HBVdb

Dataset for protein MHBs of genotype C

[Download (right click)] [Edit] [Sequences] [Repertoires]

2781 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


AB074047_MHBs_P-C      -MWNSSTFRQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KF214652_MHBs_P-C      MQWN-TTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ410505_MHBs_P-C      MQWNSSTFHQALLDPRVLD---PAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341656_MHBs_P-C      -QWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341778_MHBs_P-C      -QWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792656_MHBs_P-C      -TWTYTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU410079_MHBs_P-C      -QWNSTTFHQALLDPRVRGLXFPAGGSSSGTANPVPTTASPISSIFSRTG
EU086841_MHBs_P-C      -QWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU086840_MHBs_P-C      -QWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
HM011481_MHBs_P-C      -QWNSTTFHQALLDPRVRXLYLPAGGSSSGTVNPVPTTASPISSIFLRTG
DQ089795_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSSFSRTG
EU498227_MHBs_P-C      IQWNSSTFHKALLDPRVRGPYFPAGGSSSGTVNPVPTTASPISSIFSMTG
KF873516_MHBs_P-C      MQWNSTAFHQALQDPKVRGL--PAGGSSSGAVNPVPNTVSPISSIFAKTG
KF873544_MHBs_P-C      IQWNSTTFHQALTDPRXRGLXXPVGGSSSGTVNPVPNTVSHISSTFTKTG
KU679936_MHBs_P-C      XQWNSTAFHQALQDPRVRGLYFPAGGSSFGAVNPVPNTVSPISSIFTKTG
KU679947_MHBs_P-C      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVSPVPTTVSHISSIFTKTG
KU679957_MHBs_P-C      MQWNSTAFHQALQDPXVRGLYFPVGGSSSGTVSPVPTTVSHISSIFTKTG
KF873526_MHBs_P-C      MQWNSSAFHQALQDPRVRGLYFPAGGSSSGTVSPVQNTVSHISSIFTKTG
KU679937_MHBs_P-C      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPVPNTVSHISSIFTTTG
KF873539_MHBs_P-C      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTTTG
KF873541_MHBs_P-C      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTTTG
KU679960_MHBs_P-C      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVTPVPXTVSHISSXFXTTG
KF873536_MHBs_P-C      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSXFXTTG
KU679951_MHBs_P-C      MQWNSSAFHQALQDPRVRGLYFPAGGSSSGTVSPVPNTVSHISSIFTKTG
KF873528_MHBs_P-C      MQWNSSAFHQALQDPRVRGLYFPAGGSSSGTVSPVQNTVSHISSIFTKTG
KF873529_MHBs_P-C      MQWNSSAFHQALQDPRVRGLYFPAGGSSSGTVSPVQNTVSHISSIFTKTG
KF873514_MHBs_P-C      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPVPNTVSPISSIFTKTG
KF873520_MHBs_P-C      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPVPNTVSPISSIFTKTG
KX276992_MHBs_P-C      MQWNSTTFHQALLDPKVRGLCFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053164_MHBs_P-C      IQWNSSTFHQTLKDSRVRGLNFPAGGSGSGTVNPVPTTASPISSTFSRTG
KJ803757_MHBs_P-C      IQWNSSTFHQTLKDSRVRGLNFPAGGSGSGTVNPVPTTASPISSTFSRTG
D28880_MHBs_P-C        MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRTG
S75184_MHBs_P-C        MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRTG
KJ717799_MHBs_P-C      IQWNSTTFHQACLDPRVRGLYFPAGGSSSGTANPVPTSASPISSIFSRTG
KJ803790_MHBs_P-C      IQWNSTTFHQACLDPRVRGLYFPAGGSSSGTANPVPTSASPISSIFSRTG
FJ386626_MHBs_P-C      IHCHSTLFHQVLRDPLVAGGYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY363258_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTALPISSIFSRTG
KX276980_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
GQ924642_MHBs_P-C      VKWNSSTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053168_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803760_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ478901_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG571345_MHBs_P-C      MQWNSRTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KX276991_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276841_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700575_MHBs_P-C      MQWNSTTFXQALLDXRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700570_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVHPVPTTASPISSIFSRTG
EU306672_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASHISSIFSRTG
DQ089797_MHBs_P-C      MQWNSTTIHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSNFSRTG
AF458665_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367434_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB049610_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KR014137_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFPRTG
FJ562292_MHBs_P-C      MQWNPTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093896_MHBs_P-C      IQWNSTTFQQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014360_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
X75665_MHBs_P-C        MQWNSTTFQQALQDPRVRVLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KY363278_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVDPVPTTASHISSIFSRTG
KY363279_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVDPVPTTASHISSIFSRTG
KX276993_MHBs_P-C      MQWNSTTFHQALLDPRVRGLCFPAGGSSSGTVNPVPTTASPISSIFSKIG
JX026877_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700490_MHBs_P-C      IQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRTG
FJ562299_MHBs_P-C      MQWNSTTFHQALIHAGVRGLYFPAGGSTSGTAKPAPTTATAISAIFSRTG
EU871975_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU871977_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093902_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
DQ377164_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
DQ089758_MHBs_P-C      VQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
AY206381_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB900109_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB713890_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSKTG
AB042285_MHBs_P-C      MHWNSIKFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014372_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSNSGTVNPVPTTASPISSIFSRTG
JN370955_MHBs_P-C      MQWNSTTFHQVLLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
JN604226_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFLRTG
GQ924620_MHBs_C-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTTNPVPTTASPISSIFSRTG
AB241110_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
AB241111_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
AP011099_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
AP011100_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
AP011101_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
EU410080_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
EU410081_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
GQ924622_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
JQ281126_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM011468_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715360_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715359_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386611_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ032356_MHBs_P-C      MQWNSPTFHQALLDPRVRGLHFPAGGSGSGTVNPVPTTASPISSIFSRTG
FJ032355_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939625_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
EU939546_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU306671_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASHISSIFSRTG
DQ089804_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089802_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYXPAGGSSSGAVNPVPTTASPISSIFSRTG
AY596107_MHBs_P-C      MQWNFTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB900113_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670272_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670258_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB246346_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014385_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU871980_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFHAGGSSSGTVNPVPTTASPISSIFSRTG
EU871998_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFHAGGSSSGTVNPVPTTASPISSIFSRTG
EU570073_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASPISSIFSRTG
EU570074_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASPISSIFSRTG
AF241410_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
AF241411_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
KC793046_MHBs_P-C      MQWNSTTFHQALLNPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ899774_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562334_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
FJ562241_MHBs_P-C      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFLRTG
FJ032351_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU939588_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU522071_MHBs_P-C      TQWNSTTFQQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
EU522068_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
EU075315_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSSFSRTG
DQ089763_MHBs_P-C      TQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY641559_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014369_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670239_MHBs_P-C      VKWKSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670240_MHBs_P-C      VKWKSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU306726_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
EU306728_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
EU306722_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
HQ700456_MHBs_P-C      MQWNATTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTXSPISSIFSRTG
HQ700475_MHBs_P-C      MQWNATTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598724_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964239_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JF436920_MHBs_P-C      MQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700571_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700496_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377557_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715352_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715353_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562340_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386653_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSTFSRTG
FJ386631_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTINPVPTTASPTSSIFSRTG
FJ386602_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ032336_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939603_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939550_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU871971_MHBs_P-C      MQWNSTTFHQALLDPRVRGLCFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ478900_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPISSIFSRTG
DQ478899_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVHPVPTTASPISSIFSRTG
DQ377165_MHBs_P-C      MQWNPTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
DQ377162_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
DQ089803_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089791_MHBs_P-C      IQWNSXTFHQALPDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AY206384_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF182804_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670253_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367420_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB195936_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB112065_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTENPVPTTASPISSIFSRTG
AB014365_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341634_MHBs_P-C      MQWNSTTFHXALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
X52939_MHBs_P-C        MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093895_MHBs_P-C      IQWNSTTFQQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093898_MHBs_P-C      IQWNSTTFQQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU881996_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ518813_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670277_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014379_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014392_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG826136_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGIVNPVPTSASPISSIFSRTG
KY881976_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276985_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ924643_MHBs_P-C      VQWNSHTFHQAVLNPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ358153_MHBs_P-C      MQWNSSTFHQSLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ899778_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787462_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787441_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPIPSIFSRTG
FJ715389_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562339_MHBs_P-C      MQWNSTTFHQALLDPRVRDLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562335_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562325_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386661_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939657_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939579_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939571_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
EU939539_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU916237_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSCSGTVNPVPTTASPISSIFSRTG
EU796069_MHBs_P-C      MQWNSTTFHQALLDPRVRGPYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU717215_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU670263_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSTFSRTG
EU589336_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
EU570067_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU560439_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU306721_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
EF137802_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVSTTASPISSIFSRTG
DQ370439_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
DQ141667_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089775_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089761_MHBs_P-C      XQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSVFSRTG
AY066028_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
AB971715_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB931170_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670295_MHBs_P-C      VCWNTTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670279_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367431_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB205123_MHBs_P-C      MRWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTAPPISSIFSRTG
AB112472_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB112348_MHBs_P-C      MQWNSSTFHQALLEPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB112066_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB111123_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTINPVPTTASPISSIFSRTG
AB042284_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014396_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014393_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014380_MHBs_P-C      MQWNSTTFHQALLNPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF461357_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF461363_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367404_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386579_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB031262_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB111946_MHBs_P-C      MQWNSSTFHQALLDPKVRGLYLPAGGSSSGTVNPVQTTASPISSIFSRTG
AB112063_MHBs_P-C      MQWNSSTFHQALLDPKVRGLYLPAGGSSSGTVNPVQTTASPISSIFSRTG
FJ386657_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
GQ377583_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
DQ089801_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
EU554540_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
AB111124_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB111125_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB246344_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG826140_MHBs_P-C      MQWNSTTFHQALLGPKVRGLDLPAGGSSSGTVNPVPTSASPISSIFSKTG
MG571359_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881891_MHBs_P-C      MQWNSTTFHQALLDPKVRSLYFPAGGPSSGTGNPVPTTASPISSIFSRTG
KX765855_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803826_MHBs_P-C      MQWNSSTFHQALLDARVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRNG
KJ717844_MHBs_P-C      MQWNSSTFHQALLDARVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRNG
JQ801491_MHBs_P-C      MQWNSSTFHQALLDPRVRGLDFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604135_MHBs_P-C      MQWNYRTFHQALLDPRVRDLCFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604133_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475353_MHBs_P-C      MQWNTTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ377609_MHBs_P-C      MQWNSTTFQQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377608_MHBs_P-C      IQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSSFSRTG
GQ377546_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ899772_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTG
FJ787453_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
FJ787454_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
FJ715377_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
FJ562333_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562310_MHBs_P-C      MQWNFTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562295_MHBs_P-C      MHRNSTTFHQALLDPLAGGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562261_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562256_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386623_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
FJ386603_MHBs_P-C      MQWNSTTFHHSLLDPRVRGLYFAAGGSSSGTVNPVPTTASPISSIFSRTG
EU939619_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939609_MHBs_P-C      MQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939594_MHBs_P-C      TQWNSPTFHQTLLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939592_MHBs_P-C      TQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU796070_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
EU796072_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
EU562215_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU560438_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY206386_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AY167090_MHBs_P-C      MQWNSTTLHQALLDPRVRGLYFPAGGSSSGTVNPVPTIVSPISSIFSRTG
AB971714_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367411_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367412_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367397_MHBs_P-C      MHWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB195953_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
AB195954_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
AB111114_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014367_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089776_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089777_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MH818373_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG826139_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSASGTVNPVPTSASPISSIFSRTG
KY470911_MHBs_P-C      MRWNSSTFHQALLDPRVRGLYCPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276846_MHBs_P-C      MQWNSSTFHQALLDPRXRGXXFPAGGSSSGTVNPVPTTXSPISSIFSRTG
KJ598734_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ410515_MHBs_P-C      MKWNSSTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792995_MHBs_P-C      IKWNSTTFHQALLDPRVKSLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792740_MHBs_P-C      MQWNSTTFHQALLDPRVGHPYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX125372_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
JN827414_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
GU721029_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRTG
GQ924616_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ855376_MHBs_P-C      MQWNSSTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377620_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377555_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377529_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
FJ787468_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562276_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPXSSIFSRTG
FJ562264_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ032350_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ023645_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTLNPVPTTASPISSIFSRTG
FJ023639_MHBs_P-C      MQWNSNTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIXSRTG
EU939564_MHBs_P-C      VKWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTPASPISSIFSRTG
EU939544_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU562217_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU306725_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
DQ141657_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVQTSASPISSIFSRTG
DQ089787_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089773_MHBs_P-C      IQWNSKTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSILSRTG
DQ089772_MHBs_P-C      MQWNSSTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089766_MHBs_P-C      TQWNSSTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089760_MHBs_P-C      IQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF533983_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB900099_MHBs_P-C      VQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB697494_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTANPVPTTASPISSTFSRIG
AB367394_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB300372_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB198080_MHBs_P-C      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB195949_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB195932_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTANPVPTTASPISSIFSRTG
AB111119_MHBs_P-C      VQWKSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014399_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598730_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964230_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF384371_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU560441_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787486_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ899776_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377571_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSILSRTG
GQ377599_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377615_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475349_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475345_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475341_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377623_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377597_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562298_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562269_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
FJ562266_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRTG
FJ562248_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASPISSIFSRTG
EU939613_MHBs_P-C      XQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939573_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
EU939568_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU554535_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU086837_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASPISSIFSRTG
AB670289_MHBs_P-C      MQWNSTTFXXALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ922650_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964358_MHBs_P-C      MQWNSTTFRQAXXXXXXXXXXXPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964349_MHBs_P-C      MQWNSTTFRQAXXXXXXXXXXXPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964363_MHBs_P-C      MQWNSTTFRQAXXXXXXXXXXXPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964182_MHBs_P-C      IQWNSTTFHQALXXXXXXXXXXPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964174_MHBs_P-C      IQWNSTTFHQALXXXXXXXXXXPAGGSSSGTVNPVPTTASPILSIFSRTG
