS--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386671_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ032346_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939582_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939572_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939566_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939561_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939548_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU554540_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU306728_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU306726_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU306721_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU306720_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU306719_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ377165_LHBs_P-C      -MGGW--SSKPRQGVGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
D23684_LHBs_P-C        -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY596108_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPVGFFPDHQLDPAFGANSNNPDWDFNP
AY206384_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AP011098_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB900115_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670310_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670307_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670297_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670291_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670285_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670282_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670281_LHBs_P-C      -MGGX--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670276_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670263_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670258_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY363278_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX429907_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040141_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN604148_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787456_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562285_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562256_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDLAFGANSNNPDWDFNP
EU939603_LHBs_P-C      -MGGW--SXKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939585_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670269_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881941_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881918_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470899_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470895_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793195_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774308_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774302_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774250_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475355_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377616_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377552_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377530_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386632_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386607_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939640_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939611_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939595_LHBs_P-C      -MGGS--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939550_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
MG893556_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470883_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964199_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964198_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964197_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964196_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964195_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964194_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964193_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964192_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964191_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964190_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964189_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964188_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964187_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964186_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964185_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964078_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964075_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964074_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964073_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964072_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964071_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964070_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964069_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964068_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964067_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964066_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964065_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963899_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963898_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963897_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963896_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963895_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963894_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963893_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963892_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963891_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963890_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963889_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963888_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963887_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963886_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963885_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
KU963884_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
KU963882_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
KU963881_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
KU963880_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
KU963879_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
KU963878_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
KU963877_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
KU963876_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
KU963875_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
KU963874_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
KU963873_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
KU963872_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
KU963871_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
KT284759_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013923_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013850_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013778_LHBs_P-C      -MGGW--SSKPRRGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173440_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173439_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173337_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173310_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173289_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173287_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173284_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173283_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774361_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774357_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774339_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774293_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774266_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774265_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774260_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774251_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774248_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774247_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774239_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774233_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774220_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774219_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774195_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774194_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774185_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774184_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774181_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX661490_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX661488_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX504546_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX429904_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ341662_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ341636_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040172_LHBs_P-C      -MGGX--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040162_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN604215_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN400089_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN400088_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN400087_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750138_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ872210_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475357_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475354_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475349_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475345_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475344_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475341_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475337_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475331_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475324_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475323_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475320_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475319_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475315_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475314_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475313_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475312_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475311_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475308_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475307_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475306_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377598_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377583_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377576_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377563_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377551_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377527_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377524_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715403_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715383_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715382_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715370_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715350_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562333_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562332_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562330_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562283_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562279_LHBs_P-C      -MGGR--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562230_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386619_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386609_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386587_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386575_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939652_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939591_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939590_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU562217_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU562215_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ536410_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ089793_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
D50518_LHBs_P-C        -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
D50517_LHBs_P-C        -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY641558_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF461363_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF461357_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB697500_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670292_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670288_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670287_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670283_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670278_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670256_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470894_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774216_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774215_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787455_LHBs_P-C      -MGGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562324_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670252_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562225_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF779327_LHBs_P-C      MGQGW--SSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF779300_LHBs_P-C      MGQGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013903_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPGHQLDSAFGANSNNPDWDFNP
KY470937_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF925369_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPSHQLDPAFRANSNNPDWDFNP
FJ386612_LHBs_P-C      ----R--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700506_LHBs_P-C      --------IKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ899763_LHBs_P-C      --------TKPRQGMGTNLSVPNPPGFFPDHQLDPAFGANSNNPDWDFNP
FJ899775_LHBs_P-C      --------TKPRQGMGTNLSVPNPPGFFPDHQLDPAFGANSNNPDWDFNP
EF137803_LHBs_P-C      --------IKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY641563_LHBs_P-C      --------IKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ475353_LHBs_P-C      --------IKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598644_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ032333_LHBs_P-C      --------IKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386665_LHBs_P-C      --------IKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU872012_LHBs_P-C      --------IKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598646_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598688_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598690_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598691_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598695_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598696_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598697_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598701_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB670290_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173441_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598652_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598656_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU086839_LHBs_P-C      --------TKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB074047_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDLAFRANSNNPDWDFNP
FJ899783_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ410505_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF214652_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC792656_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386594_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU086840_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU086841_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM011481_LHBs_P-C      -MGGW--SSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
                                            .                            

DQ089795_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
AB115417_LHBs_P-C      NKDQWPEANQEGGGAFGPGFTPPHGG----LSGWSPQTQGILTTAPAAPP
EU498227_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPPAQGILTTVPAAPP
AY206376_LHBs_P-C      NKDHWPEAKQVGVGAFGPGFTPPHGS----LLGWSPQAQGMLTTVPAAPP
AY206379_LHBs_P-C      NKDHWPEAKQVGVGAFGPGFTPPHGS----LLGWSPQAQGMLTTVPAAPP
AB014378_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGRSPQAQGILTTVPAAPP
KJ410492_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ410499_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MG571359_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ717839_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ803823_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ801491_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILATMTAETP
GQ924636_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JQ027318_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGIVTTVPAAPP
KF053173_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ803766_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JN827424_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JN827425_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MG826140_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC793046_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
DQ089785_LHBs_P-C      NKDQWPEANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX276841_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JN604243_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAATP
DQ089780_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089771_LHBs_P-C      NKDQWPAAHQVGVGSFGPGLTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470914_LHBs_P-C      NKDQWPAANKVGVGSFGPGLTPPHGS----LLGWSPQAQGILTTVPAALP
JQ341626_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KF053164_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ803757_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY363254_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPATPP
JQ027321_LHBs_P-C      NKDPWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
HM011495_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILATVPAAPP
DQ089803_LHBs_P-C      NKDQWPAANKVGVGSFGPGFTPPHGS----LLGWSPQAQGTLTTVPAAPP
DQ089762_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSHQAQGILTTVPAAPP
AB112471_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MF925403_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX276854_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGTLTTVPAVPP
KR013822_LHBs_P-C      NKDQWPAASQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAVPP
KJ803818_LHBs_P-C      NKDQGPVANFGGVGSFGPGFTPPRSP----LLGGSPQAQGILTTVAAAPP
JN827421_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674390_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX276848_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX276846_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSXQAQGILTTVPAAPP
KJ410515_LHBs_P-C      NKDQWPEAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ173285_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
GQ377605_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
FJ023648_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGX----LLGWSPQAQGTLTTVPAAPP
KR013835_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KR013836_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KR013839_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KR013838_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674489_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KR013820_LHBs_P-C      NKDQWPAADQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAVPP
KJ410494_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ341614_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
HM011491_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
DQ089804_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
DQ089786_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MG826122_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF925395_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGIMTTVPAATP
KX765823_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KR013837_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KP148481_LHBs_P-C      NKDHWPAANQVGVGSFGPRFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ410518_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KF214673_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KC315399_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JX870000_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JN604129_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JN604121_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
GQ924616_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
AB112472_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
FJ023641_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
FJ023642_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KR013856_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KP148526_LHBs_P-C      NKDHWPAANQVGLGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148476_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAGPP
KC774284_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVTPP
JQ801472_LHBs_P-C      NKDQWPAAKQVGAGAFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JF899336_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
EF384206_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF925378_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGTLTTVPTAPP
KX765849_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ717791_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ410491_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KC875264_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774285_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ801481_LHBs_P-C      NKDQWPAANQVGAGAFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ027317_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGXLTTVPAAPP
GQ924649_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MF925394_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGTLTTVPTAPP
MF674494_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KY470918_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470910_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765827_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX765825_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX276847_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KU051424_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KT987423_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGSNYQHLLGWSPQAQGILTTVPAAPP
KR013905_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KR013840_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KR013826_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAVPP
KR013824_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAVPP
KR013821_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAVPP
KM875429_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ803779_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ410496_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ410495_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ410489_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ173324_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KF214667_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAAP
JQ341660_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LXGWSPQAQGILTTVPAAPP
JN604286_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTLPAAPP
HM011472_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
HM011468_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765850_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX765848_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX765845_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KX765821_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KR013902_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KR013770_LHBs_P-C      NKNQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KP148477_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148472_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ410504_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ801501_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ801497_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ801495_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JN604232_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ341633_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTIPXAPP
JQ341639_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MK818227_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MG571335_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX765852_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765842_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KR013899_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KR013819_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGN----LLGWSPQAQGILTTVPAALP
KR013817_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGN----LLGWSPQAQGILTTVPAALP
KM875428_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGMLTTVPAAPP
KM875406_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ410519_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ173323_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KF214670_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTAVPAAPP
KF053185_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC875270_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774227_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KC774221_LHBs_P-C      KKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
MG826123_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MG725248_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MG571332_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPTAPP
MF925408_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674502_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674501_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674484_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674472_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674468_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674454_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAHP
MF674442_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674435_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674412_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674402_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674398_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674388_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674386_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KY470916_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KX774503_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX765844_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX765836_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX765830_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGN----LLGWSPQAQGTLTTVPAAPP
KX765819_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KX276851_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KU051423_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KR013857_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KR013854_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KM875404_LHBs_P-C      NKDQWPTANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ803799_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ803793_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ803761_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ803759_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ717810_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ717803_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ410513_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ410501_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ410493_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KF053169_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KF053167_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KC774236_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JX507212_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ801522_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ801519_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ801513_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ801511_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ801505_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ801475_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ688403_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ341663_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ027324_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JN604256_LHBs_P-C      NKDQWPTAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JN604182_LHBs_P-C      NKDQWPTAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
HM011497_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MH220971_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MF925374_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MF925359_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MF674463_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674418_LHBs_P-C      NKDQWPAANKVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KM875424_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KC792927_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPASPP
JQ801502_LHBs_P-C      NKDQWPAANQVGVGSFRPGFTPPRGS----LLGWSPQAQGILTTVPAAPP
JQ801498_LHBs_P-C      NKDQWPAANQVGAGAFGPGFTPPHGG----LLGWSPQAQGALTTVPAAPP
JQ341652_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
HM011488_LHBs_P-C      NKDQWPAAXQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTXPAAPP
MF925410_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF925376_LHBs_P-C      KKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MF925375_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MF674486_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674471_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MF674457_LHBs_P-C      NKDQWPEAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674429_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGTLTTVPAAPP
MF674428_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGN----LLGWSPQAQGTLTTVPAAPP
MF674417_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674408_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674399_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX765824_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGI----LLGWSPQAQGILTTVPAAPP
KX765822_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KT347089_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KF053176_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ341669_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ341621_LHBs_P-C      NKDQWPEAHQVGVGSFGPGFTPPHGX----LLGWSPQAQGILTTVPAAPP
JQ341657_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGX----LLGWSPQAQGILTTVPAAPP
JQ341649_LHBs_P-C      NKDQWPAAHQVXVGXFGPGFTPPHGX----LLGWSPXAQGILTTXPAXPP
MG571345_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
AB112348_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
AB112065_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KF053187_LHBs_P-C      NKDQWPAAKQVGVGSFGPGFTPPRGS----LLGWSPQAQGILTTLPAAPP
KJ803780_LHBs_P-C      NKDQWPAAKQVGVGSFGPGFTPPRGS----LLGWSPQAQGILTTLPAAPP
AB112066_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MF925409_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KR013823_LHBs_P-C      NKDQWPAANRVGVGSFGPGLTPPHGN----LLGWSPQAQGILTTVPAVPP
JQ341620_LHBs_P-C      NKDPWPAANQVGVGXFGPGFTPPHGN----LLGWSPQAQGILTTXPAAPP
MF925398_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGIVTTVPAAPP
KF214671_LHBs_P-C      NKDRWPAANQVGVGSFGPGLTPPHGS----LLGWSPQAQGILTTVPAAPP
EU305540_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGRSPQAQGILTTVPATPP
DQ089790_LHBs_P-C      NKDPWPAAQQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ801493_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ027320_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILTTIPAAPP
FJ023645_LHBs_P-C      KKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MF674444_LHBs_P-C      NKDHWPEANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KP148567_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148492_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ803812_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPEAPP
KJ717825_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPEAPP
KY470915_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470913_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KR014021_LHBs_P-C      NKDRWPAANQVGVGSSGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KP148563_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTLPHGS----LLGWSPQAQGILTTVPAAPP
KP148474_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ803813_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ717826_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ410511_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTAPAAPP
KC875272_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC875267_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ341622_LHBs_P-C      NKDHWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JN827420_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
HM011486_LHBs_P-C      NKDPWPAAXQVGVGAFGPGFTPPHGN----LLGWSPQAQGXLTTVPAAPP
KT364719_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774189_LHBs_P-C      NKDPWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JQ341650_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ341624_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVXAAPP
KT366464_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGTLTTVPAAPP
MF674514_LHBs_P-C      NKDPWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674504_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674467_LHBs_P-C      NKDQWPAANKVGVGSFGPGFTPPHGN----LLGWSPQAQGRLTTVPAAPP
MF674458_LHBs_P-C      NKDPWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674430_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674425_LHBs_P-C      NKDPWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX765834_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KP148575_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148566_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148560_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148559_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148557_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148546_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148532_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148524_LHBs_P-C      NKDHWPAANQVGVGPFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148521_LHBs_P-C      NKDHWPAANQVGVGPFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148513_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148512_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148489_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148475_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148466_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148465_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148464_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148463_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148315_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JX504535_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGTLTTVPAAPP
JQ801488_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ341661_LHBs_P-C      NKDPWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JQ341642_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674475_LHBs_P-C      NKDNWPDGNQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KY629637_LHBs_P-C      NKDHWPAANQVGAGAFGPGLTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148534_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148531_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148525_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ173286_LHBs_P-C      NKDQWPEANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JX507214_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ801515_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148548_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148537_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ410514_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ341630_LHBs_P-C      NKDPWPEANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
MF925377_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MF674474_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KR013900_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KR013825_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAVPP
KP148574_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148573_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148572_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148571_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148570_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148568_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148564_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148562_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148561_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148558_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148555_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148554_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148552_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148551_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148549_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148547_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148545_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148543_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148540_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPLHGS----LLGWSPQAQGILTTVPAAPP
KP148538_LHBs_P-C      NKDHWPVANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148535_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148530_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148529_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148528_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148523_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148520_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148519_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148517_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148514_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148488_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148482_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148480_LHBs_P-C      NRDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148479_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148471_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148469_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148468_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148462_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KM875405_LHBs_P-C      NKDPWPTANQVGVGAFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ173438_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173437_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC875274_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ341664_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILTTIPAAPP
JQ341655_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ341654_LHBs_P-C      NKDQWPAAQQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ341653_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ341644_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ341637_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX765847_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KX276840_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTXVPAAPP
KR013855_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KP148473_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KF053193_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGTLTTVPAAPP
JX507211_LHBs_P-C      NKDPWPXANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILXTLPXTPP
JQ341617_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JN604118_LHBs_P-C      NKDXWPXAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ341618_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX276853_LHBs_P-C      NKDPWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ341641_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
MF674403_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX765853_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765826_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX276852_LHBs_P-C      NKDPWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ717809_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ801518_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ801490_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGTLTTVPAAPP
JQ341659_LHBs_P-C      NKDQWPAANQVGAGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ341651_LHBs_P-C      NKDQWPAAXQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ801482_LHBs_P-C      NKDPWPEAWQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTLPAAPP
JQ341628_LHBs_P-C      NKDXWPXAXQVGVGXXGPGFTPPHGX----LLGWSPQAQGILTTVPAAPP
JQ341631_LHBs_P-C      NKDPWPEANQVGVGSFGPGFTPPHGX----LLGWSPQAQGILTTVPAAPP
KJ803792_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765828_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KT364720_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MG826143_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470936_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470920_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470917_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470909_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470907_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX774504_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765843_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KF214676_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KF214668_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC875273_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC875269_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ801523_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ801504_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ801503_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ801470_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JN604153_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470912_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHDS----LLGWSPQAQGILTTVPAATP
KY470906_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765855_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX276844_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MF925406_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MF925405_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILATVPAAPP
MF925387_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765851_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765846_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765840_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765838_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765837_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765833_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765832_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765831_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765829_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765820_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX765818_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU051425_LHBs_P-C      KKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KT987424_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KT366463_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KT364721_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ803815_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ803811_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ803800_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ717828_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ717823_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ717812_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ717811_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC875271_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC875265_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774228_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ801520_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ801500_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ801496_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ801486_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ801473_LHBs_P-C      NKDQWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JN827422_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JN604151_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPX
KT364718_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPASPP
KT987426_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KT987425_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KT307718_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPASPP
KT307719_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPASPP
KU051426_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPASPP
KU051427_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPASPP
MF925367_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MF925365_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX276850_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGXLTTVPAAPP
KX774506_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ341635_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPATPP
KF053177_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ803770_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JN604135_LHBs_P-C      NKDSWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGMLTTVPAEPP
KF053168_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ803760_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
DQ089767_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPKAQGLLTTVPAAPP
DQ089768_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILSTVPAAPP
KF053161_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ803754_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ717844_LHBs_P-C      NKDQWPAAHQVGVGAFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ803826_LHBs_P-C      NKDQWPAAHQVGVGAFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KF053183_LHBs_P-C      KKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ803776_LHBs_P-C      KKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
DQ478901_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089773_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
AB117758_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KP148483_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQSQGILTTVPAAPP
KP148491_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQSQGILTTVPAAPP
GQ924643_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILATAPAAPP
DQ089778_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089775_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
AB031262_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
EU305541_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPATPP
DQ089788_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JN827423_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KR013841_LHBs_P-C      NKDQWPAANQVGVGSFGPGITPPHGN----LLGWSPQAQGILTTVPAAPP
GQ184326_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGALTTVPAAPP
EF494379_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089783_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
AF223960_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
GQ924612_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGIMTTVPAAPP
GQ924613_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGIMTTVPAAPP
JN827418_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JN604147_LHBs_P-C      NKDQWPTANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
GQ924650_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILSTVPAAPP
GQ924614_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
EU306691_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGIVTTVPAAPP
EU306689_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGIVTTVPAAPP
EU306688_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGIVTTVPAAPP
EU306685_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGIVTTVPAAPP
EU306687_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGIVTTVPAAPP
EU306690_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGIVTTVPAAPP
EU306694_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGIVTTVPAAPP
DQ246215_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089777_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089776_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089772_LHBs_P-C      KKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089770_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTLPAAPP
DQ089763_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
AY862869_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGN----LLGWSSQAQGILTTVPAAPP
AF473543_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
AF223958_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
FJ023643_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ023644_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ023654_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
FJ349225_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ358154_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB074756_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
AB247916_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
AB300363_LHBs_P-C      KKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
AF068756_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
FJ023647_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
FJ023649_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
FJ023657_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
FJ023658_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
GQ924604_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
GQ924629_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
GU563561_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JN827417_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JN827416_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
GQ924609_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
EF384200_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089760_LHBs_P-C      NKDQWPAAHQVGXGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
EF688062_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
FJ562337_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
AB246346_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089764_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089761_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTIPAAPP
DQ089791_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
AB205125_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
GQ924655_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ341611_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
FJ023639_LHBs_P-C      NKDQWPAANQVGVGXFGPGFTPPHGN----LLGWSPQAQGIXTTXPAAPP
DQ089784_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
AB074755_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGN----LLGWSPQAQGILSTVPAAPP
AB105173_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
AF223954_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
AF223955_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
AF223957_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
AF223961_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
AP011097_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089765_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089769_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089779_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089781_LHBs_P-C      NKDQWPTANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089782_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ341616_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ341615_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ341613_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ027333_LHBs_P-C      NKDQWPAANQVGVGSFGPGXTPPHGN----LLGWSPQAQGILTTVPAAPP
JQ040133_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
JN604144_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
GQ924615_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
GQ377536_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
FJ023653_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089792_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
FJ023650_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
DQ089766_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
GQ924642_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTMPAAPP
HQ700516_LHBs_P-C      NKDRWPKANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTPLPAVPP
AB014380_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGALTTVPVAPP
KC792831_LHBs_P-C      NKDHWPEANQVGAGAFGPGVTPPHGG----LLGWSPQAQGILTTVPAAPP
DQ089758_LHBs_P-C      NKDPWPEAXQVGAGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
MG826129_LHBs_P-C      NKDHWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTPVPAAPP
MG826138_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTPVPAAPP
MG826136_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWTPQAQGILTPVPAAPP
MG826131_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTPVPAVPP
KX276855_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGS----LLGWSXQAQGILTPVPAAPP
MG826137_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTPVPAAPP
MG826134_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTPVPAAPP
MG826135_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTPVQAAPP
AP011106_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTPVPAAPP
MG826133_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTPVPAAPP
AP011107_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTPVPAAPP
AB670253_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ032336_LHBs_P-C      NKDPWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
FJ032338_LHBs_P-C      NKDPWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
FJ032339_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
DQ089789_LHBs_P-C      NKDPWPAANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
DQ089757_LHBs_P-C      NKDPWPEAHQVGVGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ023646_LHBs_P-C      NKDPWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGTLTTLPAAPP
FJ023656_LHBs_P-C      NKDPWPAANQVGVGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
MG826139_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
AB367411_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
JX661497_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGD----LLGWSPQAQGILTTVPAAPP
EU939609_LHBs_P-C      NKDPWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
DQ089796_LHBs_P-C      NKDHWPEAXQVGVGAFGPGFTPPHGG----LLGWSPQAQGIVTTVPAAPP
KC793142_LHBs_P-C      NKDHWPGANQVGAGAFGPGFTPPHGG----LLGWSPQAQGIXTTVPXAPP
HQ700529_LHBs_P-C      NKDHWPKANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562340_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KR013866_LHBs_P-C      NKDHWPEANQVGAGASGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
GQ377636_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGXLTTVPVAPP
FJ562239_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU522068_LHBs_P-C      NKDHWPEANQVAVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB014399_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGTLTTVPVAPP
KU964243_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU964238_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU964236_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAASP
KJ598726_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAASP
KJ598720_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598662_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
HM750141_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----VLGWSPQAQGILTTVPAAPP
HM750131_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562304_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
FJ562276_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
AB014389_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGALTTVPVAPP
AB014374_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ787458_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSSQAQGILATVPAAPP
KU964173_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVTPP
KC792853_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGTLTTVPVAPP
KC792691_LHBs_P-C      NKDPWPAANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVXPP
KC792672_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPHTQGILTTVPAAPP
FJ899769_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
EU939616_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU560438_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AY206392_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAHP
KJ173432_LHBs_P-C      NKDHWPEAHQVGAGAFGPGFTPPHGN----LLGWSPQAQGILTTVPVAPP
KJ173431_LHBs_P-C      NKDHWPEAHQVGAGAFGPGFTPPHGN----LLGWSPQAQGILTTVPVAPP
KJ173334_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC792682_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774313_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774245_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
JX026880_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JN604258_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HQ622095_LHBs_P-C      NKDHWPEANQVGAGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HM011500_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----XLGWSPQAQGILTTVPAAPP
GU357845_LHBs_P-C      NKDHWSEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ787457_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILATVPAAPP
AB670249_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013943_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013791_LHBs_P-C      NKDHWPEANQVGAGAFGPSFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013780_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ598670_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC793108_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KC774353_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KC774244_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774203_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JQ040161_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTPVPXAPP
FJ562273_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU093903_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
JQ040139_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881809_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC792790_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGX----LXGWSPQAQGXLTTVPAAPP
KC774356_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JQ040145_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JF436920_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPSHGG----LLGWSPQAQGILTTVPVAPP
KR014043_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAHP
KR013858_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KR013852_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013794_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013786_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ598687_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173442_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173312_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVVPP
KJ173311_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVVPP
KJ173303_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173295_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVVPP
KJ173292_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173291_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC792669_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774334_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774304_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JX661493_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
JX429903_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JQ040165_LHBs_P-C      NKDHWPEANQVGTGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JQ040163_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JQ040152_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JQ040144_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ040131_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JN604246_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JN604140_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HM750140_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTLPVAPP
HM750139_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HM750135_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HM750134_LHBs_P-C      NKDHWPEAHQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HM750132_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HM011493_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGX----LLGWSPQAQGILTTVPAAPP
GU434374_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
GQ924633_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB014369_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTAVPVAPP
KR013831_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
KR013781_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013779_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173396_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774210_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTAVPVAPP
JX504536_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JX504534_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPIAPP
JQ040168_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JQ040149_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HM011489_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KT284755_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KT284753_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013798_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013797_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013784_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013783_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013782_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KM213037_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173395_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC793187_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC793039_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774326_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774310_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774295_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774279_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774275_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774259_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774257_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774252_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774232_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774223_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774180_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JX429905_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JX026878_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
GQ475356_LHBs_P-C      BKDHWPEANQVGAGAFGPGFTPPHGX----LLGWSPQXQGXLTTVPAAPP
HM011465_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPSAPP
KF053181_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ803774_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KF873516_LHBs_P-C      NKDHWPKANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU679951_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KF873526_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KF873528_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGXLTTVPAAPP
KF873529_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU679947_LHBs_P-C      NKDHWPKANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU679957_LHBs_P-C      NKDHWPEXNQVGAGAFGPGFTPPHGG----LLGWSPQXQGILTTVPAAPP
KF873514_LHBs_P-C      NKDHWPEANQVGAGAFGPGLTPPHGG----LLGWSPQAQGILTTVPVAPP
KF873520_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGN----LLGWSPQAQGTLTTVPVAPP
KU679936_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KF873541_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU679937_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGXLTTVPAAPP
KF873539_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KF873536_LHBs_P-C      NKDHWPZAXQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU679960_LHBs_P-C      NKBHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB493839_LHBs_P-C      NKDHWPKANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB112063_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
FJ032345_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
EU554541_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVTPP
EU554542_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
AB111946_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGG----LLGWSPLAQGILTTVPAAPP
KX276992_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367435_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGSSPQAQGILTTVPAAPP
AB105174_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGRSPQAQGILTTVPAAPP
KY881883_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
GQ475351_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
AB365451_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY881962_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGVLTTVPVAPP
KY881990_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGVLTTVPVAPP
KY881884_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881960_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881872_LHBs_P-C      NKDHWPEANQVRAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPAAPP
KY363281_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY881991_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881886_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881987_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY363275_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTPVPAAPP
KX276959_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ562251_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881882_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881997_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
EU939654_LHBs_P-C      KKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
D00630_LHBs_P-C        NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670241_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB014381_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY882003_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881994_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881989_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881981_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881892_LHBs_P-C      NKDHWPEANQVGAGVFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881887_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881880_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881871_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY363260_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
FJ386605_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY881978_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881875_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY363274_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTPVPAAPP
AB670301_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
MG893553_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVSVAPP
KY881984_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881983_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881975_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881974_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881973_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSRQAQGVLTTVPVAPP
KY881940_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881925_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881916_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881915_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY470973_LHBs_P-C      NKDHWPEANQVGAGAFGLGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470966_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470927_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470904_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470880_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470877_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY363282_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY363264_LHBs_P-C      NKDHWPESNQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KX276985_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KX276968_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964343_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
MG826125_LHBs_P-C      NKDQWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
LC279275_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY882001_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881993_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881980_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881979_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881971_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881966_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881891_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881889_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881885_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881881_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881879_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881878_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881877_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881874_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLATVPVAPP
KY881870_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY470974_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470969_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470965_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470903_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTAPVAPP
KX276981_LHBs_P-C      NKDHWPKANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVALP
KU964341_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVTPP
MG893557_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY881817_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470881_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964364_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
X04615_LHBs_P-C        NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTLPAAPP
MH891502_LHBs_P-C      NKDHWPEANQVGAGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
MH887433_LHBs_P-C      NKDHWPEANQVGAGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
MG893560_LHBs_P-C      NKDHWPEANQVGAGAFGPEFTPPHGG----LLGWSPQAQGMLTTVPVAPP
MG826124_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
LC318703_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
LC279276_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
LC279251_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY882000_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881999_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881998_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881996_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881995_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881992_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881986_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881985_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881982_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881977_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881976_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881972_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881967_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881965_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881963_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881959_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881943_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881942_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881939_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881938_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881937_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881936_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881935_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881934_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881933_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881932_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881931_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881930_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881929_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881928_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881927_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881926_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881924_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881923_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881922_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881921_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881920_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881919_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881917_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881777_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881776_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881775_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881774_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881773_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881772_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881771_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881770_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881769_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881768_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881767_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881766_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881765_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881764_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881763_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881762_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881758_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881755_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881754_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881751_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881750_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881749_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881748_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881744_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881743_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881742_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881739_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881738_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881737_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881736_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470977_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470975_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470968_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470905_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470902_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470901_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470900_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470897_LHBs_P-C      NKDHWPEANQVGAGAFGPGFAPPHGG----LLGWSPQAQGILTTVPVAPP
KY470896_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470890_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470888_LHBs_P-C      NKDHWPEADQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470887_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470886_LHBs_P-C      NKDHWPEADQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470884_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470882_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470878_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470876_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470874_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY363279_LHBs_P-C      NKDHWPEAKQVGVGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KX276976_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KX276960_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964348_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964347_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964346_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964345_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964344_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964342_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964340_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964339_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964338_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964337_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964336_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964334_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964225_LHBs_P-C      NKDHWPEANQVGAGAFGPGVTPPHGG----LLGWSPQAQGTLTTVPAAPP
KU964184_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPVAPP
KU964179_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPVAPP
KU964174_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPVAPP
KU964176_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPVAPP
KU964178_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPVAPP
KU964181_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGTLTTVPVAPP
KU964183_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPVAPP
V00867_LHBs_P-C        NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
MH094411_LHBs_P-C      IKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
LC318702_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
LC279274_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
LC279249_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
LC279248_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
LC279247_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
LC279245_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY881988_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881961_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881812_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881802_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470979_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY022423_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAVPP
KU964182_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
MG893558_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
LC279262_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
LC279261_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
LC279260_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
LC279258_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
LC279257_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
LC279256_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
LC279255_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
LC279252_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
LC279246_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470978_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470976_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470972_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470971_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470970_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470967_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470934_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470933_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470926_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470925_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KX276973_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KX276835_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964228_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964227_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KU964224_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964223_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964222_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
MK321266_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
LC373512_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
LC373511_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY363284_LHBs_P-C      NKDHWPGANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KX276836_LHBs_P-C      NKDXWPXAXQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964221_LHBs_P-C      NKGHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964358_LHBs_P-C      NKDHCPEANQVGAGAFGTGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964349_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964363_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
D23682_LHBs_P-C        NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
D23683_LHBs_P-C        NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KJ717799_LHBs_P-C      NKDPWPEARQVGVGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ803790_LHBs_P-C      NKDPWPEARQVGVGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ787442_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ787443_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939568_LHBs_P-C      KKDQWPEANQVGVGAFGPRFTPPHGG----LLGWSPQAHGILTTVPTPPP
EU093900_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367402_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
AB113875_LHBs_P-C      NTDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB113876_LHBs_P-C      NTDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939579_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPTAPP
FJ899774_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPTAPP
KU964323_LHBs_P-C      NKDHWPEANQVGAGAFGPGSTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964326_LHBs_P-C      NKDHWPEANQVGAGAFGPGSTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964327_LHBs_P-C      NKDHWPEANQVGAGAFGPGSTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964333_LHBs_P-C      NKDHWPEANQVGAGAFGPGSTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964329_LHBs_P-C      NKDHWPEANQVGAGAFGPGSTPPHGG----LLGWSPQAQGTLTTVPVAPP
GU721029_LHBs_P-C      NKDHWREAWQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTSVPAAPP
AB014392_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGALTTVPVAPP
EU939539_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPATPP
KY470980_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470981_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470982_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470983_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470984_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470985_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470986_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470987_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470988_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470990_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY470991_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
EU939653_LHBs_P-C      NKDHWPEANQVGMGAFGPGFTPPHGG----LLGWSPQAQGALTTVPAAPP
AB367406_LHBs_P-C      NKDHWPEANQVGAGAFGSGLTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715404_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQSILTTVPVAPP
AB367392_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ787449_LHBs_P-C      SKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386631_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPHAQGILTTVPPAPP
FJ787453_LHBs_P-C      NKDRWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
FJ787454_LHBs_P-C      NKDRWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
AY066028_LHBs_P-C      NKDHWPEANQVGAGAFGTGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB198082_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386652_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377601_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AF411408_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AF411411_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU796070_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU796072_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ899764_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377533_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----VLGWSPQAQGILTTVPAAPP
AY247032_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB642097_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAXGILTTVPAAPP
AB300368_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670265_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
AB670300_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
AB367431_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367407_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB195942_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB182589_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB195943_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB195944_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670243_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367394_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367398_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367403_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670251_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB367412_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
AB362932_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367804_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367432_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB195949_LHBs_P-C      NKDHWPEAKQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB198077_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB198078_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB202071_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPSHGG----LLGWSPQAQGILTTVPAAPP