KU964176_MHBs_P-C      IQWNSTTFHQALXXXXXXXXXXPAGGSSSGTVNPVPTTASPILSIFSRTG
KU964178_MHBs_P-C      IQWNSTTFHQALXXXXXXXXXXPAGGSSSGTVNPVPTTASPILSIFSRTG
KU964179_MHBs_P-C      IQWNSTTFHQALXXXXXXXXXXPAGGSSSGTVNPVPTTASPILSIFSRTG
KU964181_MHBs_P-C      IQWNSTTFHQALXXXXXXXXXXPAGGSSSGTVNPVPTTASPILSIFSRTG
KU964183_MHBs_P-C      IQWNSTTFHQALXXXXXXXXXXPAGGSSSGTVNPVPTTASPILSIFSRTG
KU964184_MHBs_P-C      IQWSSTTFHQALXXXXXXXXXXPAGGSSSGTVNPVPTTASPILSIFSRTG
JQ027324_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341649_MHBs_P-C      XQWNXXTFHQALLDXKVRGLYFPAGGSSSGTVNPVPTTXSPISSIFSRTG
MG826137_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTG
KY882003_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTVSPISSIFSRTG
KY470908_MHBs_P-C      MRWNSSTFHQALLDPRVRGLYCPAGGSSSGTVNPVPTTASPISSISSRTG
KR013871_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
KJ598733_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598715_MHBs_P-C      MQWNSTTFQQALLDPRVRGLYFPAGGSSSVTVNPVPTTASPISSIFSRTG
KJ598686_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598679_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF485389_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTXNPVPTTASPISSTFSRIG
KC792902_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792853_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGIVNPVPTTVSPISSIFSRTG
KC774290_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341652_MHBs_P-C      MQWNSSTFHXXXXXXXXXXXXXPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040132_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTX
JF828937_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700506_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700457_MHBs_P-C      MQWNSTTFHQAXLDPRXRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GU357845_MHBs_P-C      MQWNSTIFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ924655_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475328_MHBs_P-C      MQWNSTTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377631_MHBs_P-C      MQWNSSTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377533_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
GQ184326_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787479_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787450_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPTSSIFSRTG
FJ787448_MHBs_P-C      MQWNSTTFHQALLDPGVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787445_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787443_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787442_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787437_MHBs_P-C      MQWNSPTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715421_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTTASPISSIFSRTG
FJ715418_MHBs_P-C      VQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715390_MHBs_P-C      VQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715381_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTTASPISSIFSRTG
FJ715379_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
FJ715351_MHBs_P-C      VQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715341_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
FJ562332_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562300_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562288_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
FJ562280_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562273_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562249_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562238_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562235_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386673_MHBs_P-C      TQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSXFSRTG
FJ386628_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386627_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
FJ386604_MHBs_P-C      MQWNSPTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386601_MHBs_P-C      IQWNSATFHQALLDPRVRGLYFPAGGSFSGTVNPVPTTASPTSSIFSRTG
FJ386597_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTINPVPTTASPISSIFSRTG
FJ386592_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386577_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ032361_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ032346_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ032339_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ032338_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939626_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
EU939616_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939614_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939595_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939587_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939538_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU916238_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU871976_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU306720_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSRSGTVNPVPTTVSPISSIFSRTG
EU306719_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
EU306714_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
EU306713_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
EU093911_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093908_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU086842_MHBs_P-C      AQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU082432_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EF137803_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ993692_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ993691_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ980547_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ975273_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ478885_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASPISSIFSRTG
DQ377161_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
DQ370438_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTINPVPTTASPTSSIFSRTG
DQ141662_MHBs_P-C      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ141660_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTG
DQ089792_MHBs_P-C      MQWNSSTFHQALLDSRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089765_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089762_MHBs_P-C      MQWNSRTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089757_MHBs_P-C      MQWNSSTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY582136_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY206382_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AP011107_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTG
AP011106_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTG
AJ748098_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF411411_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
AF411408_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
AF223955_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB931171_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB713885_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSKTG
AB670281_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670251_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB195952_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB195948_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB113879_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB033550_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014364_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475325_MHBs_P-C      MQWNSTTFHQALLDPRVRGL--PAGGSSSGTVNPVPTTASPISSIFSRTG
KY881999_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPADGSSSGTVNPVPTTASPISSIFSRTG
KY881974_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881881_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881878_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY470873_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX774504_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPGPTTASPISSIFSRTG
KX276984_MHBs_P-C      MQWNSTTFHQALLDPRVRGLCFPAGGSSSGTVNPVPTTASPTSSIFSRIG
KX276963_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRIG
KU964064_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KR014083_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRAG
KR014011_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYFLAGGSSSGTVNPVPTTASPISSIFSRTG
KR013875_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013767_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPADGSSSGTVNPVPTTASPISSIFSRTG
KJ803766_MHBs_P-C      IQWNSSTFHQALLDPRVRGLYLPAGGSSSGTGNPVPTTASPISSIFSRTG
KJ598665_MHBs_P-C      MQWNSTTFHQALPDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KF779327_MHBs_P-C      MQWNSTTFHQALLDPRVRDLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053173_MHBs_P-C      IQWNSSTFHQALLDPRVRGLYLPAGGSSSGTGNPVPTTASPISSIFSRTG
KC792857_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792818_MHBs_P-C      MQWNSTTFHQALLNPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792746_MHBs_P-C      XXWNSTTFXQALLDPRVRXLYFPAGGSXSGTVNPVPTTASPISSIFSRTG
KC774265_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
KC774205_MHBs_P-C      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX429913_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
JQ801472_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFARTG
JQ341632_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
JQ341612_MHBs_P-C      MQWNSNTFHQALLDPRMRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ027318_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN827415_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
HQ700558_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700556_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700555_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGXSSSGTVNPVPTTASPISSIFSRTG
HQ700544_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700543_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700529_MHBs_P-C      XQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTIASPISSIFSRTG
HQ700522_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700516_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNLVPTTASPISSIFSRTG
HQ700495_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM750137_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGIVNPVPTTASPISSILSRTG
HM011493_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ924636_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ924629_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475331_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
GQ475322_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRTG
GQ377628_MHBs_P-C      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFXRTG
GQ377619_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377601_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPITASPTSSIFSRTG
GQ377543_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ899771_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ899769_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787449_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTINPVPTTASPTSSIFSRTG
FJ715404_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
FJ715391_MHBs_P-C      VQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715376_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386679_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386605_MHBs_P-C      MQWNSTTFHQALLDPXVRGLYFPAGGSSSGTXNPVPTTASPISSIFSRTG
FJ032334_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ023656_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ023646_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ023644_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ023643_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939653_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
EU939642_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYTLAGGSSSGTVNPVPTTASPISSIFSRTG
EU939586_MHBs_P-C      TQWNSTTVHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939566_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU570072_MHBs_P-C      TQWTSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU306690_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU305541_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYVPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093917_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093915_MHBs_P-C      MQWYSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093910_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093883_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU086845_MHBs_P-C      AQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EF688062_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ141665_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPISSIFSRTG
DQ089788_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089768_MHBs_P-C      TQWNSSTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
D12980_MHBs_P-C        MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
D10055_MHBs_P-C        MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY641563_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF363961_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB697502_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670274_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670273_MHBs_P-C      TKWNSTTFHQVLLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670270_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYVPAGGSSSGTVNPVPTTASPISSIFSRTG
AB195931_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTANPVPTTASPISSIFSRTG
AB111120_MHBs_P-C      VQWKSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MG826132_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTG
MF925403_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674417_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881886_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSILSRTG
KY881874_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881870_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KU964243_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964241_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964238_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964236_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964220_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803823_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803777_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803774_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803762_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSVFSRTG
KJ717839_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598738_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598737_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598732_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598731_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598729_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598728_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598727_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598726_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598725_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598723_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598722_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598721_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598720_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF214673_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053184_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053181_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053170_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSVFSRTG
KC792831_MHBs_P-C      MQWNSTTFHQALADPRVRGLYLPAGGSGSGTVNPVPTTASPISSIFSRTG
KC774353_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774319_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774207_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRIG
JX125366_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX036326_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
JQ341620_MHBs_P-C      MQWNSSTFHQTLLDPRVKGLYFPAGGSSSXTVNPVPTTASPISSIFSRTG
JQ040144_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVSPVPTTASPISSIFSRTG
JQ027321_MHBs_P-C      MQWNSNTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFXRTG
JN604140_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN315779_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700517_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM011486_MHBs_P-C      VXWNSSTFHQALLDPXVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ872211_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377536_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377530_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377524_MHBs_P-C      IQWNSTKFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787469_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562337_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386651_MHBs_P-C      MHWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386618_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386614_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ032345_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISPIFSRTG
FJ023648_MHBs_P-C      IKWNSSTFHQALLDPRVRGLYIPAGGSSSGTVNPVPTTASPISSIFSRTG
EU554542_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU554541_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU439015_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EF384206_MHBs_P-C      XQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089783_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089767_MHBs_P-C      MQWNSSTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF384372_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670249_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG826138_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTG
MF674390_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF488701_MHBs_P-C      MHWNSSTFHQALLDPRVRGLYLLAGGSSSGTVNPVPTTASPISSIFSRTG
KY882001_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881890_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPILSIFSRTG
KY881815_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470879_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPGPTTASPLSSIFSRTG
KY363260_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276959_MHBs_P-C      TQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT284758_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSLFSRIG
KR014015_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR014010_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYFHAGGSSSGTVNPVPTIASPISSIFSRTG
KR013853_MHBs_P-C      MQWNSTTFHQALPDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013848_MHBs_P-C      MQWNSTTFHQALPDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013770_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013769_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803809_MHBs_P-C      TQWNSRGLYLALADPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ717821_MHBs_P-C      TQWNSRGLYLALADPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF779242_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF214671_MHBs_P-C      VQWNSSAFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF214670_MHBs_P-C      IQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
JX504537_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ341654_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341653_MHBs_P-C      LQWXXGTFHQALLDPRGRGLYFPAGGSSSRTVNPVPTTASPISSIFSRTG
JQ341643_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ281123_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040168_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040141_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ027323_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSTFSRTG
JN827417_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604243_MHBs_P-C      AQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700476_MHBs_P-C      MQWNATTFHQALLDPRVXGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM750136_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
HM750131_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GU434374_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ924633_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475356_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475348_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475336_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475330_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475321_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475314_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475310_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
GQ475308_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475307_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475306_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377640_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377637_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377636_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377624_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377621_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASPISSIFSRTG
GQ377617_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377605_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377603_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377600_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377593_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377591_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
GQ377586_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377584_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTENPVPTTASPISSIFSRTG
GQ377580_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377579_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377577_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
GQ377576_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377574_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377572_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
GQ377552_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377551_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377528_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377527_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377526_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377523_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377521_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377515_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377514_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ899777_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787447_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787439_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715409_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715407_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715403_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715402_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715383_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715382_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715380_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
FJ715378_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
FJ715374_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562330_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562329_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562327_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562324_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562323_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
FJ562313_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562308_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562304_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562293_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562291_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562285_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASPISSIFSRTG
FJ562283_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562282_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
FJ562281_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562275_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562274_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562272_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562268_MHBs_P-C      IQWNSTTFHKALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562258_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562255_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562252_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562251_MHBs_P-C      LQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
FJ562244_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562242_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562239_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562232_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562218_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386685_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSISSRTG
FJ386670_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386659_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386644_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386639_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386637_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386630_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTXSPISSIFSRTG
FJ386619_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386609_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386598_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386591_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386588_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386587_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386574_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ032359_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939654_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939652_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939648_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
EU939618_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939611_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939610_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939605_MHBs_P-C      SQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939604_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPDGGSSSGTVNPVPTTASPISSIFSRTG
EU939600_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939591_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939590_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939585_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939582_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939570_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939567_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939562_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939554_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939543_MHBs_P-C      MQWNSTTFHQALLDPTVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939541_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU916225_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
EU916210_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU872012_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU872010_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU871982_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU871979_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSRTVNPVPTTASPISSIFSRTG
EU871978_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU717212_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU570068_MHBs_P-C      LQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU554539_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU554538_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU554537_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTG
EU306675_MHBs_P-C      MQWNSTTFHQALLDPRVQGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU306674_MHBs_P-C      MQWNSTTFHQALLDPRVQGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU306673_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093918_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093916_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093914_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093913_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093912_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093909_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093907_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU093903_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU086847_MHBs_P-C      AQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU086846_MHBs_P-C      AQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU086844_MHBs_P-C      AQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU086843_MHBs_P-C      AQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU086839_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTINPVPTTASPISSIFSRTG
EU082435_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU082431_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU082430_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU082429_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU082428_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU075342_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU075336_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU075335_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU075334_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EF494379_MHBs_P-C      VQWNSNTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EF384200_MHBs_P-C      IQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ993693_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ986375_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ975272_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ922651_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ922649_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ141656_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089799_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089793_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
D23684_MHBs_P-C        IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
D00630_MHBs_P-C        MQWNSTTFHQAVLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AY641558_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY596108_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY247032_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPTSSIFSRTG
AY247031_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
AY167096_MHBs_P-C      MQWNSKTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY167091_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AP011098_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF461359_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF461358_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF458664_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF068756_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB900116_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB675677_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670311_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670302_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670285_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670282_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670276_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670275_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670269_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
AB670267_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670261_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG826143_MHBs_P-C      MQWNSTTFHQALLDPRVRGLDLPAGGSSSGTVNPVPTTASPISSIFSRTG
MG826128_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSGTG
MF925409_MHBs_P-C      MQWNSNTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279256_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279252_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881996_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881995_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881993_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881992_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881991_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881988_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881986_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881983_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881982_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881981_MHBs_P-C      MQWNSTTFHQALLGPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881980_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881977_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881973_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881970_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881969_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881968_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPATASPISSIFSRTG
KY881965_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881963_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881961_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881959_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881938_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881936_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881935_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881934_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881933_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881932_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881931_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881930_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881929_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881928_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881927_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881926_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881925_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881924_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881923_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881921_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881919_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881917_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881916_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881892_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881887_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881885_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881880_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881877_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881876_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881872_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881871_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY629637_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470987_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470973_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
KY470906_MHBs_P-C      MQWNSSTFHQALLDHRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470888_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSVFSRTG
KY470886_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSVFSRTG
KY470880_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY363287_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY363286_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY363252_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276838_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFTRTG
KU964222_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964218_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964213_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSVFSRTG
KU964212_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSVFSRTG
KU964211_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSVFSRTG
KU964210_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSVFSRTG
KU964209_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSVFSRTG
KU964208_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSVFSRTG
KU964207_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSVFSRTG
KU964206_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSVFSRTG
KU964204_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSVFSRTG
KU964201_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSVFSRTG
KU963911_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
KU051424_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT364751_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFARTG
KT284755_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
KR819180_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR014082_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
KR014078_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
KR014077_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
KR013993_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013923_MHBs_P-C      MQWNSTTFHQALLDHRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KR013900_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013867_MHBs_P-C      IQWNSTTFHKTLLDPRVRGLYFPAGGSSSGTVNPVPTTASSISSIFSRTG
KR013866_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013846_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
KR013817_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013799_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013777_MHBs_P-C      MQWNSTTFHQALLDPRARGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KR013771_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSTGTVNPVPTTASPISSIFSRTG
KJ803770_MHBs_P-C      MQWNSSTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSKTG
KJ803754_MHBs_P-C      MQWNSSTFHNALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ717833_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
KJ717791_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598717_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598710_MHBs_P-C      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598707_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598678_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598677_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598676_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598674_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598673_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598672_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598671_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598670_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598669_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598668_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598667_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598666_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598664_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598663_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ410495_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
KJ410494_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRTG
KJ410493_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRTG
KJ410491_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRTG
KJ173335_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KJ173319_MHBs_P-C      MQWNSTTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173314_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KJ173313_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KF495606_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053177_MHBs_P-C      MQWNSSTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSKTG
KF053161_MHBs_P-C      MQWNSSTFHNALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC793195_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC793129_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KC793107_MHBs_P-C      IQWNSTTFHQXLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792716_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792710_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC792700_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774325_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRIG
KC774304_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774303_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774302_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774301_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
KC774281_MHBs_P-C      MQWNSTTFRQALLDPRVRGLYFPAGGSSSGTVNPVPITASPISSIFSRTG
KC774269_MHBs_P-C      MKWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774219_MHBs_P-C      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774204_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRIG
JX560520_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
JX504535_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX504534_MHBs_P-C      MQWNSTTFHQALLDPGVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRTG
JQ429078_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
JQ341630_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341628_MHBs_P-C      XQWNSXTFHQALTDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604281_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604246_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604215_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604148_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604131_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JF828920_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
JF828919_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
JF828918_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
JF828917_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
JF828916_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
JF828915_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
JF828913_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
HM011491_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASPISSIFSRTG
HM011489_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM011472_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM011465_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GU563561_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ924650_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASPISSIFSRTG
GQ924649_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ924615_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ924614_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ924613_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ924612_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ924609_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ924604_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ872210_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ855393_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475346_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475342_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
GQ475339_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475338_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475337_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475332_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475329_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475324_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475323_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475320_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475319_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475317_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475315_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475313_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475312_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475311_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475305_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377642_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377632_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ358154_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562307_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386687_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386596_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ349225_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ023658_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ023657_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ023654_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ023653_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ023650_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ023649_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ023647_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ023642_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ023641_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939578_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939563_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU882005_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU306694_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU306691_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU306689_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU306688_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU306687_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU306685_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU305542_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ141668_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ141664_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ141663_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089789_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089784_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089782_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089781_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
D50519_MHBs_P-C        MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AF286594_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB697500_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670305_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670290_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670283_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670266_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670262_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367414_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040139_MHBs_P-C      MQWNSTTFHQALLDPRVRGL--PAGGSSSGTVNPVPTTASPISSIFSRTG
MG826129_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYVPAGGSSSGTVNPVPTSASPISSIFSRTG
MG571335_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674489_MHBs_P-C      MKWNSRTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
LC279255_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881997_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881994_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881990_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPMSSIFSRTG
KY881979_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881971_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881966_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881962_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPMSSIFSRTG
KY881915_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881889_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881888_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881883_MHBs_P-C      IRWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSILSRTG
KY881882_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY470925_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470905_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY363274_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGDSSSGTVNPVPTTASPISSIFSRTG
KY363268_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276853_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276852_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964228_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964227_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964226_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964225_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964224_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964223_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964217_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964216_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964215_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964214_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964032_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963920_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
KR013852_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYPPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013823_MHBs_P-C      MKWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013820_MHBs_P-C      MQWNSGTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013809_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPASGSSSGTVNPVPTTASPISSIFSRTG
KR013778_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KR013766_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013764_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013763_MHBs_P-C      MQWNSTTFHQTPLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148524_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148521_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148512_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KM359441_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803812_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803794_MHBs_P-C      MQWNSNTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803769_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTIASPISSIFSRTG
KJ717825_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ717804_MHBs_P-C      MQWNSNTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598660_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598642_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRTG
KJ598641_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ410521_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF779300_MHBs_P-C      MQWNSTTFHQALLDPKVGGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF485390_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053175_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTIASPISSIFSRTG
KC875262_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792926_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792706_MHBs_P-C      MQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
KC774358_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYLPAGGSGSGTVNPVPTTASPISSIFSRTG
KC774296_MHBs_P-C      MRWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774277_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVLPTSSIFSRTG
KC774254_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
KC774211_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
KC774189_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
JX507212_MHBs_P-C      VQWNSSTFHLALLDPRVRGLYFPAGGSSSGTXNPVPTTASPISSIFSRTG
JX125375_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX125374_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX125373_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX125370_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSISGTVNPVPTTASPISSIFSRTG
JQ801493_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341651_MHBs_P-C      IQWNSSTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341650_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040131_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN827423_MHBs_P-C      MQWNSSIFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN827418_MHBs_P-C      MQWNSNTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604121_MHBs_P-C      IQWNSSTFHQALLDPRVRGLYVPAGGSSSGTVNPVPTTASPISSIFSRTG
HM011500_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475357_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670243_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
X04615_MHBs_P-C        MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG571332_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674408_MHBs_P-C      MQWNSSTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881998_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881964_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881817_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470920_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470885_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGPSSGTVNPVPTTASPISSILSRTG
KY363283_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
KY363282_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
KY363281_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY363253_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765821_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTG
KX276981_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTIVSPISSIFSRTG
KX276844_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276839_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
KU964348_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964347_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964346_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964345_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964344_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964343_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964342_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964340_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964339_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964338_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964337_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964336_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964334_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964200_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSVFSRTG
KU964171_MHBs_P-C      MQWNYTTFHQALLDPRVRSLYRPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964078_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964077_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964075_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964074_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964073_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964072_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964071_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964070_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964069_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964068_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964067_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964066_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KU964065_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KR014012_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013927_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013902_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013882_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KR013877_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTG
KR013876_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTG
KR013874_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTG
KR013872_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTG
KR013859_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013842_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013839_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIYSRTG
KR013801_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013772_MHBs_P-C      MQWNATTFHQTLLDPRVRGLYFPAGGSSTGTVNPVPTTASPISSIFSRTG
KJ803818_MHBs_P-C      MFWNSLTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KJ803810_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ717834_MHBs_P-C      MFWNSLTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KJ717822_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598743_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598716_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598662_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ410511_MHBs_P-C      VQWNSRTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSISSRTG
KJ410499_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173305_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF214655_MHBs_P-C      MQWNSATFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KC793202_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC793142_MHBs_P-C      IKWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KC793108_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFLRTG
KC792775_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774335_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
JX504541_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX504539_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
JX125371_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801521_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801515_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVQTTASPISSIFSRTG
JQ341658_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341648_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341641_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTXASPISSIFSRTG
JQ341636_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341616_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
JQ341615_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341613_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ281128_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ281122_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFTRTG
JQ281114_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040172_MHBs_P-C      XQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040166_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040165_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040163_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040162_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040155_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040151_MHBs_P-C      XQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN827420_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604258_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604254_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTG
JN604231_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYIPAGGSSSGTVNPVPTTASPTSSIFSRTG
JN604153_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604151_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN400089_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN400088_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN400087_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JF899336_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ622095_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM750141_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
HM750140_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM750138_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM750135_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM750134_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM750132_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089780_MHBs_P-C      MQWNXSTFHQALLDPRVRGXYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670241_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MH891502_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
MG826135_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTG
MG826134_MHBs_P-C      MQWTSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTG
MG826133_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTG
MG826131_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTSASPISSIFSRTG
MG826127_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG826126_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG826124_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG826123_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG725248_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925398_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925376_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925374_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRTG
MF925359_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRTG
MF674504_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674471_MHBs_P-C      TQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674467_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674458_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRTG
MF674430_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674425_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRTG
MF674399_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC373511_MHBs_P-C      MQWNSTTFHQALRDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279275_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPISSIFSRTG
LC279257_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279254_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY882000_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881989_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881987_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSILSRTG
KY881985_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881984_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPVGGSSSGTGNPVPTTASPISSIFSRTG
KY881978_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881975_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881967_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881960_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTGNPVPTIASPISSIFSRTG
KY881943_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881942_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881941_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881940_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881939_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881937_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881922_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881920_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881918_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881884_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTGNPVPTIASPISSIFSRTG
KY881879_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881875_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTGNPVPTTASPISSIFSRTG
KY881812_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881802_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY670782_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY629631_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470991_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470990_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470988_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470986_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470985_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470984_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470983_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470982_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470981_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470980_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470979_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470978_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470977_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470976_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470975_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470974_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470972_MHBs_P-C      MQWNSTTFHQALLGPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470971_MHBs_P-C      MQWNSTTFHQALLGPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470970_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470969_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470968_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470967_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470966_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470965_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470933_MHBs_P-C      MQWNSTTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470930_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470918_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470917_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470914_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470913_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470910_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470909_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470907_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470897_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRTG
KY470892_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470889_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470884_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470883_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470881_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470878_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470876_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765851_MHBs_P-C      MQWNSSTFHQALLDSRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765831_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
KX765823_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRTG
KX276979_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KX276851_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
KU964333_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPTSSIFSRTG
KU964332_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPTSSIFSRTG
KU964331_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPTSSIFSRTG
KU964330_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPTSSIFSRTG
KU964329_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPTSSIFSRTG
KU964328_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPTSSIFSRTG
KU964327_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPTSSIFSRTG
KU964326_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPTSSIFSRTG
KU964325_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPTSSIFSRTG
KU964324_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPTSSIFSRTG
KU964323_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPTSSIFSRTG
KU964322_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPTSSIFSRTG
KU964321_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPTSSIFSRTG
KU964320_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPTSSIFSRTG
KU964319_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPTSSIFSRTG
KU964318_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYNPAGGSSSGTVNPVPTTASPTSSIFSRTG
KU964205_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSVFSRTG
KU964203_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSVFSRTG
KU964202_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSVFSRTG
KU964177_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964172_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964170_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964169_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964043_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964033_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964031_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964030_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964029_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964028_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964027_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964026_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964025_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964024_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964023_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964022_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964021_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964020_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964014_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964012_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964002_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963914_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963913_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963912_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963910_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963909_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963908_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963907_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963906_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963905_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963904_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963903_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963902_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963901_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963900_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963880_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963878_MHBs_P-C      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT987425_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPNTASPISSIFSRTG
KT366463_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT364752_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KR014048_MHBs_P-C      MQWNSITFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR014021_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIYSRTG
KR013909_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSTGTVNPVPTTASPISSIFSRTG
KR013905_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013890_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KR013870_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
KR013862_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013854_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013841_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIYSRTG
KR013840_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIYSRTG
KR013833_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013829_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013827_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVQTTASPISSIFSRTG
KR013825_MHBs_P-C      MQWNSGTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013819_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013812_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013804_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013802_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013800_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013791_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013782_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013776_MHBs_P-C      MQWDSTTFHQTLLDPRVRGLYFPAGGSSTGTVNPVPTTASPISSIFSRTG
KR013774_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSTGTVNPVPTTASPISSIFSRTG
KR013773_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSTGTVNPVPTTASPISSIFSRTG