AB205124_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB222714_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670247_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB642095_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB640730_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB471853_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB471852_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB471851_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367422_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPSHGG----LLGWSPQAQGILTTVPAAPP
AB367414_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB300365_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPIAPP
AB222715_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB300359_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JF828921_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JF828918_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JF828920_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JF828913_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JF828915_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JF828917_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JF828924_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JF828925_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JF828926_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JF828929_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JF828930_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715379_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ562269_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPIAPP
KJ717833_LHBs_P-C      NKDPWPEARQVGVGAFGPGFTPPHGG----LLGWSPLAQGILTTVPATPP
GQ924620_LHBs_C-C      NKDPWPEAWQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTPVPAAPP
JQ341632_LHBs_P-C      NKDPWPEAWQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPATPP
KR014078_LHBs_P-C      NKDPWPEAWRVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013870_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR014077_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR014083_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013871_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR014082_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AF241410_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPATPP
AB241111_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JN827414_LHBs_P-C      NKDPWPGAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU410079_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AF241411_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JN827415_LHBs_P-C      NKDPWPGAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB241110_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AP011099_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AP011100_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AP011101_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU410080_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU410081_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JN604226_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ924622_LHBs_P-C      NKDPWPEAWQVGAGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367395_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPAAPP
AB367396_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367424_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562250_LHBs_P-C      NKDHWPKANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715377_LHBs_P-C      SKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ715378_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ715380_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ787470_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ787471_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----FLGWSPQAQGTLTTVPAAPP
FJ715374_LHBs_P-C      NKDHWPEANQVGAGAFGPGITPPHGG----LLGWSPQAQGILTTVPVVPP
FJ715375_LHBs_P-C      NKDHWPEANQVGAGAFGPGITPPHGG----LLGWSPQAQGILTTVPVVPP
FJ715376_LHBs_P-C      NKDHWPEANQVGAGAFGPGITPPHGG----LLGWSPQAQGILTTVPVVPP
FJ715389_LHBs_P-C      NKDHWPEAIKVGAGAFGPGITPPHGG----LLGWSPQAQGILTTVPVVPP
EU939586_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB367420_LHBs_P-C      NKDHWPEANQVGAGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JF828916_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JF828919_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367416_LHBs_P-C      NKDHWPEAHQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367803_LHBs_P-C      NKDHWPEAHQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU560440_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPAAPP
EU579442_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPAAPP
FJ562243_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU872000_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQDMLTTVPVAPP
EU570072_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPS
EU093902_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVVPP
AB367434_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB367399_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367397_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB014393_LHBs_P-C      NKDHWPEAXQVGAGAFGPGFTPPHGG----LLGWSPQAQGALTTVPVAPP
EU939542_LHBs_P-C      NKDHWPEANQVGAGAFGPGVTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ899767_LHBs_P-C      NKDHWPEANQVGAGAFGPGVTPPHGG----LLGWSPQAQGILTTVPAAPP
AB042282_LHBs_P-C      NKDHWPEANQVGAGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB042283_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013868_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ032334_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
EU939594_LHBs_P-C      NKDHWPEANQVGAGAFGPGLTPPHGG----LLGWSPQAQGILTTMPEAPP
EU939567_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPVAPP
EU939564_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU589336_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVTPP
AB195937_LHBs_P-C      NKDHWPEANQVGAGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB195938_LHBs_P-C      NKDHWPEANQVGAGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB014367_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB014384_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGALTTVPVAPP
AB670239_LHBs_P-C      NKDHWPEANQVGAGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670240_LHBs_P-C      NKDHWPEANQVGAGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774358_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGIVTTMPVAPP
FJ899770_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
EU939536_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU554537_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU439015_LHBs_P-C      NKDHWPEAKQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
EU306674_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU306673_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670302_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670273_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPAAPP
AB670270_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
AB670262_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTMTTVPAAPP
AB288026_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB014362_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
FJ386685_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB298720_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
AB298721_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
EU075336_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB111121_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPLAQGILTTVPAAPP
AB014376_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB014394_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB111122_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB111123_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013842_LHBs_P-C      NKDHWPEANQAGAGAFGPGFTPPHGG----LLGRSPQAQGILTTVPAAPP
KR013844_LHBs_P-C      NKDHWPEANQVGAGALGPGFTPPHGG----LLGRSPQAQGILTTVPAAPP
KR013848_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGRSPQAQGILTTVPAAPP
KR013849_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGRSPQAQGILTTVPAAPP
AB642099_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
EU872001_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPVAPP
EU872003_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPVAPP
EU872004_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPVAPP
EU872002_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPVAPP
EU916223_LHBs_P-C      NKDHWPEANQVGAGAFGLGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AF363961_LHBs_P-C      NKDHWPEAHQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU916224_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939619_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
GQ377615_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
GQ377571_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
GQ377562_LHBs_P-C      NKDHWPEANQVGAGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562306_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562265_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTMPVAPP
FJ562249_LHBs_P-C      NKDHWPEANQVGAGAFGSGFTPPHGG----LLGWSPQAQGIMTTVPVAPP
FJ386597_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ386588_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAVPP
EU939543_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB670264_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367404_LHBs_P-C      NKDHWPEANQVGAGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB299858_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILSTVPVAPP
AB426467_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILSTVPVAPP
AB198076_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562307_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377632_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB195936_LHBs_P-C      NKDHWPEANQVGAGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB642100_LHBs_P-C      NKDHWPEANQVGAGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB900116_LHBs_P-C      NKDHWPEANQVGAGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB049610_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB033551_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB033550_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670272_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB026815_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
AB300360_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGTLTTVPAAPP
AB026811_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPRGG----LLGWSPQAQGTLTTVPVAPP
AB026812_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPRGG----LLGWSPQAQGTLTTVPVAPP
AB026813_LHBs_P-C      NKDHWPEADQVGAGAFGPGFTPPRGG----LLGWSPQAQGTLTTVPVAPP
AB026814_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPRGG----LLGWSPQAQGTLTTVPVAPP
AB014371_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
AB014363_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KR013861_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
KR013860_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
D50520_LHBs_P-C        NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPEAPP
AB033552_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB033553_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB033556_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
DQ089799_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ562258_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ562272_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ562281_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWNPQAQGILTTVPVAPP
AB042284_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB195947_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
AB195952_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB198079_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB198080_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB198081_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB198083_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB300361_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367423_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB471848_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
AB471849_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
AB471850_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
FJ386596_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386687_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013859_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
GQ377580_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ899777_LHBs_P-C      NKDPWPEANQVGAGAFGPGFTPPHGG----LLGWNPLAQGILTTVPVAPP
EU939544_LHBs_P-C      NKDHWPESNQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
EU916237_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU871978_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
EU570068_LHBs_P-C      NKDHWPEANQVEAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU570067_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU554539_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU306675_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
D50519_LHBs_P-C        NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPEAPP
AB014383_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGALTTVPVAPP
FJ787439_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVTPP
FJ787479_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVTPP
AB113878_LHBs_P-C      NKDHWPEATQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB195930_LHBs_P-C      NKDHWPEATQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB195931_LHBs_P-C      NKDHWPEATQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB195932_LHBs_P-C      NKDHWPEATQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475325_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367410_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939587_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939600_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU939614_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
GQ475316_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475327_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475334_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KT284758_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JQ040151_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
MH818373_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY881964_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
JQ040132_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774299_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ787468_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ787469_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386579_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ787445_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU939605_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
DQ975272_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
DQ478899_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB111120_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGALTTVPVAPP
AB050018_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU554538_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU871980_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWNPQAQGILTTVPVAPP
EU871998_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWNPQARGILTTVPVAPP
EU916238_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939578_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562280_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377523_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377538_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU554536_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
GQ377603_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377593_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ787441_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVTPP
AB014396_LHBs_P-C      NKDHWPKANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
AB195953_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB195954_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB246345_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
GQ377518_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ899771_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
EU939563_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
FJ386659_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
AB205123_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQSILTTVPVTPP
AB111114_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY363258_LHBs_P-C      NKDQWPESNQVGTGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774179_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774297_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KX276980_LHBs_P-C      NKDHWPEAKQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAVPP
KC774269_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LVGWSPQAQGILTTVPAAPP
MG826128_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTSVPAAPP
KX276993_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013827_LHBs_P-C      NKDHWPEANQVGSGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC792995_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWNPQAQGILTTVPAAPP
HM011479_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGXLTTVPAAPP
KX276837_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGXLTTVPAAPP
HM750136_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774211_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
KC774256_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774277_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774335_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPATPP
JX036326_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JX036327_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964016_LHBs_P-C      NKDQWPKANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPVEPP
KU964015_LHBs_P-C      NKDQWPKANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPVEPP
KU964019_LHBs_P-C      NKDQWPKANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPVEPP
KY363252_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPYGG----LLGWSPQAQGTLTTVPAAPP
KU964011_LHBs_P-C      NKDPWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGIVTTVPVAPP
KJ410510_LHBs_P-C      NKDPWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562221_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KX276991_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC793119_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KC792902_LHBs_P-C      NKDHWPEANQVGVGAFGPGVTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774296_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774214_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JX026877_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
AY057947_LHBs_P-C      IKDHWPAANQVGVGAFGPGLTPPHGG----ILGWSPQAQGILTTVSTIPP
X52939_LHBs_P-C        NKDHWPEAKQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KC792710_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LVGWSPQAQGILTTVPVAPP
KC792700_LHBs_P-C      NKARWPYAAQVGAGAFGPGFTPPHGG----LLGWSPQAXGILTTVPVAPP
KC774213_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU916225_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964017_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPVAPP
KU964013_LHBs_P-C      NKDQWPEANQVGAGAFGPGVTPPHGG----LLGWSPQAQGMLTTVPVAPP
KR013874_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KF214655_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC793040_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774306_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPVAPP
KC774281_LHBs_P-C      KKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774217_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939571_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGIVTTVPAAPP
EU796069_LHBs_P-C      NKDHWPEANQVGTGAFGPGFTPPHGG----VLGWSPQAQGILTTVPVAPP
GQ377591_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAL-
GQ377572_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AY247031_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562282_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964330_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPIAPP
KU964325_LHBs_P-C      NKDHWQEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KR013882_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KR013846_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173335_LHBs_P-C      NKDPWPEAWQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC875261_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774325_LHBs_P-C      NKDHWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774253_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JX560520_LHBs_P-C      NKDHWPEANQVGAGAFGLGFTPPHGG----LLGWSPQAQGILTTVPAAPP
DQ089797_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGXLTTVPAAPP
AB670237_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964214_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964175_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964018_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KT364751_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KR014010_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013815_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVTPP
KC875263_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC793129_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792775_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774340_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774204_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JX125372_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAVPP
JQ341634_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGRSPQAQGILTTVPAAPP
EU075315_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTSVPAAPP
MG826127_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MG826126_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU964014_LHBs_P-C      NKDQWPEANQVGAGAFGPGLTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964012_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPVAPP
KU964004_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR819180_LHBs_P-C      NKDHWPEATQVGAGAFGSGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KM359441_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ598642_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC793107_LHBs_P-C      NKDHWPEANQVGAXAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC793051_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGTLTAVPAAPP
KC792817_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774191_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JX504541_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JX429914_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377624_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
GQ259588_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPSHGG----LLGWSPQAQGILTTVPAAPP
FJ899765_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562323_LHBs_P-C      NKDHWPEANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY881970_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881876_LHBs_P-C      NKDHWPEANQVGAGVFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881815_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470879_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KX276979_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU964332_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964331_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU964328_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU964324_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964322_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KU964321_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU964320_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU964319_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU964318_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU964213_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964212_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964211_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964210_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964209_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964208_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964207_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964206_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964204_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964201_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964171_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KT364752_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KT284757_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTAPSAPP
KR013876_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013799_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013776_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTSPHGG----LLGWSPQAQGILTTVPVAPP
KR013767_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KR013766_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KJ598769_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILATVPAAPP
KJ598768_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILATVPAAPP
KJ598659_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173328_LHBs_P-C      NKDHWPEANQVGVGAYGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173327_LHBs_P-C      NKDHWPEANQVGVGAYGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173305_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC793201_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC793019_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC792759_LHBs_P-C      NKDHWPEANQVGXGAFGPGXTPPHGG----LLGWSPQAQGILTTVPVATP
KC792746_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSXQAQGXLTTVPVTPP
KC774346_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQSQGILTTVPAAPP
KC774330_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774319_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774303_LHBs_P-C      NKDHWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGIVTTVPAAPP
KC774300_LHBs_P-C      NKDHWPAANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774280_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774242_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774231_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774225_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774208_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774207_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JX560519_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JX504542_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGIVTTVPAAPP
FJ386647_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386627_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPAAPP
LC090200_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY881890_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KY470885_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470875_LHBs_P-C      NKDHWPEADQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470873_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964172_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR014011_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013809_LHBs_P-C      NKDHWPEANQVGAGAFGPGITPPHGG----LLGWSPQAQGTLTTVPVAPP
KR013795_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ598713_LHBs_P-C      NKDHWPEANQVGAGAFGPGLTPPHGG----LLGWSPQAQGTLTTVPVAPP
KJ598712_LHBs_P-C      NKDHWPEANQVGAGAFGPGLTPPHGG----LLGWSPQAQGTLTTVPVAPP
KJ598709_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KJ598660_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ598641_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173332_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173331_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC875262_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC793202_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVTPP
KC793123_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGXLTTVPAAPP
KC793050_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC792834_LHBs_P-C      NKDQWPEANQVGAGAFGPXFTPPHGG----LLGWSPQAQXXLTTVPVAPP
KC792799_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774288_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774274_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774267_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILSTVPAAPP
JX661491_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY881969_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY470892_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470889_LHBs_P-C      NKNHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY363287_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTSTTVPAAPP
KY363253_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KX276964_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KX276838_LHBs_P-C      NKDHWSEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964177_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964077_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KR013877_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013875_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013872_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KF485390_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC793100_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGN----LLGWSPQAQGTLTTVPAAPP
KC793097_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792857_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792740_LHBs_P-C      NKDHWPGANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774301_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774254_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JX429913_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JQ341670_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPATPP
LC279253_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KX276984_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964215_LHBs_P-C      NKDHWPEANQVGAGAFGPGLTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964205_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964203_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964202_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964170_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964053_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964052_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964051_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964050_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964049_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KT284754_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR014015_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013814_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KR013813_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KR013808_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013801_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013800_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013796_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013792_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013777_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPAAPP
KR013765_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013764_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KR013763_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KR013762_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KM229703_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ803762_LHBs_P-C      NKDHWPEANQVGAGAFGPGFIPPHGG----LLGWSPQAQGILTTVPAAPP
KJ598753_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598716_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ598710_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KJ598703_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598686_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVATP
KJ598681_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ598679_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVATP
KJ598661_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ598639_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ598636_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ598635_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ410521_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173446_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173317_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173315_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KJ173314_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAVPP
KJ173313_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAVPP
KF053170_LHBs_P-C      NKDHWPEANQVGAGAFGPGFIPPHGG----LLGWSPQAQGILTTVPAAPP
KC793110_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792926_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KC792792_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792680_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KC792658_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774360_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774359_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774355_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774354_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774351_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774348_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----VLGWSPQAQGILTTVPAAPP
KC774347_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVVPP
KC774333_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774321_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774320_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774311_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774298_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774282_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774278_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----VLGWSPQAQGILATVPAAPP
KC774276_LHBs_P-C      NKDHWPEANQVGAGAFGPGITPPHGG----LLGWSPQAQGILTTVPVAPP
KC774271_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774270_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774268_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774224_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774218_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774199_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
JX429916_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JX125375_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAVPP
JX125374_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAVPP
JX125370_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JX125366_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JQ341658_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
LC279254_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KX276839_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964039_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU963929_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU963928_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU963927_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU963926_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU963925_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU963924_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU963923_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU963922_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU963921_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU963920_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU963919_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU963918_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU963917_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU963916_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU963915_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KR013834_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
KR013773_LHBs_P-C      NKDHWPKANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ598744_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598719_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KJ598718_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVSPP
KJ598717_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KJ598715_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KJ598714_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KJ598711_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KJ598708_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KJ598707_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KJ598705_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KJ410508_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173444_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173443_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173282_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KJ173281_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KC793003_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792961_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792911_LHBs_P-C      NKDXWPXAXQVGVGAFGPGFTPPHGG----LLGWSPQXQGILTTVPAAPP
KC792771_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774205_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
KC774182_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JX125371_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTMPATPP
JX125365_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
LC279259_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013833_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
KR013802_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013793_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KF485389_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC793024_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KC792968_LHBs_P-C      NKDXWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPXAPP
KC792923_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC792862_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792708_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774283_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
LC279250_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470930_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470929_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
KY363286_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KU964220_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KU964218_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964217_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KU964216_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KU964200_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964048_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964047_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964046_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964045_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964044_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964043_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964041_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964040_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964038_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964037_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964036_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964035_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964034_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964002_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963997_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963996_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963992_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KT284756_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR014012_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013873_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013832_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
KR013830_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
KR013829_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
KR013828_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
KR013812_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KR013811_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KR013810_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KR013807_LHBs_P-C      NKDHWPEANQVGAGAFEPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013774_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013772_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013771_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013768_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KR013761_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KP784761_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
KP027477_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ803765_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ790199_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ598754_LHBs_P-C      NKDHWPEANQVGAGAFWPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598752_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPAAPP
KJ598751_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598749_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPAAPP
KJ598748_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598747_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598746_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598745_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598743_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598742_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598741_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598740_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPAAPP
KJ598702_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598698_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598693_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598689_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598680_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173434_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173433_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173430_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173429_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173428_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173427_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173426_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173394_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
KJ173393_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
KJ173392_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KJ173391_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KJ173316_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173308_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KJ173307_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KJ173306_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173304_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KJ173296_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173294_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KJ173293_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KJ173288_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KF779242_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KF053172_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC793103_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC793035_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792999_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KC792965_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792962_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792941_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGXLTTVPVAPP
KC792940_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792921_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792803_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC792776_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792704_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792695_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792690_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792679_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792655_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774352_LHBs_P-C      NKDHWPGANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774345_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----VLGWSPQAQGILATVPAAPP
KC774342_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----VLGWSPQAQGILTTVPAAPP
KC774338_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774337_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----VLGWSPQAQGILTTVPAAPP
KC774336_LHBs_P-C      NKDHWPEANQVGAGAFGPGFSPPHGG----VLGWSPQAQGILATVPAAPP
KC774331_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774329_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774327_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774318_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KC774316_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774315_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774314_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774312_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774292_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774287_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774286_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774272_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774264_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774262_LHBs_P-C      NKDHWPEANQVGAGAFGPGFSPPHGG----VLGWSPQAQGILATVPAAPP
KC774261_LHBs_P-C      NKDHWPEANQVGAGAFGPGFSPPHGG----VLGWSPQAQGILATVPAAPP
KC774249_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774243_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774241_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774240_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774237_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774229_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774226_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774209_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774206_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774202_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774200_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----VLGWSPQAQGILATVPAAPP
KC774197_LHBs_P-C      NKDHWPEANQVGAGSFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774196_LHBs_P-C      NKDHWPEANQVGAGAFGPGFSPPHGG----VLGWSPQAQGILATVPAAPP
KC774192_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774190_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774187_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----VLGWSPQAQGILTTVPAAPP
JX661495_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JX661492_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JX504545_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JX504544_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JX429918_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JX429917_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JX429912_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
JX429909_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JX429906_LHBs_P-C      NKDHWPEANQVGAGSFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
JX125373_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JX026888_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JX026884_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
JQ688404_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JQ341665_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JQ341648_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ598706_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KC793074_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792873_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQXQGILTTVPAAPP
KC792716_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----XLGWSPQAQGXLTTVPAAPP
JQ341643_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JQ341610_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPAAPP
KU964226_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964054_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964055_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964056_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964057_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964058_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964059_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964060_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964061_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964062_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964063_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
FJ787448_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
EU939655_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU939656_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU093896_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPAAPP
EU670263_LHBs_P-C      NKDHWPEAWQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTSVPAAPP
EF536066_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KF053184_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGTLTTVPAAPP
KJ803777_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGTLTTVPAAPP
GQ377608_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU570073_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGKLTKAPVAPP
EU570074_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGKLTKVPVAPP
AB493844_LHBs_P-C      NKDHWPKANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939588_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGIVTTVPAAPP
FJ899778_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGIVTTVPAAPP
EU881996_LHBs_P-C      NKDPWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939644_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGD----LLGWSPQAQGILTTVPVAPP
AB367417_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB014385_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGALTTVPVAPP
KR013869_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ386589_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAPGILTSVPAAPP
FJ032356_LHBs_P-C      NKDHWPVANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB367427_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377553_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ787452_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
FJ562292_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ386602_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGSSPQAQGILTTVSTAPP
EU916234_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU579443_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
EU086837_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AF458665_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILSTVPVAPP
AB113879_LHBs_P-C      NKDHWPESNQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU086847_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGLSTPVPAAPP
EU086843_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGISTTVPAAPP
EU086844_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLSTPVPAAPP
EU086845_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGLSTPVPAAPP
EU086846_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGLSTPVPAAPP
GQ377628_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ899788_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562255_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTPVPAAPP
FJ386620_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGTLTTVPAAPP
FJ386611_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPAAPP
FJ386603_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
FJ032355_LHBs_P-C      NKDHWPVANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU871979_LHBs_P-C      NKDRWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU093915_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
DQ922649_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AY167096_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377599_LHBs_P-C      NKDHWPEANQVGAGAFGPGLTPPHGG----LLGWSPQAQGTLTTVPAAPP
FJ899789_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562266_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU939607_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU547562_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGRSPQAQGILTTVPAAPP
AB900099_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
GQ377623_LHBs_P-C      NKDRWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAATP
GQ377621_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPGAPP
GQ377600_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377528_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAEPP
FJ899776_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ787486_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715397_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTSVPAAPP
FJ715395_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTSVPAAPP
FJ562308_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ562293_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ562244_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ562241_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939617_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939615_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939604_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU939562_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939545_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU871977_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
EU717212_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPAAPP
EU560441_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU093914_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU093912_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU093898_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU082435_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EF536065_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
DQ980547_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
DQ975273_LHBs_P-C      NKDHWPGATQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
DQ922651_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
DQ478900_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AY206381_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AF384371_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013867_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
GQ377570_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377517_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715372_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPSHGG----LLGWSPQAQGILTTVPAAPP
FJ386689_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386577_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTSVPVAPP
EU939546_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
EU916219_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
DQ922650_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
DQ478885_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013864_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013862_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
KR013769_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JQ040155_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562301_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562242_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
EU939612_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
D23681_LHBs_P-C        NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881888_LHBs_P-C      NKNHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
GQ475350_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475332_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475329_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475328_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475322_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475317_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475305_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377642_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
GQ377640_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
GQ377637_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
GQ377619_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
GQ377618_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377617_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
GQ377597_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
GQ377585_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377579_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
GQ377575_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
GQ377574_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
GQ377554_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377546_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
GQ377545_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377521_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
GQ377515_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
FJ715422_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715400_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPSHGG----LLGWSPQAQGILTTVPAAPP
FJ715398_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPSHGG----LLGWSPQAQGILTTVPAAPP
FJ715392_LHBs_P-C      NKDHWPEANQVGAGAFRPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715371_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPSHGG----LLGWSPQAQGILTTVPAAPP
FJ715367_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715366_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715358_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
FJ715357_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
FJ715355_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
FJ562329_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ562327_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ562318_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562275_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
FJ562274_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
FJ562238_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ562235_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ562233_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562218_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386678_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386639_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386625_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386618_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ386576_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
FJ386574_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ032361_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ032359_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ032331_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939613_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU939610_LHBs_P-C      NKDHWPGANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
EU939593_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939592_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939540_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939538_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU916233_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU916222_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU916210_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU871982_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU562218_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU093918_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU093917_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU093916_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU093913_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU093911_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHSG----LLGWSPQAQGILTTVPVAPP
EU093910_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU093909_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU093908_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU093907_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU093895_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU093883_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU082432_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU082431_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU082430_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU082429_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU082428_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU075342_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU075338_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU075335_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
EU075334_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
DQ993693_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
DQ993692_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
DQ993691_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AY641560_LHBs_P-C      NKDHWPEANQVGVGTFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB675677_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670311_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB670305_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013804_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JX504539_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JQ040166_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPAAPP
FJ899761_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562284_LHBs_P-C      KKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670289_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
FJ386657_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
HQ700569_LHBs_P-C      NKDQWPEPNQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
X75665_LHBs_P-C        NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HQ700504_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HQ700502_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HQ700545_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HQ700556_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JN604222_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HQ700564_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
HQ700563_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HQ700573_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HQ700570_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HQ700562_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPAAPP
HQ700565_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HQ700577_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
HQ700457_LHBs_P-C      NKDQWPEANQVGVGAFGPGLTPPHGG----LLGWSPQAQGXLTTVPTAPP
HQ700490_LHBs_P-C      NKDQWPEANQVGVGAFGPGLTPPHGG----LLGWSPQAQGILTTVPTAPP
HQ700456_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
HQ700475_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTATP
HQ700571_LHBs_P-C      NKDQWPEANQVGAGAFGPXFTPPHGG----LLGWSPQAQGILTTVPTAPP
HQ700575_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
HQ700566_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
HQ700495_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTLPAAPP
HQ700572_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
HQ700561_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
HQ700559_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
HQ700555_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
HQ700558_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
HQ700496_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTLPAAPP
HQ700544_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
HQ700567_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPXAPP
HQ700576_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGXXTTVPTAPP
AB900113_LHBs_P-C      TKDQWPEAHQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPTAPP
FJ787447_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
KC792880_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTXVPAAPP
AY167099_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
FJ562313_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
FJ386653_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPAAPP
AB971714_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB971715_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562335_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTAPAAPP
FJ386598_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AY167091_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGTLTTVPAAPP
AB111124_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB111125_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB246344_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB300362_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AF458664_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
GQ475346_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
KC792793_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
AY206386_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
DQ089802_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
EU882005_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KC792713_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KC792739_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
DQ089801_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
FJ562298_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964020_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964021_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964022_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964023_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964024_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964025_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964026_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964027_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964028_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964029_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964030_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964031_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964032_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KU964033_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
KC792762_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
FJ386626_LHBs_P-C      NKDHWAEAEQVGAGAFGPGFTLPRSS----LLGWSPQAQGTLTPPAAAPP
GQ358153_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
EU871974_LHBs_P-C      NKDHWPEANQVGAGAFGPGVNPPHSG----LLGWSPQAQGILTTVPVAAP
EU871970_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGGSPQAQGTLTTVPVAPP
EU871972_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGGSPQAQGILTTVPVAPP
AF182803_LHBs_P-C      NKDHWPEANQVGAGAFGPGVTPPHGG----LLGWSPQAQGILTTVPVAPP
EU871969_LHBs_P-C      NKDHWPEANQVGAGAFGPGVTPPHGG----LLGWSPQAQGILTTVPVAPP
HQ700522_LHBs_P-C      NKDRWPEANQVGTGAFGPGFTPPHGG----LLGWSPLAQGTLTTVPAAPP
HQ700543_LHBs_P-C      NKDHWPEANQVGTGAFGPGFTPPHGG----LLGWSPLAQGTLTTVPAAPP
FJ562299_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386601_LHBs_P-C      NKDHWPEANHVGAGAFGPGFTPPHGG----LLGGSPHAQGILTTMPISPP
AF182802_LHBs_P-C      NKDHWPEANQVGAGAFGPGVTPPHGG----LLGRSPQAQGTLTTVPVAPP
AB014365_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPSAPP
KJ717822_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ803810_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
EU939596_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
FJ787450_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
EU871973_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGRSPQAQGILTTVPVAPP
FJ715405_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715406_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
D28880_LHBs_P-C        NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGALTTVPVAPP
S75184_LHBs_P-C        NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGALTTVPVAPP
EU939659_LHBs_P-C      NKDHWPEAHQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
DQ890381_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ717821_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KJ803809_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
AB675674_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWGPQAQGILTTVPAAPP
AB675675_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWGPQAQGILTTVPAAPP
JQ027322_LHBs_P-C      NKDHWPXANQVGAGAFGPGXTPPHGG----LXGWSPQAQGTLTTVPAAPP
FJ787466_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AF411412_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPVAPP
AB670238_LHBs_P-C      NKDHWPEANQVGAGALGPGFTPPHGG----LLGWSPQXQGILTTVPAAPP
AB014391_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGALTTVPVAPP
AB014382_LHBs_P-C      NKDHWPEANQVGAGAYGPGVTPPHGG----LLGWSPQAQGTLTTVPVAPP
GQ377620_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGRSPQAQGMLTTVPAAPP
FJ715360_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPVAPP
FJ715416_LHBs_P-C      NKDHWPEANQVGAGAFGPGLTPPHGS----LLGWSPQAQGILTTVPVAPP
FJ386613_LHBs_P-C      NKDHWPEANQVGAGAFGSGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670274_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ372968_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
FJ899772_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ787467_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715415_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----PLGWSPQAQGILTTVPAAPP
FJ386624_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
FJ032350_LHBs_P-C      NKDHWPEANQVGAGAFGPGSTPPHGG----LLGWSPQAQGTLTTVPVAPP
DQ089787_LHBs_P-C      NKDQWPAANQVGVGSCVSRFIPAHGH----LVGWSPQAQGILTTVPAAPP
AB367401_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPAAPP
KJ598666_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598678_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598663_LHBs_P-C      NKDHWPVANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598665_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598667_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598668_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598669_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598671_LHBs_P-C      NKDHWPAASQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598672_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598673_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598674_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598676_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598677_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598664_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598731_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGTLTTVPAAPP
KU964229_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGTLTTVPAAPP
FJ562300_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU963904_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU964242_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU964241_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU964240_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU964239_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU964237_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGTLTTVPAASP
KU964235_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU964234_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU964233_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU964232_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU964231_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU964230_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598739_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598738_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598737_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598736_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598735_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598734_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598733_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598732_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598730_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598729_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598728_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598727_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598725_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGTLTTVPAASP
KJ598724_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598723_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598722_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ598721_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KJ173333_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ412089_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAVPP
KU963914_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU963913_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU963912_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU963911_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU963910_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU963909_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU963908_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU963907_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU963906_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU963905_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU963903_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU963902_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU963901_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KU963900_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774235_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KY670782_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JX504537_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPASPP
KY629631_LHBs_P-C      NKDHWPAANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MG826132_LHBs_P-C      NKDHWPKANQVGVGAFGPGFTPPHGG----LLGWSPQAQGTLTPVPAAPP
JF828923_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562228_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVVPP
FJ386623_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPTAPP
FJ032351_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
EU939597_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AY220699_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
AB670259_LHBs_P-C      NKDHWPEANXVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB106895_LHBs_P-C      NKDQWTGALQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
JN604231_LHBs_P-C      NKDHWPEANQVGXGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386604_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU919168_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
DQ377164_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB931170_LHBs_P-C      TKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGKLTSMPAAPP
AB670279_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGD----LLGWSPQAQGILTTVPAAPP
FJ715351_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----PLGWSPQAQGILTTVPAAPP
FJ715368_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----PLGWSPQAQGILTTVPAAPP
FJ715390_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----PLGWSPQAQGILTTVPAAPP
FJ715391_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----PLGWSPQAQGILTTVPAAPP
FJ715418_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----PLGWSPQAQGILTTVPAAPP
KX276963_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGTLTTVPAAPP
FJ715359_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
FJ562334_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562310_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
FJ562264_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386661_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPVAPP
EU939647_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
EU560439_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AY306136_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB931171_LHBs_P-C      TKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGKLTSMPAAPP
AB900109_LHBs_P-C      TKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQTQGILTTVPAAPP
AB111119_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGALTTVPVAPP
GQ377631_LHBs_P-C      NKDHWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
GQ377526_LHBs_P-C      NKDHWPEANQVGSGAFGPGFTPPHGG----LLGWSPQAQGISTTVPVAPP
FJ899773_LHBs_P-C      NKDHWPQANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILATVPVAPP
FJ787437_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ715364_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715344_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGIVTTVPVTPP
FJ562268_LHBs_P-C      NKDHWPEANQVGAGAYGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562248_LHBs_P-C      NKDHWPEANQVIPGKFGPGFTPLHDG----LLGWSPQAQGILTTVPAAPP
FJ518813_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ386673_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVSPP
FJ386644_LHBs_P-C      NKDHWPEANYPGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
FJ386614_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGN----LLGWSPQAQGILTTVPVAPP
EU939657_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU939649_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU871975_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LMGWSPQAQGTLTTVPVAPP
EU871971_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU086842_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGD----LLGWSPQAQGMLTTVPAAPP
AF461358_LHBs_P-C      KKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AF461359_LHBs_P-C      KKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB670260_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670242_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB485810_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY881968_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KU964064_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KR013851_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KM875423_LHBs_P-C      NKDHWPEADQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ173309_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
GQ377586_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377577_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ358158_LHBs_C-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715421_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715381_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715352_LHBs_P-C      NKDHWPEAIKVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ715343_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGIVTTVPVTPP
FJ562319_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386672_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPQHGG----LLGWSPQAQGILTTVPAAPP
FJ386630_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
EU939648_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
EU939618_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVVTTVPVAPP
EU939601_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU919169_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
EU554535_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
DQ683578_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AY641561_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AY596107_LHBs_P-C      NKDHWPEAHQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AY206382_LHBs_P-C      NKDHWPKANQVGAGAFGPGFTPPRGG----LLGWSPQAQGILTTVPAAPP
AB697510_LHBs_P-C      NKDHWPEAHQVEAGAFGPGFTPPHGG----LLGWSPQAQGMLTSVPAAPP
AB697490_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670306_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670298_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670277_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670275_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670267_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAPGILTTVPAAPP
AB176642_LHBs_P-C      NKDQWPEANQVGAGAFGPGFAPPHGG----LLGWSPQAQGILTTVPAAPP
AB014377_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB485808_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB014360_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
AB014379_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGALTTVPVAPP
FJ386670_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
GQ377557_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377555_LHBs_P-C      NKDHWPAANQVGAGAFGPGLTPPHGG----LLGWSQQAQGTLTTVPAAPP
FJ715365_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715342_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGIVTTVPVTPP
FJ386592_LHBs_P-C      NKDHWPEANQVGAGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
FJ386591_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
FJ032340_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
DQ536412_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AY641559_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQARGIVTPVPAAPP
AF533983_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY470891_LHBs_P-C      NKDHWPEANQVGAGAFGPGLTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173321_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173319_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPVAPP
KC774255_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774238_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
JQ027323_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGXSPQAQGTLTTVPAAPP
JN604254_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPAAPP
JN604133_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JF828937_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475348_LHBs_P-C      NKDQWPEANQVGAGAFGPGSTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377529_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGTLTTVPAAPP
GQ358157_LHBs_P-C      NKDHWPKAHQVGTGSFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
FJ787465_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ787464_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715353_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ562320_LHBs_P-C      NKDHWPEAHQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562315_LHBs_P-C      NKDHWPEANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
FJ562261_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ562252_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ386664_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
FJ386662_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386595_LHBs_P-C      NKDHWPEANQVGAGTFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ032341_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
EU939651_LHBs_P-C      NKDHWPEANQVGTGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939626_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
EU939625_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
EU939570_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPVAPP
EU871976_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
D12980_LHBs_P-C        NKDHWPDGIKVGAGDFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AF286594_LHBs_P-C      NKDHWPDGIKVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB697502_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB670295_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB367418_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY363283_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013853_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ598638_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173436_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173435_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173302_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173301_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774343_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774309_LHBs_P-C      NKDHWPEANQVGAGAFGLGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774290_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774289_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILKTVPAAPP
JX661489_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JX429915_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JN604281_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILATVPAAPP
JN604131_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JN315779_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JF828928_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JF828922_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
HM750137_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ872211_LHBs_P-C      NKDHWPEATQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475339_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475338_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475336_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475321_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475318_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPAAPP
GQ475310_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475309_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAATP
GQ377609_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
GQ377584_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
GQ377578_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
GQ377559_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377541_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVSAAPP
GQ377540_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715409_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715402_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562325_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGXLTTVPAAPP
FJ562291_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562288_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562232_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386679_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
FJ386671_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
FJ032346_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939582_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
EU939572_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
EU939566_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939561_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU939548_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
EU554540_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
EU306728_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU306726_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU306721_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU306720_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU306719_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
DQ377165_LHBs_P-C      NKDHRPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
D23684_LHBs_P-C        NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGALTTVPVAPP
AY596108_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AY206384_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AP011098_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB900115_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGD----LLGWSPQAQGILTTVPAAPP
AB670310_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670307_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB670297_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAPGILTTVPAAPP
AB670291_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670285_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670282_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB670281_LHBs_P-C      NKDHWPEANQVGAGAFGAGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670276_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
AB670263_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPSHGG----LLGWSPQAQGILTTVPASPP
AB670258_LHBs_P-C      NKDQWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPAAPP
KY363278_LHBs_P-C      NKDHWPEAKQVGVGAFGPGLTPPHGG----LLGWSPQAQGTLTTVPAAPP