KR013768_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013765_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KR013762_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013761_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148575_MHBs_P-C      MQWNSSTFHQALLDPRVRGLCFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148564_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148563_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148561_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148545_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148514_MHBs_P-C      MQWNSSTFHQALLDSRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148513_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPISSIFSRTG
KP148469_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148465_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803800_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
KJ717812_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
KJ717809_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598753_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598752_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598751_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598749_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598746_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598740_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598719_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598718_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598714_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598713_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598712_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598711_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598709_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASPISSIFSRTG
KJ598708_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598706_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598705_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598703_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598687_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598681_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598680_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
KJ598646_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ410518_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSVFSRTG
KJ410492_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ410489_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
KJ173396_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
KJ173395_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
KJ173333_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173323_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173316_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KJ173309_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173282_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173281_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF214675_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF214667_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053193_MHBs_P-C      MQWNSNTFHTALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC875273_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVKPVPTTASPISSIFSRTG
KC875270_MHBs_P-C      MQWNSSTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC875269_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
KC875263_MHBs_P-C      MQWNSTTFHQAPLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC793123_MHBs_P-C      IRWNSTTFHQALLDPRVRGLYXPAGGSSSGTXNPVPTTASPTSSIFSRTG
KC793100_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTG
KC793024_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC793019_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792873_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792793_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792691_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792658_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774357_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774356_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASPISSIFSRTG
KC774355_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774352_MHBs_P-C      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774348_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774343_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774342_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774340_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSILSRTG
KC774336_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASLTSSIFSRTG
KC774318_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
KC774311_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774310_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774309_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774308_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774306_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774285_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774283_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
KC774271_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774270_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774266_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774264_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774253_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774252_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774247_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774245_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774242_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
KC774235_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774232_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774231_MHBs_P-C      MQWNSITFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774227_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774226_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774225_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KC774224_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774221_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774217_MHBs_P-C      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774209_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
KC774208_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
KC774202_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774200_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774196_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASLTSSIFSRTG
KC774194_MHBs_P-C      MQWNSTIFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
KC774192_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774187_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774185_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC315399_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX661497_MHBs_P-C      AQWNSITFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
JX661490_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX661489_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX507211_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX429907_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX125365_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX026888_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801523_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGIVNPVPTTASPISSIFSRTG
JQ801518_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801501_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801497_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801475_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
JQ801473_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ412089_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341626_MHBs_P-C      MQWNSSTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341621_MHBs_P-C      XQWNSSTFHQALLDPXVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341610_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPXSSIFSRTG
JQ281127_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040149_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ027320_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASPISSIFSRTG
JN827422_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604232_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM011479_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT366464_MHBs_P-C      MQWNSSTFHQALLDPRVRGLY--AGGSSSGTVNPVPTTASPISSIFSRTG
MG826122_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674514_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674486_MHBs_P-C      MQWNSSTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674435_MHBs_P-C      MQWNSSTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279274_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279251_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279250_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470929_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470902_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
KY470901_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
KY470894_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
KY470875_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIISRTG
KY363275_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY363264_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765849_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276854_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTXNPVPTTAYPISSIFSKTG
KX276848_MHBs_P-C      MKWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964341_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963929_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
KU963928_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
KU963927_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
KU963926_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
KU963925_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
KU963924_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
KU963923_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
KU963922_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
KU963921_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
KU963919_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
KU963918_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
KU963917_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
KU963916_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
KU963915_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
KU963873_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963872_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT987423_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT284757_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013858_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013851_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013850_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013836_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIYSRTG
KR013832_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013826_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013822_MHBs_P-C      MQWNSSTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP784761_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148559_MHBs_P-C      MQWNSSTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148535_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148477_MHBs_P-C      MQWNSSTFHQALLDPRVRGIYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148476_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148474_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPTGGSSSGTVNPVPTTASPISSIFSRTG
KP148473_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148472_MHBs_P-C      MQWNSSTFHQALLDPRVRGIYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598693_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598659_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ410510_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173306_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC875261_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSTSGTVNPVPTTASPISSIFSRTG
KC793110_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792940_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792880_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792679_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSSFSRTG
KC774329_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774321_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774300_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774289_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774288_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774284_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774279_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774267_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIYSRTG
KC774260_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774256_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
KC774214_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNRVPTTALPTSSIFSRTG
KC774213_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTALPTSSIFSRTG
KC774191_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
JX504542_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX429918_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVNPVPTTASPISSIFSRTG
JX429915_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX036327_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
JQ801495_MHBs_P-C      WKWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341662_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341657_MHBs_P-C      MQWNSSTFHQAXXXXXXXXXXXXAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341633_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341631_MHBs_P-C      MQXNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341618_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341614_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRXG
JQ040152_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040145_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ027333_MHBs_P-C      IQWNSSTFHQALLBPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN827421_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604147_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MH220971_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MG893553_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925395_MHBs_P-C      MQWNSNTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925365_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674444_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674429_MHBs_P-C      MQWNSSTFHQVLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881972_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881809_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470891_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470890_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470887_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470882_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY363254_MHBs_P-C      TQWNSPTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765832_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765830_MHBs_P-C      MQWNTSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963884_MHBs_P-C      MQWNSTTFHQVLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963881_MHBs_P-C      MQWNSTTFHQVLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963879_MHBs_P-C      MQWNSTTFHQVLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963876_MHBs_P-C      MQWNSTTFHQVLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR014043_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYVPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013908_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSTGTVNPVPTTASPISSIFSRTG
KR013864_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013861_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013860_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013849_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013845_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013844_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013838_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIYSRTG
KR013837_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIYSRTG
KR013811_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013808_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013805_MHBs_P-C      MQWTSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013796_MHBs_P-C      MQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013795_MHBs_P-C      MQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013794_MHBs_P-C      MQWNSTTFQQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013793_MHBs_P-C      MQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013792_MHBs_P-C      MQWNSTTFQQALLDPRVRGLYFPAGSSSSGTVNPVPTTASPISSIFSRTG
KP148568_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598768_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ410514_MHBs_P-C      IQWNSNTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173308_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173307_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173304_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173291_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC793040_MHBs_P-C      IHWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792999_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792927_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792834_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792817_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792762_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792680_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792669_MHBs_P-C      XQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
JX661493_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801504_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSTGTVNPVPTTASPISSIFSRTG
JQ801498_MHBs_P-C      IQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801490_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341669_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTVSPISSIFSRTG
JQ341665_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341661_MHBs_P-C      MQWNSSTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341644_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341642_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341637_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341624_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341622_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPISSIFSRTG
JQ341617_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341611_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASPISSIFSRTG
JQ281124_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ281121_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
JQ281120_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
JQ281119_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ281118_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ281117_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ281116_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ281113_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ281112_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040133_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFXAGGSSSGTVNPVPTTASPISSIFSRTG
JN827425_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN827424_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN827416_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604286_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604256_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604182_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604144_MHBs_P-C      MQWNSSTFHQXLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604129_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN604118_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM011497_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
V00867_MHBs_P-C        MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK818227_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MH887433_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MH094411_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
MG893560_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG893558_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG893557_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG893556_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG826125_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925410_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925408_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925406_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925405_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925394_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925387_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925377_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925375_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925369_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925367_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674502_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674501_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674494_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASPISSIFSRTG
MF674484_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674475_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674474_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674472_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674468_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674457_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674454_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674442_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674428_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674418_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674412_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674403_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674402_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674398_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674388_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674386_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF488703_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC373512_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC318703_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC318702_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279276_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279262_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279261_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279260_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279259_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279258_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279249_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279248_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279247_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279246_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279245_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC090200_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRTG
KY881777_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881776_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881775_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881774_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881773_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881772_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881771_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881770_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881769_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881768_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881767_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881766_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881765_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881764_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881763_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881762_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881758_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881755_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881754_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881751_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881750_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881749_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881748_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881744_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881743_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881742_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881739_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881738_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881737_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY881736_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470937_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPVSSIFSRTG
KY470936_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPVSSIFSRTG
KY470934_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470927_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470926_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470916_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470915_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470912_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470904_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470903_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470900_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470899_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470896_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470895_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470877_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470874_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY363284_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KY022423_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX774506_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX774503_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765853_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765850_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765848_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765847_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765846_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765845_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765844_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765843_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765842_MHBs_P-C      MQWNSSTFHKALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765840_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765839_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765838_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765837_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765836_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765834_MHBs_P-C      MQWNSNTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KX765833_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765829_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765828_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765827_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765826_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765825_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765824_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765822_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765820_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765819_MHBs_P-C      MQWNSSTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765818_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276976_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276973_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276968_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276965_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276964_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276960_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276847_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276835_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276831_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYCPAGGSSSETVHPVPTTASPTSSIFSRTG
KU964364_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964199_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964198_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964197_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964196_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964195_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964194_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964193_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964192_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964191_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964190_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964189_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964188_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964187_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964186_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964185_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964175_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTIASPISSIFSRTG
KU964173_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964063_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KU964062_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KU964061_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KU964060_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KU964059_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KU964058_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KU964057_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KU964056_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KU964055_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KU964054_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KU964053_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KU964052_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KU964051_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KU964050_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KU964049_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KU964048_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964047_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964046_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964045_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964044_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964041_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964040_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964039_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964038_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964037_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964036_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964035_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964034_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964019_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964018_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964017_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964016_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASPISSIFSRTG
KU964015_MHBs_P-C      MQWNSTTFHQALLDPRVRGPYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964013_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964011_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964004_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963997_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963996_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963992_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963899_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963898_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963897_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963896_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963895_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963894_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963893_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963892_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963891_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963890_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963889_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963888_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963887_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963886_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963885_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963882_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963877_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963875_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963874_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963871_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU051427_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU051426_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU051425_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU051423_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT987426_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT987424_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT364721_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT364718_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT347089_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT307719_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT307718_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT284759_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT284756_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT284754_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KT284753_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR014092_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPISSIFSRTG
KR013984_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013961_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013943_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013903_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013899_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013873_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013869_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013868_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013857_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013856_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013855_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013835_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIYSRTG
KR013834_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013831_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013830_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013828_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013824_MHBs_P-C      MQWNSSTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013821_MHBs_P-C      MQWNSSTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013815_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013814_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013813_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013810_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013807_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013798_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013797_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013786_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013784_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013783_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013781_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013780_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013779_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148574_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148573_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148572_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148571_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148570_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148567_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTAPPISSIFSRTG
KP148566_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148562_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148560_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148558_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148557_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148555_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148554_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148552_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148551_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148549_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148548_MHBs_P-C      MQWSSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148547_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148546_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148543_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148540_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148538_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148537_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148534_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148532_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148531_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148529_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148528_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148526_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148525_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148523_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148520_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148517_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148492_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148491_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148489_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148488_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148483_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148482_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148481_MHBs_P-C      MQWNSSTFHRALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148480_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148479_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148475_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148471_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148468_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148466_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148464_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148463_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148462_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148315_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP027477_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KM875429_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KM875428_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KM875424_MHBs_P-C      MQWNSSTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KM875423_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KM875406_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KM875405_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KM875404_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KM229703_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KM213037_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803815_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803813_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803811_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803799_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803793_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803792_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803779_MHBs_P-C      MQWNSPTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803776_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803765_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803761_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803759_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ790199_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ717828_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ717826_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ717823_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ717811_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ717810_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ717803_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ717802_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ717790_MHBs_P-C      MQWNSPTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598769_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598754_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598750_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598748_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598747_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598745_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598744_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598742_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598741_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598702_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598701_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598699_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598698_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598697_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598696_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598695_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598691_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598690_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598689_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598688_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598661_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598658_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598656_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598652_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598651_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598649_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598647_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598644_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRTG
KJ598639_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598638_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598636_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598635_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ410519_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ410513_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ410508_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ410504_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
KJ410501_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ410496_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173446_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSTTG
KJ173444_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173443_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173442_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173441_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173440_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173439_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173438_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173437_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173436_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173435_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173434_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173433_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173432_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173431_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173430_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173429_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173428_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173427_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173426_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173394_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173393_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173392_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173391_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173337_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173334_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173332_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173331_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173328_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSTTG
KJ173327_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSTTG
KJ173324_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173321_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173317_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173315_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173312_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173311_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173310_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173303_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173302_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173301_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173296_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173295_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173294_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173293_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173292_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173289_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173288_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173287_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173286_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173285_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173284_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173283_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF214676_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF214668_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053185_MHBs_P-C      MQWNSSTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053183_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053176_MHBs_P-C      MQWNSSTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053172_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053169_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053167_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC875274_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC875272_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSTSGTVNPVPTTASPISSIFSRTG
KC875271_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC875267_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC875265_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC875264_MHBs_P-C      MQWNSSTFHQALLDPTVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC793201_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASPISSIFSKTG
KC793187_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC793119_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSKTG
KC793103_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC793051_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTLNPVPTTASPTSSIFSRTG
KC793050_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KC793039_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792965_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792962_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792961_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792941_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792923_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792921_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792911_MHBs_P-C      MQWNSTTFHQXLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792803_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792799_MHBs_P-C      XQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792792_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792790_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792776_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792771_MHBs_P-C      MQWNSXTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792759_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792739_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792713_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792708_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTG
KC792704_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792695_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792690_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792682_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792672_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792655_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774361_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774360_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
KC774359_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774354_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
KC774351_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774347_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774346_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774345_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774339_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774338_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774337_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774334_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774333_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774331_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774330_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774327_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774326_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774320_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774316_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774315_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774314_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774313_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774312_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774299_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774298_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774297_MHBs_P-C      MQWNSPTFHQAPLNPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774295_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774293_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774292_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774287_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774286_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774282_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774280_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774278_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774276_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774275_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774274_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774272_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774268_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774262_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774261_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774259_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774257_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774255_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
KC774251_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774250_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774249_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774248_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774244_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASPISSIFSRTG
KC774243_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774241_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774240_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774239_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774238_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774237_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774236_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774233_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774229_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774228_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774223_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774220_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774218_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774216_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774215_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774210_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774206_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774203_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774199_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774197_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774195_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774190_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774184_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774182_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774181_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774180_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774179_MHBs_P-C      MQWNSPTFHQAPLNPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
JX870000_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX661496_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX661495_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX661492_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX661491_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
JX661488_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX560519_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASPISSIFSKTG
JX507214_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX504546_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX504545_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX504544_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX504536_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
JX429917_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX429916_MHBs_P-C      MQWSSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX429914_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
JX429912_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX429909_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX429906_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX429905_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX429904_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX429903_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTG
JX026884_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX026880_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX026878_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801522_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801520_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801519_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801513_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801511_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801509_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801505_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801503_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
JQ801502_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801500_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801496_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801488_MHBs_P-C      MQWNSRTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801486_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801482_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801481_MHBs_P-C      MQWNSSTFHQALLDPKVRGLYFPAGGSSSETVNPVPTTASPISSIFSRTG
JQ801470_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ688404_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ688403_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341670_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341663_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341659_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ281125_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ027317_MHBs_P-C      XQWNSSTFHQALLDPRVRGLYXPAGGSSSGTVNPVPTTASPISSIFSRTG
HM011488_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF674463_MHBs_P-C      MQWNSSTFHQXLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276840_MHBs_P-C      MQWNSSTFHQXLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803780_MHBs_P-C      MQWNSTAFHPALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053187_MHBs_P-C      MQWNSTAFHPALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC793097_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISLIFSRTG
KC793074_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC793035_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341639_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ027322_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276836_MHBs_P-C      VXWNXTXFHXALLBPXVRGLYFPAGGSSSGTVNPVPTTXSPISSIFSRTG
KP148530_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148519_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC793003_MHBs_P-C      XQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPXSSIFSRTG
KC792862_MHBs_P-C      XQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSXFSRTG
JQ341668_MHBs_P-C      XQWNSSXFHQVLLDPRVRGLYFPAGGSSSGTVNPVPTTASPIXSIXSRTG
JQ341790_MHBs_P-C      XQWNSSXFHQVLLDPRVRGLYFPAGGSSSGTVNPVPTTASPIXSIXSRTG
MK321266_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX765852_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC792968_MHBs_P-C      MQWNSXTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341655_MHBs_P-C      XQWNSSTFHQXLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX276855_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTXNPVPTSASPISSIFSRTG
KX276837_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM011495_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSILSKTG
JQ341660_MHBs_P-C      XQWNSSXFHQALLDPRVRGLYVPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ341664_MHBs_P-C      MQWNSSXFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598735_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598736_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ598739_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964229_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964231_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964232_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964233_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964234_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964235_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964237_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964240_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964242_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB115417_MHBs_P-C      MQWNSTTFHQALLDPKLRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367392_MHBs_P-C      VQWNSTTFRQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU919169_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
HQ700569_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRTG
HQ700577_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRTG
EU919168_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
EU939644_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ358158_MHBs_C-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRSG
GQ358157_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRIG
GQ372968_MHBs_P-C      MQRNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
FJ899773_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPILSIFSRTG
HQ700578_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB176642_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ899770_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089796_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014362_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGPSSGTVNPVPTTASPISSIFSRTG
AB493839_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTIASPISSIFSWTG
AB493844_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
JN604222_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700576_MHBs_P-C      MQWNSTTFHQALLDPXVXGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700566_MHBs_P-C      MQWNSTTFHQALLDPRVRXLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700563_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700574_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700572_MHBs_P-C      MQWNSTTFHQALLDPRVRGLXFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700567_MHBs_P-C      MQWNSTTFHQALLDPRVMGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700559_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700561_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700502_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700504_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700545_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700573_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700565_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700562_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYYPXGGSSSGTVNPVPTTASPISSIFSRTG
HQ700564_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ032340_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ032341_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386632_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939649_MHBs_P-C      MQWNSITFHQALLDPRVRGLYFPAGGSSSGIVNPVPTTASPISSIFSRTG
AB014391_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU075338_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014389_MHBs_P-C      MQWNSTTFHQALIDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF411412_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715375_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939640_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014384_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386662_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670259_MHBs_P-C      MHRISTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ141658_MHBs_P-C      MQWNSTNFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
DQ141659_MHBs_P-C      MQWNSTNFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
DQ141661_MHBs_P-C      MQWNSTNFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
FJ899761_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ899764_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
FJ899765_MHBs_P-C      VQWSSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB675674_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB675675_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB106895_MHBs_P-C      MQRNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367422_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB195942_MHBs_P-C      MQWNSTTFHQTLLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB195943_MHBs_P-C      MQWNSTTFHQTLLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB195944_MHBs_P-C      MQWNSTTFHQTLLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB697510_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGIVNPVPTTVSPISSIFSRTG
EU872000_MHBs_P-C      IQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRTG
EU872001_MHBs_P-C      IQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRTG
EU872002_MHBs_P-C      IQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRTG
EU872003_MHBs_P-C      IQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRTG
EU872004_MHBs_P-C      IQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRTG
AB670298_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367435_MHBs_P-C      TQWNSTTFHQALLDPRVRGL--PAGGSSSGTVNPVPTTASPISSIFSRTG
AB112471_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787467_MHBs_P-C      MQWNSTTFHQALLDPIVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
FJ787464_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
FJ787465_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
FJ787466_MHBs_P-C      MQWNSTTFHQALLDPIVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
D23682_MHBs_P-C        MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
D23683_MHBs_P-C        MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
FJ715405_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTTASPISSIFSRTG
FJ715406_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTTASPISSIFSRTG
FJ562315_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
AY206389_MHBs_P-C      SGRHSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
DQ377163_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
EU306727_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
AB670307_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPTSSIFSRTG
FJ899789_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
DQ089786_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPSTASPISSIFARTG
AB697490_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367410_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
AB367401_MHBs_P-C      TQWNSTTFHKAMLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367396_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSTFSRIG
AB367424_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSTFSRIG
AB367416_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTANPVPTTASPISSTFSRIG
AB367803_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTANPVPTTASPISSTFSRIG
FJ386625_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFARTG
DQ089790_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPITASPISSIFSRTG
AB670264_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
AB368297_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVHPVPTTASPISSIFSRTG
AB367423_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014382_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPILSIFSRTG
AB014363_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASHISSIFSRTG
JF828928_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JF828921_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JF828922_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB670260_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB026815_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475347_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSTSGTVNPVPTTASPISSIFSRTG
GQ475355_MHBs_P-C      MQWNSTTFHQXXXDSRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JF828929_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JF828924_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JF828925_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JF828926_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JF828930_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JF828923_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EF536065_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EF536066_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASPISPIFSRTG
GQ377559_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
FJ715355_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
FJ562228_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386671_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
EU939561_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPVGGSSSGTVNPVPTTASPISSIFSRTG
EU939542_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRTG
EU916219_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
EU872008_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089785_MHBs_P-C      VRWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY641561_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
AY167099_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB247916_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB198081_MHBs_P-C      MQWNSTTFHQALVDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB105174_MHBs_P-C      IQWNSTTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU916223_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
EU916224_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
EU916222_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRAG
AB117758_MHBs_P-C      MLWNSATFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB205125_MHBs_P-C      TQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB026811_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB026812_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB026813_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB026814_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB074755_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB074756_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB105173_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB299858_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB300363_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB426467_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF223954_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF223956_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF223957_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF223958_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF223959_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF223960_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYVPAGGSSSGTVNPVPTTASPISSIFSRTG
AF223961_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF473543_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AP011097_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY862869_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089764_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089769_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089771_MHBs_P-C      IQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU305540_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTTSPISSIFSRTG
DQ089779_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ089770_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPXTASPISSIFSRXG
DQ089778_MHBs_P-C      MQWNSNTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASPISSIFSRTG
AB198082_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFLRTG
FJ715358_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
FJ715357_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
EU939617_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386652_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
FJ562284_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB642099_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRTG
AB111118_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB050018_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014383_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014381_MHBs_P-C      MQWNSTTFHQALLHPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014371_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTANPVPTTASPISSIFSRTG
AB670301_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB198077_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB198078_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB198079_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB246345_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB288026_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNPVPTTASPISSIFSRTG
AB298720_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB298721_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB300359_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB300365_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367407_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASPISSIFSRTG
AB471848_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB471849_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB471850_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB642100_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB198083_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
FJ032333_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
FJ386624_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
FJ386665_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
AB300361_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVHPVPTTASPISSIFSRTG
GQ377538_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSFGTVHPVPTTASPISSIFSRTG
FJ899788_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
EU939615_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
FJ386678_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
AB033552_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRTG
AB033556_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRTG
AB033551_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRTG
FJ899767_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRTG
FJ715397_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562250_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
FJ562221_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386689_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939647_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRIG
EU939596_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTANPVPTIASPISSIFSRTG
EU939548_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670306_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014378_MHBs_P-C      IQWNSTTFHQALLDPKVRGLYLPAGGSSSGTENPVPTTASPISSIFSRTG
LC279253_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475351_MHBs_P-C      MQWNSTTFHQALLDPKVKGLYFPAGGSSSGTVHPVPTTALPISSIFSRTG
GQ377540_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715422_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFARTG
FJ715392_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFARTG
FJ386664_MHBs_P-C      MQWNSTNFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
FJ386620_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU579442_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ683578_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ536412_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVRTTASPISSIFSRTG
DQ536410_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB195945_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB182589_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787457_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787458_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475316_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475327_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475334_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB205124_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY057947_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY206392_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562233_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562265_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377575_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377578_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475318_MHBs_P-C      MQWNSPTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB042282_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB042283_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB033553_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB202071_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670252_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014376_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB642095_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB900115_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB300368_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386613_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386672_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939593_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040161_MHBs_P-C      XQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670238_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367403_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670256_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562319_MHBs_P-C      MQWNSKTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ899775_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939540_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ899763_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ227696_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939572_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB642097_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014374_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014377_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB195947_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB222714_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB222715_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB300362_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB362932_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB365451_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTALPISSIFSRTG
AB367399_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB471851_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB471852_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB471853_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB485808_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB640730_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB014394_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367432_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367804_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377618_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFARTG
GQ377616_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377598_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377563_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377553_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPVGGSSSGTVNPVPTTASPISSIFSRTG
GQ377518_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377517_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ227697_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ227695_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ227694_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ227693_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ227692_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715370_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715368_MHBs_P-C      MQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715367_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715366_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715365_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715364_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715350_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715343_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715342_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562318_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562243_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386589_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386576_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386575_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939656_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939655_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939597_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939536_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU562218_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU560440_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU554536_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670297_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTG
FJ032331_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB198076_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562301_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939612_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670291_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM750139_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377585_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377570_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377562_MHBs_P-C      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377554_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377545_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377541_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715395_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562225_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939552_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670287_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670242_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670247_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF182802_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939659_MHBs_P-C      VQWTSTTFHQTLLDPRVRGLYLPAGGSSSGTVNPVPTTASPTSSIFSRTG
FJ787470_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSMTG
FJ787471_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715415_MHBs_P-C      VQWNSTTFHKALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715416_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939651_MHBs_P-C      MQWNTTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB300360_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
EU093900_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670278_MHBs_P-C      VQWNSTTFLQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB195937_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB195938_MHBs_P-C      VQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU579443_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
AB367395_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTANPVPTTASPISSTFSRIG
FJ386647_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYXPAGGSSSGTANPVPTTASPTSSIFSRIG
AB367398_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPITASPISSIFSRTG
AB111122_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTINPVPTTASPISSIFSRTG
FJ562230_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU916233_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY306136_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFPRTG
EU916234_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTAASPISSIFSRTG
FJ386595_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670292_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670300_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670265_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367402_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670288_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
D50517_MHBs_P-C        MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
D50518_MHBs_P-C        MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
D50520_MHBs_P-C        MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367427_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY641562_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670263_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB111121_MHBs_P-C      MQWNSTTFHQALLDPRVKGLYFPAGGSSSGTINPVPTTASPISSIFSRTG
AB670310_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY641560_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475344_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475350_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475354_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY206376_MHBs_P-C      LKWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
AY206379_MHBs_P-C      LKWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
FJ386607_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY220699_MHBs_P-C      IQWNSTTFHQTLLDPRVRGLYIPAGGSSSGTVNPVPTTASPISSIFSRTG
AF182803_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU871973_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU871970_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU871969_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU871972_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
EU939607_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ899783_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562320_MHBs_P-C      MQWNSTTFHQALLDPXVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ890381_MHBs_P-C      MQWNSTTFHQTLLDPKVRGLYLPVGGSSSGTVNPVPTIASPISSIFSKTG
FJ787452_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367418_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
DQ246215_MHBs_P-C      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367417_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562279_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386612_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPTSSIFSRTG
FJ787455_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787456_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB195930_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTANPVPTTASPISSIFSRTG
AB113878_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTANPVPTTASPISSIFSRTG
FJ715344_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISPIFSRTG
AB367406_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562306_MHBs_P-C      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU871974_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715400_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715372_MHBs_P-C      MQWNSITFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPIPSIFSRTG
FJ715371_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939545_MHBs_P-C      TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
D23681_MHBs_P-C        TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB113875_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB113876_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB485810_MHBs_P-C      VRWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ475309_MHBs_P-C      IQWKSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939601_MHBs_P-C      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
GQ259588_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715398_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB670237_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU547562_MHBs_P-C      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
                              .                . .                       

AB074047_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLREI
KF214652_MHBs_P-C      DPARNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KJ410505_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341656_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341778_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792656_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
EU410079_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
EU086841_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU086840_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM011481_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089795_MHBs_P-C      DPAPNMENTISXFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU498227_MHBs_P-C      DPAPNMESTTSGLLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGA
KF873516_MHBs_P-C      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873544_MHBs_P-C      DPATNMESTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGA
KU679936_MHBs_P-C      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU679947_MHBs_P-C      DPVTNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU679957_MHBs_P-C      DPVTNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873526_MHBs_P-C      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU679937_MHBs_P-C      DPATNMENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLXFLGGA
KF873539_MHBs_P-C      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873541_MHBs_P-C      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU679960_MHBs_P-C      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGX
KF873536_MHBs_P-C      DPATNMENTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLSFLGXX
KU679951_MHBs_P-C      DPATNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGA
KF873528_MHBs_P-C      DPATNMENTTSGFLGPLLXLQAGFFLLTRILTIXQSLDSWWTSLNFLGGA
KF873529_MHBs_P-C      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873514_MHBs_P-C      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
KF873520_MHBs_P-C      DPAANMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGV
KX276992_MHBs_P-C      DPAPNMESTQLGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
KF053164_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ803757_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
D28880_MHBs_P-C        DPAPNMENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDLWWTSLNFLGGA
S75184_MHBs_P-C        DPAPNMENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDLWWTSLNFLGGA
KJ717799_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEA
KJ803790_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEA
FJ386626_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGA
KY363258_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEA
KX276980_MHBs_P-C      DPATNMESTTSGFLGLLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGV
GQ924642_MHBs_P-C      DPAPNMESTASGLLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGA
KF053168_MHBs_P-C      DSAPNMESTTSGFLRPLLGLQEGFFSLTRILTIPQSLGSWWTSLNFLGGA
KJ803760_MHBs_P-C      DSAPNMESTTSGFLRPLLGLQEGFFSLTRILTIPQSLGSWWTSLNFLGGA
DQ478901_MHBs_P-C      DPAPNMESTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG571345_MHBs_P-C      DPAPNMESATSGFLGPLLVLQAGFFLLTRILKIPQNLDSWWTSLNFLGGA
KX276991_MHBs_P-C      DPAPNMGNTTSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX276841_MHBs_P-C      DPAPNMESTTSGFLGPLLAFQAGFFXLTRILTIPKSLDSWWTSLSFLGGA
HQ700575_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLSFLGEA
HQ700570_MHBs_P-C      DPAPNMENTASGHLGPLLGLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
EU306672_MHBs_P-C      DPAPNMESTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
DQ089797_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF458665_MHBs_P-C      DPAPNMENTTTGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGA
AB367434_MHBs_P-C      DSVPNMENTASGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB049610_MHBs_P-C      DPASNMESTTSGFLGPLLVLQAGFFLSTRILTIPQSLDSWWTSLSFLGGA
KR014137_MHBs_P-C      DPASNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
FJ562292_MHBs_P-C      DPAPNMENTTSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU093896_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014360_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
X75665_MHBs_P-C        DPVTNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KY363278_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY363279_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276993_MHBs_P-C      DPAPNMESTTLGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX026877_MHBs_P-C      DPAPNMENTTSGFLGPRLVLQAGFFSLTRILTIPQSLDSWLTSLNFLGEA
HQ700490_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGEA
FJ562299_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871975_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGA
EU871977_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGA
EU093902_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGA
DQ377164_MHBs_P-C      DPAPNMESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
DQ089758_MHBs_P-C      DPAPKMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY206381_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
AB900109_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
AB713890_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB042285_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014372_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFSLLTKILTIPQSLBSWWTSLNFLGGA
JN370955_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGA
JN604226_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ924620_MHBs_C-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGA
AB241110_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB241111_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AP011099_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AP011100_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AP011101_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
EU410080_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
EU410081_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ924622_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JQ281126_MHBs_P-C      DPAPNMESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM011468_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILXIPQSLDSWWTSLNFLGGA
FJ715360_MHBs_P-C      DPAPNMESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
FJ715359_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLGSWWTSLNFLGGA
FJ386611_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FJ032356_MHBs_P-C      DPALNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGA
FJ032355_MHBs_P-C      DPALNMENTTSGFLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939625_MHBs_P-C      DPVPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939546_MHBs_P-C      DPAPNMENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306671_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
DQ089804_MHBs_P-C      DPAPNMESTTSGFLXPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089802_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AY596107_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB900113_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLSFLGGA
AB670272_MHBs_P-C      DPAQNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB670258_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB246346_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014385_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871980_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
EU871998_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
EU570073_MHBs_P-C      DPATNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGA
EU570074_MHBs_P-C      DPATNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGA
AF241410_MHBs_P-C      DPVPKMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF241411_MHBs_P-C      DPVPKMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC793046_MHBs_P-C      DPAPTMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
FJ899774_MHBs_P-C      DPAPNMESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
FJ562334_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562241_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ032351_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939588_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU522071_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTLPQSLDSWWTSLNFLGEA
EU522068_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU075315_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089763_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY641559_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014369_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGEA
AB670239_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670240_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306726_MHBs_P-C      DPAPNMESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
EU306728_MHBs_P-C      DPAPNMESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
EU306722