JX429907_LHBs_P-C      NKDHWPEAHRVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JQ040141_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTAXPAAPP
JN604148_LHBs_P-C      NKDHWPEANQVGAGAFGPGLTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ787456_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
FJ562285_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562256_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
EU939603_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLSTVPVAPP
EU939585_LHBs_P-C      NKDHWPEASQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
AB670269_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KY881941_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
KY881918_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGC----LLGWSPQAQGTLTTVPVAPP
KY470899_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTAPVAPP
KY470895_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTAPVAPP
KC793195_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPVAPP
KC774308_LHBs_P-C      NKDHWPKANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774302_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
KC774250_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
GQ475355_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGX----LLGWSPQAQGILTTVPAAPP
GQ377616_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
GQ377552_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377530_LHBs_P-C      NKDHWPEANQAGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
FJ386632_LHBs_P-C      NKDHWPEANQVGAGXFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ386607_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPAAPP
EU939640_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
EU939611_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
EU939595_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPIAPP
EU939550_LHBs_P-C      NKDHWPEAHQVGTGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
MG893556_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWNPQAQGILTTVPAAPP
KY470883_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KU964199_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964198_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964197_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964196_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964195_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964194_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964193_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTMPVAPP
KU964192_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964191_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964190_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964189_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964188_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964187_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964186_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964185_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU964078_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964075_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964074_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964073_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964072_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964071_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964070_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964069_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964068_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964067_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964066_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU964065_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KU963899_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963898_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963897_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963896_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963895_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963894_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963893_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963892_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963891_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963890_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963889_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963888_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963887_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963886_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963885_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963884_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963882_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963881_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963880_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963879_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963878_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963877_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963876_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963875_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963874_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963873_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963872_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KU963871_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KT284759_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KR013923_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
KR013850_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013778_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPAAPP
KJ173440_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173439_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173337_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173310_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173289_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173287_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ173284_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ173283_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774361_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774357_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774339_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774293_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774266_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774265_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774260_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILSTVPAAPP
KC774251_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774248_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774247_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774239_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774233_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774220_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774219_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774195_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774194_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774185_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774184_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774181_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JX661490_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JX661488_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JX504546_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JX429904_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JQ341662_LHBs_P-C      NKBHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JQ341636_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JQ040172_LHBs_P-C      NKDHWPEANQVGAGSFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JQ040162_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
JN604215_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
JN400089_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPAAPP
JN400088_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPAAPP
JN400087_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPAAPP
HM750138_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ872210_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLRWSPQAQGILTTVPAAPP
GQ475357_LHBs_P-C      NKDHWPEANQVGXGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475354_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475349_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475345_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475344_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475341_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475337_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475331_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475324_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475323_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475320_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475319_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475315_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475314_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475313_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475312_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475311_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475308_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475307_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475306_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377598_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377583_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
GQ377576_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGMLTTVPAAPP
GQ377563_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377551_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPIAPP
GQ377527_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ377524_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ715403_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715383_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715382_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715370_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ715350_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562333_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562332_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562330_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ562283_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ562279_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGVLTTVPVAPP
FJ562230_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386619_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ386609_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
FJ386587_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386575_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939652_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939591_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU939590_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU562217_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU562215_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
DQ536410_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
DQ089793_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
D50518_LHBs_P-C        NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
D50517_LHBs_P-C        NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AY641558_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLLTTVPAAPP
AF461363_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AF461357_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB697500_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670292_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670288_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670287_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670283_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AB670278_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTAPAAPP
AB670256_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KY470894_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KC774216_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KC774215_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ787455_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGS----PLGWSPQAQGILTTVPVAPP
FJ562324_LHBs_P-C      NKDHWPQANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
AB670252_LHBs_P-C      NKDHCPEANQVGAGAFGPGFTPPXGG----XLGWSXQAQGXLXTVPAAPP
FJ562225_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KF779327_LHBs_P-C      NKDQWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPTAPP
KF779300_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KR013903_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KY470937_LHBs_P-C      NKDQWPAANQAGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
MF925369_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWSPQAQGILTTVPAAPP
FJ386612_LHBs_P-C      NKDHWPKANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
HQ700506_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ899763_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ899775_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EF137803_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
AY641563_LHBs_P-C      NKDHWPEANQVGVGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
GQ475353_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ598644_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ032333_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
FJ386665_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU872012_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
KJ598646_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ598688_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----IFGWSPQAQGILTTVPVAPP
KJ598690_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598691_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598695_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598696_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598697_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
KJ598701_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----ILGWSPQAQGILTTVPVAPP
AB670290_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAALP
KJ173441_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
KJ598652_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQDILTTVPAAPP
KJ598656_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
EU086839_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPVAPP
AB074047_LHBs_P-C      NKDQWPAANQVGVGSFGPGFTPPHGS----LLGWGPQAQGILTTVPAAPP
FJ899783_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGIMTTAP-APP
KJ410505_LHBs_P-C      NKDQWPAAHQVGVGSFGPGFTPPHGN----LLGWSPQAQGILTTVPAAPP
KF214652_LHBs_P-C      NKDQWPEANQVGAGAFGPGYTPPHGG----LLGWSPQAQGILTTVPAAPP
KC792656_LHBs_P-C      HKAHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGLVTTVPVAPP
FJ386594_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGTLTTVPVAPP
EU086840_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGISTTVPAAPP
EU086841_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGISTTVPAAPP
HM011481_LHBs_P-C      NKDHWPEANQVGAGAFGPGFTPPHGG----LLGWSPQAQGILTTVPAAPP
                                               .                         

DQ089795_LHBs_P-C      SASTNRQSGRQPXPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB115417_LHBs_P-C      PATTNRQTRRQPTTISPPLIDSHPQAMQWNSTTFHQALLDPKLRGLYFPA
EU498227_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHKALLDPRVRGPYFPA
AY206376_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQALKWNSTTFHQALLDPKVRGLYFPA
AY206379_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQALKWNSTTFHQALLDPKVRGLYFPA
AB014378_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPKVRGLYLPA
KJ410492_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ410499_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MG571359_LHBs_P-C      TASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ717839_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPA
KJ803823_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPA
JQ801491_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLDFPA
GQ924636_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ027318_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KF053173_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHQALLDPRVRGLYLPA
KJ803766_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHQALLDPRVRGLYLPA
JN827424_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JN827425_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
MG826140_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLGPKVRGLDLPA
KC793046_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLNPKVRGLYFPA
DQ089785_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVRWNSSTFHQALLDPRVRGLYFPA
KX276841_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JN604243_LHBs_P-C      PASTTRQSGRQPTPISPPLRDSHPQVAQWNSSTFHQALLDPRVRGLYLPA
DQ089780_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNXSTFHQALLDPRVRGXYLPA
DQ089771_LHBs_P-C      PASTNRRSGRQPTPITPPLRDSHPQAIQWNSSTFHQALLDPRVRGLYFPA
KY470914_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341626_LHBs_P-C      PASTNRQSGRQPTPIXPPLRBSHPQAMQWNSSTFHQALLDPKVRGLYLPA
KF053164_LHBs_P-C      SASTNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHQTLKDSRVRGLNFPA
KJ803757_LHBs_P-C      SASTNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHQTLKDSRVRGLNFPA
KY363254_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSPTFHQALLDPRVRGLYLPA
JQ027321_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSNTFHQALLDPRVRGLYFPA
HM011495_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089803_LHBs_P-C      PASTNRQSRRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089762_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSRTFHQALLDPRVKGLYFPA
AB112471_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF925403_LHBs_P-C      PASTTRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX276854_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR013822_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVKGLYFPA
KJ803818_LHBs_P-C      PASTNRTPGRPPTPISPPLRDSRPPAMFWNSLTFHQALLDPRVRGLYFPA
JN827421_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
MF674390_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX276848_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMKWNSSTFHQALLDPRVRGLYFPA
KX276846_LHBs_P-C      PASTNRQSGRQPTPISPPLRDXHPQAMQWNSSTFHQALLDPRXRGXXFPA
KJ410515_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMKWNSSTFHQALLDPKVRGLYFPA
KJ173285_LHBs_P-C      PASTTRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
GQ377605_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
FJ023648_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIKWNSSTFHQALLDPRVRGLYIPA
KR013835_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR013836_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR013839_LHBs_P-C      PASTNRQSRRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR013838_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674489_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMKWNSRTFHQALLDPRVRGLYFPA
KR013820_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSGTFHQALLDPRVRGLYFPA
KJ410494_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341614_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPA
HM011491_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089804_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089786_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MG826122_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF925395_LHBs_P-C      PASTKRQSGRQPTPISPPLRDSHPQAMQWNSNTFHQALLDPRVRGLYFPA
KX765823_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR013837_LHBs_P-C      PASTNQQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148481_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHRALLDPRVRGLYFPA
KJ410518_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KF214673_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KC315399_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JX870000_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JN604129_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JN604121_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHQALLDPRVRGLYVPA
GQ924616_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AB112472_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
FJ023641_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
FJ023642_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR013856_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHLQAMQWNSSTFHQALLDPRVRGLYFPA
KP148526_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148476_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KC774284_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
JQ801472_LHBs_P-C      SASTNRQSGRQPTPISPPLRESHPQAMQWNSSTFHQALLDPRVRGLYLPA
JF899336_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSSTFHQALLDPRVRGLYFPA
EF384206_LHBs_P-C      PASXNRQSGRQPTPISPPLRDSHPQAXQWNSTTFHQALLDPRVRGLYFPA
MF925378_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765849_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ717791_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ410491_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KC875264_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPTVRGLYFPA
KC774285_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ801481_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPKVRGLYFPA
JQ027317_LHBs_P-C      PASTNRQSXRQPTPISPPLRDSHPQAXQWNSSTFHQALLDPRVRGLYXPA
GQ924649_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF925394_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674494_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KY470918_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KY470910_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765827_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765825_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX276847_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KU051424_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KT987423_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR013905_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR013840_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR013826_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPA
KR013824_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPRAMQWNSSTFHQALLDPRVKGLYFPA
KR013821_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVKGLYFPA
KM875429_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ803779_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSPTFHQALLDPRVRGLYFPA
KJ410496_LHBs_P-C      PASTNRQSGRQPTPISPPLRNSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ410495_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ410489_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ173324_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KF214667_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPA
JQ341660_LHBs_P-C      PASTNRQTGRQPTPISPPLRDSHPQAXQWNSSXFHQALLDPRVRGLYVPA
JN604286_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
HM011472_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
HM011468_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765850_LHBs_P-C      PASSNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765848_LHBs_P-C      PASSNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765845_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765821_LHBs_P-C      TASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR013902_LHBs_P-C      PASTNRQSGGQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR013770_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148477_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGIYFPA
KP148472_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGIYFPA
KJ410504_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801501_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801497_LHBs_P-C      PASSNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801495_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAWKWNSSTFHQALLDPRVRGLYLPA
JN604232_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341633_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341639_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MK818227_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MG571335_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765852_LHBs_P-C      PASTNRQTGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765842_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHKALLDPRVRGLYFPA
KR013899_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR013819_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
KR013817_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
KM875428_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KM875406_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ410519_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ173323_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KF214670_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHQALLDPRVRGLYLPA
KF053185_LHBs_P-C      PASTNRQSGRKPTPISPPLRDSHPQAMQWNSSTFHQALLDPKVRGLYFPA
KC875270_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPKVRGLYFPA
KC774227_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KC774221_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
MG826123_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MG725248_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MG571332_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF925408_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674502_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674501_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674484_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674472_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674468_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674454_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674442_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674435_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQTLLDPRVRGLYFPA
MF674412_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674402_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674398_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674388_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674386_LHBs_P-C      TASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KY470916_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX774503_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765844_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765836_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765830_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNTSTFHQALLDPRVRGLYFPA
KX765819_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPKVRGLYFPA
KX276851_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KU051423_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR013857_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR013854_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KM875404_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ803799_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ803793_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ803761_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ803759_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ717810_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ717803_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ410513_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ410501_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ410493_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KF053169_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KF053167_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KC774236_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JX507212_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSSTFHLALLDPRVRGLYFPA
JQ801522_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801519_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801513_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801511_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801505_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801475_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ688403_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341663_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ027324_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JN604256_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JN604182_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
HM011497_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MH220971_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPA
MF925374_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPA
MF925359_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPA
MF674463_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQXLLDPRVRGLYFPA
MF674418_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KM875424_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVKGLYFPA
KC792927_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
JQ801502_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801498_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHQALLDPRVRGLYLPA
JQ341652_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHXXXXXXXXXXXXXPA
HM011488_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF925410_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF925376_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF925375_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674486_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQTLLDPRVRGLYFPA
MF674471_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSSTFHQALLDPRVRGLYFPA
MF674457_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674429_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQVLLDPRVRGLYFPA
MF674428_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674417_LHBs_P-C      PASTKRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674408_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPKVRGLYFPA
MF674399_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765824_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765822_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KT347089_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KF053176_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPKVRGLYFPA
JQ341669_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYXPA
JQ341621_LHBs_P-C      PASTNRQSGRXPTPISPPLRDSHPQAXQWNSSTFHQALLDPXVRGLYXPA
JQ341657_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQAXXXXXXXXXXXXA
JQ341649_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPXAXQWNXXTFHQALLDXKVRGLYFPA
MG571345_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSRTFHQALLDPRVRGLYFPA
AB112348_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLEPRVRGLYFPA
AB112065_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KF053187_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTAFHPALLDPRVRGLYFPA
KJ803780_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTAFHPALLDPRVRGLYFPA
AB112066_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF925409_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSNTFHQALLDPRVRGLYFPA
KR013823_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMKWNSSTFHQALLDPRVRGLYFPA
JQ341620_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQTLLDPRVKGLYFPA
MF925398_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KF214671_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSSAFHQTLLDPRVRGLYFPA
EU305540_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089790_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801493_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ027320_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
FJ023645_LHBs_P-C      PASTNRQSRRRPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674444_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148567_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148492_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ803812_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ717825_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KY470915_LHBs_P-C      PASTNRQSGRQPTPISPPLRGSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KY470913_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR014021_LHBs_P-C      PASTNRQSGRQPTPTSPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148563_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148474_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPT
KJ803813_LHBs_P-C      PASTIRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ717826_LHBs_P-C      PASTIRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ410511_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSRTFHQALLDPRVRGLYLPA
KC875272_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KC875267_LHBs_P-C      PASTNRQSGRQPTPISPPLRDRHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341622_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JN827420_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HM011486_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVXWNSSTFHQALLDPXVRGLYFPA
KT364719_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KC774189_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ341650_LHBs_P-C      TASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341624_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KT366464_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLY--A
MF674514_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674504_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674467_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674458_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674430_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674425_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765834_LHBs_P-C      PASTXRQSGRQPTPISPPLRDSHPQAMQWNSNTFHQALLDPRVRGLYFPA
KP148575_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLCFPA
KP148566_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148560_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148559_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQTLLDPRVRGLYFPA
KP148557_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148546_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148532_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQDMQWNSSTFHQALLDPRVRGLYFPA
KP148524_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148521_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148513_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148512_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148489_LHBs_P-C      PASTNRQSRRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148475_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148466_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148465_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148464_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148463_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148315_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JX504535_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801488_LHBs_P-C      PASTNRQTGRQPTPISPPLRDSHPQAMQWNSRTFHQALLDPRVRGLYFPA
JQ341661_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPKVRGLYFPA
JQ341642_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674475_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KY629637_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KP148534_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148531_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148525_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ173286_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JX507214_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801515_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KP148548_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWSSSTFHQALLDPRVRGLYFPA
KP148537_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ410514_LHBs_P-C      PASTNRQSRREPTPISPPLRDSHPQAIQWNSNTFHQALLDPRVRGLYFPA
JQ341630_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF925377_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674474_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR013900_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KR013825_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSGTFHQALLDPRVRGLYFPA
KP148574_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148573_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148572_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148571_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148570_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148568_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148564_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148562_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148561_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148558_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148555_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148554_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148552_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148551_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148549_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148547_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148545_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148543_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148540_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148538_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148535_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148530_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148529_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148528_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148523_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148520_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148519_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148517_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148514_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDSRVRGLYFPA
KP148488_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148482_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148480_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148479_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148471_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148469_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148468_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148462_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KM875405_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ173438_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173437_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC875274_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341664_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPXAMQWNSSXFHQALLDPRVRGLYFPA
JQ341655_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAXQWNSSTFHQXLLDPRVRGLYFPA
JQ341654_LHBs_P-C      XASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341653_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQALQWXXGTFHQALLDPRGRGLYFPA
JQ341644_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341637_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765847_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX276840_LHBs_P-C      PASTNRQSGRXPTPISPPLRDSHPQAMQWNSSTFHQXLLDPRVRGLYFPA
KR013855_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148473_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KF053193_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSNTFHTALLDPRVRGLYFPA
JX507211_LHBs_P-C      TASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ341617_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JN604118_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341618_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX276853_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341641_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF674403_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765853_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765826_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX276852_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ717809_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801518_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801490_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341659_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341651_LHBs_P-C      PASTNRQSGRQPTPXSPPLRDSHPQAIQWNSSTFHQALIDPRVRGLYFPA
JQ801482_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341628_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAXQWNSXTFHQALTDPRVRGLYFPA
JQ341631_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQXNSSTFHQALLDPRVRGLYFPA
KJ803792_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765828_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KT364720_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MG826143_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLDLPA
KY470936_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KY470920_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KY470917_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KY470909_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KY470907_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX774504_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765843_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KF214676_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KF214668_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KC875273_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KC875269_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801523_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801504_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801503_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801470_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JN604153_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KY470912_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KY470906_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDHRVRGLYFPA
KX765855_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX276844_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF925406_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF925405_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF925387_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765851_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDSRVRGLYFPA
KX765846_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765840_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765838_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765837_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765833_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765832_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765831_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765829_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765820_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX765818_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KU051425_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KT987424_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KT366463_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KT364721_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ803815_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ803811_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ803800_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ717828_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ717823_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ717812_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ717811_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KC875271_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KC875265_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KC774228_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801520_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801500_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801496_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801486_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ801473_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JN827422_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JN604151_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KT364718_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KT987426_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KT987425_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KT307718_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KT307719_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KU051426_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KU051427_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF925367_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MF925365_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KX276850_LHBs_P-C      PASTNRQSXRQPTPISPPLRDSHPQAXQWNSSAXHQALLDPRVRGLYFPA
KX774506_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341635_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWXXXXXXXXXXXXXXXGPYLLA
KF053177_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPKVRGLYLPA
KJ803770_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPKVRGLYLPA
JN604135_LHBs_P-C      PASTKRQSGRQPTPISPPLRDSHPHAMQWNYRTFHQALLDPRVRDLCFPA
KF053168_LHBs_P-C      PASTTRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ803760_LHBs_P-C      PASTTRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089767_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALIDPRVRGLYFPA
DQ089768_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSSTFHQALIDPRVRGLYFPA
KF053161_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHNALLDPRVRGLYFPA
KJ803754_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHNALLDPRVRGLYFPA
KJ717844_LHBs_P-C      PASTNRQTGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDARVRGLYFPA
KJ803826_LHBs_P-C      PASTNRQTGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDARVRGLYFPA
KF053183_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ803776_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ478901_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089773_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSKTFHQALLDPRVRGLYLPA
AB117758_LHBs_P-C      PASTNRQSGRQPTPICPPVRDSHTQAMLWNSATFHQALLDPRVRGLYFPA
KP148483_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KP148491_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
GQ924643_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSHTFHQAVLNPKVRGLYFPA
DQ089778_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSNTFHQALLDPRVRGLYFPA
DQ089775_LHBs_P-C      PASTKRQPKRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AB031262_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
EU305541_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYVPA
DQ089788_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPA
JN827423_LHBs_P-C      PASSNRQSGRQPTPISPPLRDSHPQAMQWNSSIFHQALLDPRVRGLYFPA
KR013841_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
GQ184326_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
EF494379_LHBs_P-C      PAPTNRQSGRQPTPISPPLRDSHPQAVQWNSNTFHQALLDPRVRGLYLPA
DQ089783_LHBs_P-C      PASTNRQSGRKPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPA
AF223960_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYVPA
GQ924612_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPA
GQ924613_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPA
JN827418_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSNTFHQALLDPRVRGLYYPA
JN604147_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
GQ924650_LHBs_P-C      TASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
GQ924614_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
EU306691_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
EU306689_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
EU306688_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
EU306685_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
EU306687_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
EU306690_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
EU306694_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ246215_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089777_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089776_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089772_LHBs_P-C      PASTNRQSGRKPTPISPPLRDSHPQAMQWNSSTFHQTLLDPRVRGLYFPA
DQ089770_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089763_LHBs_P-C      AASTNRQSGRQPTPISPPLRDSHPQATQWNSSTFHQALLDPRVRGLYFPA
AY862869_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AF473543_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AF223958_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
FJ023643_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
FJ023644_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
FJ023654_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
FJ349225_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
GQ358154_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AB074756_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AB247916_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AB300363_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSSTFHQALLDPRVRGLYFPA
AF068756_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
FJ023647_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
FJ023649_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
FJ023657_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
FJ023658_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
GQ924604_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
GQ924629_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
GU563561_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JN827417_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JN827416_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
GQ924609_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
EF384200_LHBs_P-C      PASSNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHQALLDPRVRGLYFPA
DQ089760_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHQALLDPRVRGLYFPA
EF688062_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
FJ562337_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AB246346_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPA
DQ089764_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPA
DQ089761_LHBs_P-C      PASTNRQVGRKPTPISPPLRDSHPQAXQWNSSTFHQALLDPRVRGLYLPA
DQ089791_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSXTFHQALPDPRVRGLYLPA
AB205125_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSSTFHQALLDPRVRGLYLPA
GQ924655_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYLPA
JQ341611_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
FJ023639_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSNTFHQALLDPRVRGLYFPA
DQ089784_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AB074755_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AB105173_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AF223954_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AF223955_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AF223957_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AF223961_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AP011097_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089765_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089769_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089779_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089781_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089782_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341616_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341615_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ341613_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
JQ027333_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSSTFHQALLBPRVRGLYFPA
JQ040133_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFXA
JN604144_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQXLLDPRVRGLYFPA
GQ924615_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
GQ377536_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
FJ023653_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089792_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDSRVRGLYFPA
FJ023650_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089766_LHBs_P-C      PASTKRQSGRQPTPISPPLRDSHPQATQWNSSTFHQALLDPRVKGLYFPA
GQ924642_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVKWNSSTFHQTLLDPRVRGLYFPA
HQ700516_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB014380_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLNPRVRGLYFPA
KC792831_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALADPRVRGLYLPA
DQ089758_LHBs_P-C      SASTNRQSGRQPTPISPPLRDSHPQAVQWNSSTFHQALLDPRVRGLYFPA
MG826129_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYVPA
MG826138_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPA
MG826136_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAIQWNSTTFHQALLDPRVRGLYFPA
MG826131_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYLPA
KX276855_LHBs_P-C      PASTNXQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPA
MG826137_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPA
MG826134_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWTSTTFHQALLDPRVRGLYFPA
MG826135_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPA
AP011106_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLLDPRVRGLYFPA
MG826133_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPA
AP011107_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670253_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
FJ032336_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYLPA
FJ032338_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYLPA
FJ032339_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYLPA
DQ089789_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
DQ089757_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVKGLYFPA
FJ023646_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
FJ023656_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
MG826139_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
AB367411_LHBs_P-C      PASTNRQSGRKPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX661497_LHBs_P-C      PVSTNRQSGRQPTPISPPLRDSHPQAAQWNSITFHQALLDPRVRGLYLPA
EU939609_LHBs_P-C      SASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFQQALLDPRVRGLYFPA
DQ089796_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KC793142_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAIKWNSTTFHQALLDPRVRGLYLPA
HQ700529_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAXQWNSTTFHQALLDPRVRGLYFPA
FJ562340_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013866_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
GQ377636_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYXPA
FJ562239_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
EU522068_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB014399_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KU964243_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964238_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964236_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598726_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598720_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598662_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPA
HM750141_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HM750131_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
FJ562304_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ562276_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB014389_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALIDPRVRGLYFPA
AB014374_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ787458_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KU964173_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KC792853_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KC792691_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYXPA
KC792672_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ899769_LHBs_P-C      PASTNWQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPA
EU939616_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPA
EU560438_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AY206392_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173432_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173431_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173334_LHBs_P-C      SASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792682_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPKVRGLYFPA
KC774313_LHBs_P-C      TVSTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774245_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
JX026880_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JN604258_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
HQ622095_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HM011500_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GU357845_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTIFHQALLDPRVRGLYFPA
FJ787457_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
AB670249_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013943_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KR013791_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
KR013780_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598670_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KC793108_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KC774353_LHBs_P-C      PASTNRQSGRQPTPISPPIRDSHPQAMQWNSTTFHQTLLDPRVRGLYLPA
KC774244_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPV
KC774203_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
JQ040161_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAXQWNSTTFHQALLDPRVRGLYFPA
FJ562273_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
EU093903_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
JQ040139_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGL--PA
KY881809_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KC792790_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774356_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ040145_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JF436920_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFQQALLDPRVRGLYFPA
KR014043_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYVPA
KR013858_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
KR013852_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYPPA
KR013794_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAMQWNSTTFQQALLDPRVRGLYSPA
KR013786_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598687_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173442_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173312_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173311_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173303_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173295_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173292_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173291_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792669_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAXQWNSTTFHQALLDPRVRGLYLPA
KC774334_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774304_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX661493_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
JX429903_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ040165_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ040163_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ040152_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ040144_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPA
JQ040131_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JN604246_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JN604140_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HM750140_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HM750139_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HM750135_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HM750134_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HM750132_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HM011493_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GU434374_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ924633_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB014369_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013831_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013781_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013779_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173396_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
KC774210_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX504536_LHBs_P-C      SASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
JX504534_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPGVRGLYLPA
JQ040168_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPA
JQ040149_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYXPA
HM011489_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KT284755_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KT284753_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013798_LHBs_P-C      PASTNRQSGRKPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013797_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013784_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013783_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013782_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KM213037_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173395_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC793187_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC793039_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774326_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774310_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774295_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774279_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
KC774275_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774259_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774257_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774252_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774232_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774223_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774180_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX429905_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX026878_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ475356_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYXPA
HM011465_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KF053181_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ803774_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KF873516_LHBs_P-C      PASTNRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPKVRGL--PA
KU679951_LHBs_P-C      PASANRQSGRQPTPISQPLRVTHPQAMQWNSSAFHQALQDPRVRGLYFPA
KF873526_LHBs_P-C      PASANRQSGRQPTPISPPLRVTHPQAMQWNSSAFHQALQDPRVRGLYFPA
KF873528_LHBs_P-C      PASANRQSGRQPTPISPPLRVTHPQAMQWNSSAFHQALQDPRVRGLYFPA
KF873529_LHBs_P-C      PASANRQSGRQPTPISPPLRVTHPQAMQWNSSAFHQALQDPRVRGLYFPA
KU679947_LHBs_P-C      PASANRQSGRQPTPISPPLRVTHPQAMQWNSTAFHQALQDPRVKGLYFPA
KU679957_LHBs_P-C      PASANRQSGRQPTPISPPLRVTHPQAMQWNSTAFHQALQDPXVRGLYFPV
KF873514_LHBs_P-C      PASTNRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPA
KF873520_LHBs_P-C      PASTNRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPA
KU679936_LHBs_P-C      PASTNRQSGRQPTPITPPLRDTHPQAXQWNSTAFHQALQDPRVRGLYFPA
KF873541_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPA
KU679937_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYLPA
KF873539_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPA
KF873536_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPA
KU679960_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPA
AB493839_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB112063_LHBs_P-C      PASTNRQSGRQPTPISLPLRDSHPQAMQWNSSTFHQALLDPKVRGLYLPA
FJ032345_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
EU554541_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
EU554542_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
AB111946_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHSQAMQWNSSTFHQALLDPKVRGLYLPA
KX276992_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLCFPA
AB367435_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGL--PA
AB105174_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPKVRGLYLPA
KY881883_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIRWNSTTFHQALLDPRVRGLYFPA
GQ475351_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVKGLYFPA
AB365451_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KY881962_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881990_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881884_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
KY881960_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
KY881872_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KY363281_LHBs_P-C      PASTNRQSGRKPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881991_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881886_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
KY881987_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY363275_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KX276959_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPKVRGLYFPA
FJ562251_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQALQWNSTTFHQALLDPRVRGLYFPA
KY881882_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
KY881997_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
EU939654_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPA
D00630_LHBs_P-C        PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQAVLDPRVRGLYLPA
AB670241_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPA
AB014381_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLHPRVRGLYFPA
KY882003_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881994_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881989_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881981_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLGPRVRGLYFPA
KY881892_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881887_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881880_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881871_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY363260_LHBs_P-C      LASTNRQSGRRPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPA
FJ386605_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPHAMQWNSTTFHQALLDPXVRGLYFPA
KY881978_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881875_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY363274_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670301_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
MG893553_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881984_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPV
KY881983_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881975_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881974_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KY881973_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
KY881940_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881925_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881916_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881915_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY470973_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470966_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470927_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470904_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470880_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470877_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY363282_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY363264_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KX276985_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KX276968_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964343_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
MG826125_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279275_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY882001_LHBs_P-C      PASTNRQSGRKPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881993_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881980_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881979_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881971_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881966_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881891_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPKVRSLYFPA
KY881889_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
KY881885_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881881_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KY881879_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881878_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KY881877_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881874_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
KY881870_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KY470974_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470969_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470965_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470903_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KX276981_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KU964341_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
MG893557_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881817_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470881_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964364_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
X04615_LHBs_P-C        PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
MH891502_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
MH887433_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
MG893560_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
MG826124_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC318703_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279276_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279251_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY882000_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881999_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881998_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881996_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881995_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881992_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881986_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881985_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881982_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881977_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881976_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881972_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881967_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881965_LHBs_P-C      PAPTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881963_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881959_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881943_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881942_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881939_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881938_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881937_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881936_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881935_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881934_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881933_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881932_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881931_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881930_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881929_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881928_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881927_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881926_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881924_LHBs_P-C      PAPTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881923_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881922_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881921_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881920_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881919_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881917_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881777_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881776_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881775_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881774_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881773_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881772_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881771_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881770_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881769_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881768_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881767_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881766_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881765_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881764_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881763_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881762_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881758_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881755_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881754_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881751_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881750_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881749_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881748_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881744_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881743_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881742_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881739_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881738_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881737_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881736_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470977_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470975_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQTMQWNSTTFHQALLDPRVRGLYFPA
KY470968_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470905_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470902_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470901_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470900_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470897_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470896_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470890_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470888_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470887_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470886_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470884_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470882_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470878_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470876_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470874_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY363279_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KX276976_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KX276960_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964348_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964347_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964346_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964345_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964344_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964342_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964340_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964339_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964338_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964337_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964336_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964334_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964225_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964184_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWSSTTFHQALXXXXXXXXXXPA
KU964179_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALXXXXXXXXXXPA
KU964174_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALXXXXXXXXXXPA
KU964176_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALXXXXXXXXXXPA
KU964178_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALXXXXXXXXXXPA
KU964181_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALXXXXXXXXXXPA
KU964183_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALXXXXXXXXXXPA
V00867_LHBs_P-C        PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
MH094411_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC318702_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279274_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279249_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279248_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279247_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279245_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881988_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881961_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881812_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881802_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470979_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY022423_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964182_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALXXXXXXXXXXPA
MG893558_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279262_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279261_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279260_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279258_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279257_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279256_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279255_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279252_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279246_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470978_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470976_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470972_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLGPRVRGLYFPA
KY470971_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLGPRVRGLYFPA
KY470970_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470967_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470934_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470933_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALIDPRVRGLYFPA
KY470926_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470925_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KX276973_LHBs_P-C      PASTNRQSRRHPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KX276835_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964228_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964227_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964224_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964223_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964222_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
MK321266_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC373512_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC373511_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALRDPRVRGLYFPA
KY363284_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KX276836_LHBs_P-C      PAATNRQSGRQPTPISPPLRDSHPQAVXWNXTXFHXALLBPXVRGLYFPA
KU964221_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTXXXXXXXXXXXXXXXPA
KU964358_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFRQAXXXXXXXXXXXPA
KU964349_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFRQAXXXXXXXXXXXPA
KU964363_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFRQAXXXXXXXXXXXPA
D23682_LHBs_P-C        PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
D23683_LHBs_P-C        PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ717799_LHBs_P-C      PAAANRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQACLDPRVRGLYFPA
KJ803790_LHBs_P-C      PAAANRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQACLDPRVRGLYFPA
FJ787442_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ787443_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939568_LHBs_P-C      PASTDRQSRRQPTTISPPLRDSHPHAMQWNSTTFHQALLDPKVRGLYFPA
EU093900_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPA
AB367402_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
AB113875_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
AB113876_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
EU939579_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAIQWNSTTFHQALLDPRVRGLYFPA
FJ899774_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAIQWNSTTFHQALLDPRVRGLYFPA
KU964323_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
KU964326_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
KU964327_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
KU964333_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
KU964329_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
GU721029_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB014392_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
EU939539_LHBs_P-C      PASTNRQTGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KY470980_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470981_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470982_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470983_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470984_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470985_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470986_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470987_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470988_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470990_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470991_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939653_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
AB367406_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
FJ715404_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB367392_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFRQALLDPRVRGLYLPA
FJ787449_LHBs_P-C      PASTDRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
FJ386631_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ787453_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ787454_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AY066028_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
AB198082_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386652_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377601_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AF411408_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
AF411411_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
EU796070_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
EU796072_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
FJ899764_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPA
GQ377533_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AY247032_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB642097_LHBs_P-C      PASTNRQSGRQPTPISPPXRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB300368_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670265_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670300_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB367431_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB367407_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPV
AB195942_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRSLYFPA
AB182589_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AB195943_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRSLYFPA
AB195944_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRSLYFPA
AB670243_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPA
AB367394_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB367398_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB367403_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670251_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB367412_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB362932_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB367804_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB367432_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB195949_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPA
AB198077_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB198078_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB202071_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB205124_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB222714_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670247_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB642095_LHBs_P-C      PASTNRQSGRXPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB640730_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB471853_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB471852_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB471851_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB367422_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
AB367414_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
AB300365_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB222715_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB300359_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JF828921_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JF828918_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
JF828920_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
JF828913_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
JF828915_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
JF828917_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
JF828924_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JF828925_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JF828926_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JF828929_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JF828930_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715379_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562269_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ717833_LHBs_P-C      PASTNRQSGRQPTPIFPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ924620_LHBs_C-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ341632_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR014078_LHBs_P-C      TASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013870_LHBs_P-C      TASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR014077_LHBs_P-C      TASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR014083_LHBs_P-C      TASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013871_LHBs_P-C      TASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR014082_LHBs_P-C      TASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AF241410_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB241111_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JN827414_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU410079_LHBs_P-C      PASTNRQSGRLRTPISPPIRDTHPQAXQWNSTTFHQALLDPRVRGLXFPA
AF241411_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JN827415_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB241110_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AP011099_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AP011100_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AP011101_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU410080_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU410081_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JN604226_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ924622_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
AB367395_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
AB367396_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB367424_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562250_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715377_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715378_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715380_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ787470_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
FJ787471_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
FJ715374_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715375_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715376_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715389_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939586_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTVHQALLDPRVRGLYLPA
AB367420_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JF828916_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
JF828919_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
AB367416_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
AB367803_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
EU560440_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
EU579442_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ562243_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU872000_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQTLLDPRVRGLYFPA
EU570072_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWTSTTFHQALLDPRVRGLYLPA
EU093902_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
AB367434_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB367399_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
AB367397_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMHWNSTTFHQALLDPRVRGLYLPA
AB014393_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPA
EU939542_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPA
FJ899767_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPA
AB042282_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
AB042283_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
KR013868_LHBs_P-C      PASTNRQSGRQPTPISPPLRDCHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ032334_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939594_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSPTFHQTLLDPRVRGLYLPA
EU939567_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
EU939564_LHBs_P-C      PASTNRQSGRQPTPISPPLRVSHPQAVKWNSTTFHQALLDPRVRGLYLPA
EU589336_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB195937_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPA
AB195938_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPA
AB014367_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB014384_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670239_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVKWKSTTFHQALLDPRVRGLYFPA
AB670240_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVKWKSTTFHQALLDPRVRGLYFPA
KC774358_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYLPA
FJ899770_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPA
EU939536_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
EU554537_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPRAMQWNSTTFHQALLDPRVRGLYFPA
EU439015_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
EU306674_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVQGLYFPA
EU306673_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670302_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
AB670273_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATKWNSTTFHQVLLDPRVRGLYLPA
AB670270_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYVPA
AB670262_LHBs_P-C      PASTNRQSGRKPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
AB288026_LHBs_P-C      PASTNRQSGRQSTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB014362_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386685_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
AB298720_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
AB298721_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
EU075336_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
AB111121_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
AB014376_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
AB014394_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
AB111122_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
AB111123_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
KR013842_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KR013844_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KR013848_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALPDPRVRGLYLPA
KR013849_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
AB642099_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU872001_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQTLLDPRVRGLYFPA
EU872003_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQTLLDPRVRGLYFPA
EU872004_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQTLLDPRVRGLYFPA
EU872002_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQTLLDPRVRGLYFPA
EU916223_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
AF363961_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
EU916224_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
EU939619_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
GQ377615_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377571_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377562_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
FJ562306_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
FJ562265_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ562249_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386597_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPA
FJ386588_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939543_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPTVRGLYFPA
AB670264_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB367404_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB299858_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
AB426467_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
AB198076_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562307_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377632_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB195936_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPA
AB642100_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB900116_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB049610_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYLPA
AB033551_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB033550_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670272_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPA
AB026815_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB300360_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB026811_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB026812_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB026813_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB026814_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB014371_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
AB014363_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KR013861_LHBs_P-C      PASTNRQTGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPA
KR013860_LHBs_P-C      PASTNRQTGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPA
D50520_LHBs_P-C        PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
AB033552_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB033553_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB033556_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
DQ089799_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562258_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562272_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562281_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB042284_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB195947_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB195952_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB198079_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB198080_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALLDPRVRGLYFPA
AB198081_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALVDPRVRGLYFPA
AB198083_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB300361_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB367423_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
AB471848_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB471849_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB471850_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386596_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPA
FJ386687_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPA
KR013859_LHBs_P-C      PASTNRQTGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPA
GQ377580_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ899777_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
EU939544_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
EU916237_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU871978_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
EU570068_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQALQWNSTTFHQALLDPRVRGLYFPA
EU570067_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU554539_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU306675_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVQGLYFPA
D50519_LHBs_P-C        PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
AB014383_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ787439_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPA
FJ787479_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPA
AB113878_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPA
AB195930_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPA
AB195931_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPA
AB195932_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPA
GQ475325_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGL--PA
AB367410_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
EU939587_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
EU939600_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
EU939614_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYLPA
GQ475316_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
GQ475327_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
GQ475334_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KT284758_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
JQ040151_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAXQWNSTTFHQALLDPRVRGLYFPA
MH818373_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881964_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
JQ040132_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KC774299_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ787468_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ787469_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ386579_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ787445_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
EU939605_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQASQWNSTTFHQALLDPRVRGLYLPA
DQ975272_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPA
DQ478899_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB111120_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWKSTTFHQALLDPRVRGLYLPA
AB050018_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU554538_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU871980_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFHA
EU871998_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFHA
EU916238_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939578_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPA
FJ562280_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
GQ377523_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377538_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU554536_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377603_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377593_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ787441_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPA
AB014396_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
AB195953_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
AB195954_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
AB246345_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
GQ377518_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ899771_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPA
EU939563_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPA
FJ386659_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPA
AB205123_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAMRWNSTTFHQALLDPRVRGLYFPA
AB111114_LHBs_P-C      PASSNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY363258_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774179_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSPTFHQAPLNPRVRGLYFPA
KC774297_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSPTFHQAPLNPRVRGLYFPA
KX276980_LHBs_P-C      PASTKRESGRKPTPISPPLRDSHPHAMQWNSTTFHQTLLDPRVRGLYFPA
KC774269_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMKWNSTTFHQALLDPRVRGLYFPA
MG826128_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPA
KX276993_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLCFPA
KR013827_LHBs_P-C      LASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
KC792995_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIKWNSTTFHQALLDPRVKSLYYPA
HM011479_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KX276837_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HM750136_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774211_LHBs_P-C      PAFTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774256_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774277_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774335_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX036326_LHBs_P-C      PASTNRQSGRLPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX036327_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964016_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964015_LHBs_P-C      PASTNRKSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGPYFPA
KU964019_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY363252_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964011_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ410510_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
FJ562221_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KX276991_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC793119_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792902_LHBs_P-C      PVSTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774296_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMRWNSTTFHQALLDPRVRGLYFPA
KC774214_LHBs_P-C      SASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX026877_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPA
AY057947_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
X52939_LHBs_P-C        PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792710_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792700_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
KC774213_LHBs_P-C      SASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU916225_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964017_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964013_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013874_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KF214655_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSATFHQALLDPRVRGLYFPA
KC793040_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQIIHWNSTTFHQALLDPRVKGLYFPA
KC774306_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KC774281_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFRQALLDPRVRGLYFPA
KC774217_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPA
EU939571_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU796069_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGPYFPA
GQ377591_LHBs_P-C      -LCSHRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377572_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AY247031_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562282_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964330_LHBs_P-C      PVSTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
KU964325_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
KR013882_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KR013846_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173335_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC875261_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774325_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774253_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX560520_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
DQ089797_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTIHQALLDPRVRSLYFPA
AB670237_LHBs_P-C      PASTNRQSGRQPTPIXPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964214_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
KU964175_LHBs_P-C      PASTNRQSGRQPTPISXXLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KU964018_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KT364751_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR014010_LHBs_P-C      PASTNRQSGKQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFHA
KR013815_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC875263_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQAPLDPRVRGLYFPA
KC793129_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KC792775_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774340_LHBs_P-C      PASTNRQLGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
KC774204_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX125372_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
JQ341634_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHXALLDPRVRGLYFPA
EU075315_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
MG826127_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
MG826126_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964014_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964012_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964004_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR819180_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KM359441_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KJ598642_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC793107_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQXLLDPRVRGLYFPA
KC793051_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792817_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774191_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX504541_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPLAVQWNSTTFHQALLDPRVRGLYFPA
JX429914_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377624_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ259588_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ899765_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWSSTTFHQALLDPRVRGLYFPA
FJ562323_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881970_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881876_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KY881815_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470879_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KX276979_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964332_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
KU964331_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
KU964328_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
KU964324_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
KU964322_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
KU964321_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
KU964320_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
KU964319_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
KU964318_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYNPA
KU964213_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964212_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964211_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964210_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964209_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964208_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964207_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964206_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964204_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964201_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964171_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNYTTFHQALLDPRVRSLYRPA
KT364752_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KT284757_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013876_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KR013799_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013776_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWDSTTFHQTLLDPRVRGLYFPA
KR013767_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
KR013766_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598769_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYYPA
KJ598768_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYYPA
KJ598659_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173328_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173327_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173305_LHBs_P-C      PASINRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC793201_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPV
KC793019_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792759_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYXPA
KC792746_LHBs_P-C      XASTNRQSGRQPTPISPPLRDSHPQAXXWNSTTFXQALLDPRVRXLYFPA
KC774346_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774330_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774319_LHBs_P-C      PASTNRQVGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774303_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774300_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
KC774280_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774242_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774231_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAMQWNSITFHQALLDPRVRGLYFPA
KC774225_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774208_LHBs_P-C      PASTNRQSGRQPTPISPPVRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774207_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
JX560519_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX504542_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386647_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYXPA
FJ386627_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC090200_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881890_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470885_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470875_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470873_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964172_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYLPA
KR014011_LHBs_P-C      PASTNRQSGRQPTPISPPLRDGHPQATQWNSTTFHQALLDPRVRGLYFLA
KR013809_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013795_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFQQALLDPRVRGLYFPA
KJ598713_LHBs_P-C      PASTNRQLGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598712_LHBs_P-C      PASTNRQLGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598709_LHBs_P-C      PASTNRQLGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598660_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598641_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173332_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173331_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC875262_LHBs_P-C      PASTKRQSGRQPTPISPPLRDSHLQAMQWNSTTFHQALLDPRVRGLYFPA
KC793202_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC793123_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIRWNSTTFHQALLDPRVRGLYXPA
KC793050_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KC792834_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792799_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAXQWNSTTFHQALLDPRVRGLYFPA
KC774288_LHBs_P-C      HASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
KC774274_LHBs_P-C      PASTNRQLGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774267_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX661491_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881969_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY470892_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470889_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY363287_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY363253_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYSPA
KX276964_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KX276838_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964177_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964077_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013877_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KR013875_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013872_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KF485390_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KC793100_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYXPA
KC793097_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792857_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792740_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVGHPYFPA
KC774301_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774254_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX429913_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ341670_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279253_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KX276984_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLCFPA
KU964215_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964205_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964203_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964202_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964170_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964053_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964052_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964051_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964050_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964049_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KT284754_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR014015_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KR013814_LHBs_P-C      PASTNRRSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013813_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013808_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPA
KR013801_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013800_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013796_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPRAMQWNSTTFQQALLDPRVRGLYFPA
KR013792_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFQQALLDPRVRGLYFPA
KR013777_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRARGLYFPA
KR013765_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013764_LHBs_P-C      PASTNRQSGRQPTPLSPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
KR013763_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTPLDPRVRGLYFPA
KR013762_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KM229703_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ803762_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
KJ598753_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598716_LHBs_P-C      PASTTRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598710_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPA
KJ598703_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598686_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598681_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
KJ598679_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598661_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598639_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598636_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598635_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ410521_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173446_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173317_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173315_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173314_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173313_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KF053170_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
KC793110_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792926_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792792_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792680_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792658_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774360_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774359_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774355_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774354_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774351_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774348_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774347_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774333_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774321_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774320_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774311_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774298_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774282_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774278_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774276_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774271_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774270_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774268_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774224_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KC774218_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774199_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX429916_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWSSTTFHQALLDPRVRGLYFPA
JX125375_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX125374_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX125370_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX125366_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ341658_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279254_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KX276839_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964039_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963929_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963928_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963927_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963926_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963925_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963924_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963923_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963922_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963921_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963920_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963919_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963918_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963917_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963916_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963915_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013834_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013773_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
KJ598744_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598719_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598718_LHBs_P-C      PASTNRQLGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598717_LHBs_P-C      PASTNRQLGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598715_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFQQALLDPRVRGLYFPA
KJ598714_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598711_LHBs_P-C      PASTNRQLGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598708_LHBs_P-C      PASTNRQLGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598707_LHBs_P-C      PASTNRQLGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598705_LHBs_P-C      PASTNRQLGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ410508_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173444_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173443_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173282_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173281_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC793003_LHBs_P-C      PATTNRXSGRQPTPISPPLRDSHPQAXQWNSTTFHQALLDPRVRGLYFPA
KC792961_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792911_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQXLLDPRVRGLYFPA
KC792771_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSXTFHQALLDPRVRGLYFPA
KC774205_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPA
KC774182_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX125371_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX125365_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279259_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013833_LHBs_P-C      PASTNRQSGRQSTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013802_LHBs_P-C      PASTNRQSGRQSTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013793_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFQQALLDPRVRGLYFPA
KF485389_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC793024_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792968_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSXTFHQALLDPRVRGLYFPA
KC792923_LHBs_P-C      PASTNRQXRRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792862_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAXQWNSTTFHQALLDPRVRGLYFPA
KC792708_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774283_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
LC279250_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470930_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470929_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY363286_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964220_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964218_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KU964217_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964216_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964200_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964048_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964047_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964046_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964045_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964044_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964043_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964041_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964040_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964038_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964037_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964036_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964035_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964034_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964002_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963997_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963996_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963992_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KT284756_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPHAMQWNSTTFHQALLDPRVRGLYFPA
KR014012_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KR013873_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013832_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013830_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013829_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013828_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013812_LHBs_P-C      PAPTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013811_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013810_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013807_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013774_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
KR013772_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNATTFHQTLLDPRVRGLYFPA
KR013771_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
KR013768_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013761_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KP784761_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KP027477_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ803765_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ790199_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598754_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598752_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598751_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598749_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598748_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598747_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598746_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598745_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598743_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598742_LHBs_P-C      PASTDRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598741_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598740_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598702_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598698_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598693_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598689_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598680_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173434_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173433_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173430_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173429_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173428_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173427_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173426_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173394_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173393_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173392_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173391_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173316_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173308_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173307_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173306_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173304_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173296_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173294_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173293_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173288_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KF779242_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KF053172_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC793103_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC793035_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792999_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KC792965_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792962_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792941_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792940_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792921_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792803_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792776_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792704_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792695_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792690_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792679_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792655_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774352_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPA
KC774345_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774342_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774338_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774337_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774336_LHBs_P-C      SASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774331_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774329_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774327_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774318_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774316_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774315_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774314_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774312_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774292_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774287_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774286_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774272_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774264_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774262_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774261_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774249_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774243_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774241_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774240_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774237_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774229_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774226_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774209_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774206_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774202_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774200_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774197_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774196_LHBs_P-C      SASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774192_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774190_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774187_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX661495_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX661492_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX504545_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX504544_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX429918_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX429917_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX429912_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX429909_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX429906_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX125373_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX026888_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX026884_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ688404_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ341665_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ341648_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598706_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC793074_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792873_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792716_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ341643_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ341610_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964226_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964054_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964055_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964056_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964057_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964058_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964059_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964060_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964061_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964062_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964063_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ787448_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPGVRGLYFPA
EU939655_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939656_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU093896_LHBs_P-C      PVSTNRQSARQPTPISPPLRDSHPQAIQWNSTTFQQTLLDPRVRGLYFPA
EU670263_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EF536066_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KF053184_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
KJ803777_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
GQ377608_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPKVRGLYFPA
EU570073_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPV
EU570074_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPV
AB493844_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939588_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ899778_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU881996_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
EU939644_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB367417_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB014385_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013869_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386589_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ032356_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSPTFHQALLDPRVRGLHFPA
AB367427_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377553_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPV
FJ787452_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPA
FJ562292_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNPTTFHQALLDPRVRGLYFPA
FJ386602_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPA
EU916234_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU579443_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU086837_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AF458665_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB113879_LHBs_P-C      PVSTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU086847_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAAQWNSTTFHQALLDPRVRGLYFPA
EU086843_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAAQWNSTTFHQALLDPRVRGLYFPA
EU086844_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAAQWNSTTFHQALLDPRVRGLYFPA
EU086845_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAAQWNSTTFHQALLDPRVRGLYFPA
EU086846_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAAQWNSTTFHQALLDPRVRGLYFPA
GQ377628_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALLDPRVRGLYFPA
FJ899788_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562255_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386620_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
FJ386611_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386603_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHHSLLDPRVRGLYFAA
FJ032355_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU871979_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU093915_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWYSTTFHQALLDPRVRGLYFPA
DQ922649_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AY167096_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSKTFHQALLDPRVRGLYFPA
GQ377599_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ899789_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562266_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939607_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU547562_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB900099_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVKGLYFPA
GQ377623_LHBs_P-C      PASTNRQSRRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377621_LHBs_P-C      PAATNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPV
GQ377600_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377528_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ899776_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ787486_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715397_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715395_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562308_LHBs_P-C      PVSTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562293_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562244_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562241_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPA
EU939617_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939615_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939604_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPD
EU939562_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939545_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPA
EU871977_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU717212_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU560441_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU093914_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU093912_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU093898_LHBs_P-C      PVSTNRQSARQPTPISPPLRDSHPQAIQWNSTTFQQTLLDPRVRGLYFPA
EU082435_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EF536065_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
DQ980547_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
DQ975273_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
DQ922651_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
DQ478900_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AY206381_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPA
AF384371_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013867_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHKTLLDPRVRGLYFPA
GQ377570_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377517_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715372_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSITFHQALLDPRVRGLYFPA
FJ386689_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386577_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
EU939546_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
EU916219_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
DQ922650_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
DQ478885_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013864_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KR013862_LHBs_P-C      PASTNRQTGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPA
KR013769_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ040155_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562301_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPA
FJ562242_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939612_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
D23681_LHBs_P-C        PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPA
KY881888_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
GQ475350_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ475332_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ475329_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ475328_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALIDPRVRGLYFPA
GQ475322_LHBs_P-C      SASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ475317_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ475305_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377642_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377640_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377637_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377619_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377618_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377617_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377597_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377585_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377579_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377575_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377574_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377554_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377546_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377545_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377521_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377515_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715422_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715400_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715398_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715392_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715371_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715367_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715366_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715358_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715357_LHBs_P-C      PAPTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715355_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562329_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562327_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562318_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562275_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562274_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562238_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
FJ562235_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562233_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562218_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386678_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386639_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386625_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386618_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386576_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386574_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ032361_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ032359_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ032331_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939613_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAXQWNSTTFHQALLDPRVRGLYFPA
EU939610_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939593_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939592_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQTLLDPRVRGLYFPA
EU939540_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
EU939538_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPA
EU916233_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU916222_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU916210_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU871982_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU562218_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU093918_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU093917_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU093916_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU093913_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU093911_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU093910_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU093909_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU093908_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU093907_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPA
EU093895_LHBs_P-C      PASTNRQSARQPTPISPPLRDSHPQAIQWNSTTFQQTLLDPRVRGLYFPA
EU093883_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU082432_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU082431_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU082430_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU082429_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU082428_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU075342_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU075338_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU075335_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU075334_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
DQ993693_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
DQ993692_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
DQ993691_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AY641560_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB675677_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670311_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670305_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013804_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX504539_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
JQ040166_LHBs_P-C      PASTNRLSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ899761_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPA
FJ562284_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670289_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFXXALLDPRVRGLYFPA
FJ386657_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HQ700569_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
X75665_LHBs_P-C        SASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFQQALQDPRVRVLYFPA
HQ700504_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPA
HQ700502_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPA
HQ700545_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPA
HQ700556_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPA
JN604222_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPA
HQ700564_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPA
HQ700563_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPA
HQ700573_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPA
HQ700570_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAVQWNSTTFHQALLDPRVRGLYYPA
HQ700562_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPX
HQ700565_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYYPA
HQ700577_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HQ700457_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQAXLDPRXRGLYFPA
HQ700490_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTAFHQALLDPRVRGLYFPA
HQ700456_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNATTFHQALLDPRVRGLYFPA
HQ700475_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNATTFHQALLDPRVRGLYFPA
HQ700571_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HQ700575_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFXQALLDXRVRGLYFPA
HQ700566_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRXLYFPA
HQ700495_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HQ700572_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLXFPA
HQ700561_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HQ700559_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HQ700555_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HQ700558_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HQ700496_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HQ700544_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HQ700567_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVMGLYFPA
HQ700576_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPXVXGLYFPA
AB900113_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ787447_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPA
KC792880_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPA
AY167099_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562313_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386653_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
AB971714_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB971715_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562335_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386598_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AY167091_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB111124_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
AB111125_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
AB246344_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
AB300362_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AF458664_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ475346_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792793_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AY206386_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQTMQWNSTTFHQALLDPRVRGLYLPA
DQ089802_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYXPA
EU882005_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPA
KC792713_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC792739_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
DQ089801_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562298_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964020_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KU964021_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KU964022_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KU964023_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KU964024_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KU964025_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KU964026_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KU964027_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KU964028_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KU964029_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KU964030_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KU964031_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KU964032_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KU964033_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPA
KC792762_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ386626_LHBs_P-C      PASRKPPSGSPPTLISLPLRDSHPNAIHCHSTLFHQVLRDPLVAGGYFPA
GQ358153_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQSLLDPRVRGLYFPA
EU871974_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU871970_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU871972_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AF182803_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU871969_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HQ700522_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HQ700543_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562299_LHBs_P-C      PASTNRQSGRKPTPISPPLRDSHPQAMQWNSTTFHQALIHAGVRGLYFPA
FJ386601_LHBs_P-C      PASTNRQARRRTTPISPPLIDSHPQAIQWNSATFHQALLDPRVRGLYFPA
AF182802_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB014365_LHBs_P-C      PASTNRQSGRQHTPXSPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KJ717822_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPA
KJ803810_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPA
EU939596_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
FJ787450_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU871973_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715405_LHBs_P-C      PASTNRQSGRQPTPISSPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715406_LHBs_P-C      PASTNRQSGRQPTPISSPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
D28880_LHBs_P-C        PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
S75184_LHBs_P-C        PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939659_LHBs_P-C      PASTNRQTGRQPTPISPPLRDSHPQAVQWTSTTFHQTLLDPRVRGLYLPA
DQ890381_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPKVRGLYLPV
KJ717821_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSRGLYLALADPRVRGLYFPA
KJ803809_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSRGLYLALADPRVRGLYFPA
AB675674_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB675675_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ027322_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ787466_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPIVRGLYFPA
AF411412_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPA
AB670238_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB014391_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB014382_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
GQ377620_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715360_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ715416_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ386613_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670274_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ372968_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQRNSTTFHQALLDPRVRGLYFPA
FJ899772_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ787467_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPIVRGLYFPA
FJ715415_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAVQWNSTTFHKALLDPRVRGLYLPA
FJ386624_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ032350_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
DQ089787_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AB367401_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHKAMLDPRVRGLYLPA
KJ598666_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KJ598678_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KJ598663_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KJ598665_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALPDPRVRGLYLPA
KJ598667_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KJ598668_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KJ598669_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KJ598671_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KJ598672_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KJ598673_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KJ598674_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KJ598676_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KJ598677_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KJ598664_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
KJ598731_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964229_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562300_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963904_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964242_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964241_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964240_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964239_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964237_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964235_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964234_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964233_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964232_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964231_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964230_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598739_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598738_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598737_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598736_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598735_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598734_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598733_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598732_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598730_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598729_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598728_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598727_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598725_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598724_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598723_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598722_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ598721_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173333_LHBs_P-C      SASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ412089_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963914_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963913_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963912_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963911_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963910_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963909_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963908_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963907_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963906_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963905_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963903_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963902_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963901_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU963900_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774235_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY670782_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX504537_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY629631_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
MG826132_LHBs_P-C      PASTNRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPA
JF828923_LHBs_P-C      PASTNRQSGTQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562228_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386623_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ032351_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939597_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AY220699_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPHAIQWNSTTFHQTLLDPRVRGLYIPA
AB670259_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMHRISTTFHQALLDPRVRGLYFPA
AB106895_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQRNSTTFHQTLLDPRVRGLYFPA
JN604231_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYIPA
FJ386604_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSPTFHQALLDPRVRGLYFPA
EU919168_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPA
DQ377164_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB931170_LHBs_P-C      PATTNRQLGRRPTPITPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AB670279_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715351_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAVQWNSTTFHKALLDPRVRGLYLPA
FJ715368_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHKALLDPRVRGLYLPA
FJ715390_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAVQWNSTTFHKALLDPRVRGLYLPA
FJ715391_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAVQWNSTTFHKALLDPRVRGLYLPA
FJ715418_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAVQWNSTTFHKALLDPRVRGLYLPA
KX276963_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715359_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ562334_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
FJ562310_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNFTTFHQALLDPRVRGLYFPA
FJ562264_LHBs_P-C      PASTNRQTGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386661_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939647_LHBs_P-C      PASTNRQAGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU560439_LHBs_P-C      PASTNRQAGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
AY306136_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB931171_LHBs_P-C      PATTNRQSGRRPTPITPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPA
AB900109_LHBs_P-C      PATTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB111119_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWKSTTFHQALLDPRVRGLYFPA
GQ377631_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQTLLDPRVRGLYFPA
GQ377526_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
FJ899773_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ787437_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSPTFHQALLDPRVRGLYFPA
FJ715364_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715344_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562268_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHKALLDPRVRGLYFPA
FJ562248_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ518813_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386673_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPKVRGLYFPA
FJ386644_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386614_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939657_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939649_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSITFHQALLDPRVRGLYFPA
EU871975_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU871971_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLCFPA
EU086842_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAAQWNSTTFHQALLDPRVRSLYFPA
AF461358_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AF461359_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670260_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670242_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB485810_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVRWNSTTFHQALLDPRVRGLYFPA
KY881968_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KU964064_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013851_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KM875423_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173309_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377586_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377577_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ358158_LHBs_C-C      PAATNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715421_LHBs_P-C      PASTNRQSGRQPTPISSPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715381_LHBs_P-C      PASTNRQSGRQPTPISSPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715352_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ715343_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562319_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSKTFHQALLDPRVRGLYFPA
FJ386672_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386630_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYLPA
EU939648_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939618_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
EU939601_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
EU919169_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPA
EU554535_LHBs_P-C      PASTNRQSGRQPTPISPPLRDGHPQAMQWNSTTFHQALLDPRVRGLYFPA
DQ683578_LHBs_P-C      PASTNRQSERQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AY641561_LHBs_P-C      PVSTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AY596107_LHBs_P-C      SAFTNRESGRQTTPISPPLRDSHPQAMQWNFTTFHQTLLDPRVRGLYFPA
AY206382_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB697510_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
AB697490_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
AB670306_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
AB670298_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670277_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670275_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670267_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB176642_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB014377_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB485808_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB014360_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB014379_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386670_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377557_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
GQ377555_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715365_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715342_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386592_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ386591_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ032340_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
DQ536412_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AY641559_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AF533983_LHBs_P-C      PASTNRQSGRQPTPISSPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470891_LHBs_P-C      PASTNRQSGRQSTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173321_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173319_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALIDPRVRGLYFPA
KC774255_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774238_LHBs_P-C      PVSTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ027323_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JN604254_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JN604133_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JF828937_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
GQ475348_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377529_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ358157_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ787465_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ787464_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715353_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
FJ562320_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPXVRGLYFPA
FJ562315_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562261_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562252_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386664_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTNFHQALLDPRVRGLYFPA
FJ386662_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386595_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ032341_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVKGLYFPA
EU939651_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNTTTFHQALLDPRVRGLYFPA
EU939626_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939625_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939570_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU871976_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPA
D12980_LHBs_P-C        PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AF286594_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB697502_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670295_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPLAVCWNTTTFHQALLDPRVRGLYFPA
AB367418_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY363283_LHBs_P-C      PASTNRQSGRQPTPIFPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KR013853_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALPDPRVRGLYFPA
KJ598638_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173436_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173435_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173302_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KJ173301_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774343_LHBs_P-C      PASANRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774309_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774290_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774289_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX661489_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX429915_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JN604281_LHBs_P-C      PVSTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JN604131_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JN315779_LHBs_P-C      PASTNRQLGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JF828928_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JF828922_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
HM750137_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ872211_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ475339_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ475338_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ475336_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ475321_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ475318_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSPTFHQALLDPRVRGLYFPA
GQ475310_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ475309_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWKSTTFHQALLDPRVRGLYFPA
GQ377609_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFQQTLLDPRVRGLYFPA
GQ377584_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377578_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377559_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377541_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377540_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ715409_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQVMQWNSTTFHQALLDPRVRGLYFPA
FJ715402_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562325_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
FJ562291_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562288_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562232_LHBs_P-C      PASTNRQTGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386679_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPA
FJ386671_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ032346_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939582_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
EU939572_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939566_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939561_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPV
EU939548_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
EU554540_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU306728_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU306726_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU306721_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU306720_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU306719_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
DQ377165_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNPTTFHQALLDPRVRGLYFPA
D23684_LHBs_P-C        PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
AY596108_LHBs_P-C      PASTNRQSGRQPTPIFPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AY206384_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AP011098_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB900115_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPA
AB670310_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670307_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670297_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670291_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670285_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670282_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670281_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670276_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670263_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
AB670258_LHBs_P-C      PATTNRQSRRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
KY363278_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JX429907_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
JQ040141_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPA
JN604148_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ787456_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562285_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ562256_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939603_LHBs_P-C      PASTNRQSGRQPTPISPPLRESHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939585_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPA
AB670269_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY881941_LHBs_P-C      PASTNRQSGRQPTLISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY881918_LHBs_P-C      PASTNRQSGRRPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPA
KY470899_LHBs_P-C      PASTNRQSGRQSTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470895_LHBs_P-C      PASTNRQSGRQSTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC793195_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774308_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774302_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KC774250_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ475355_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQXXXDSRVRGLYFPA
GQ377616_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377552_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
GQ377530_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386632_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
FJ386607_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939640_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939611_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
EU939595_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPA
EU939550_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
MG893556_LHBs_P-C      PASTNRQSGRQPTPITPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KY470883_LHBs_P-C      PASTNRQSGRQPTPIPPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964199_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964198_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964197_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964196_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964195_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964194_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964193_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964192_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964191_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964190_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964189_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964188_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964187_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964186_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964185_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964078_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964075_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964074_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964073_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964072_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA
KU964071_LHBs_P-C      PASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPA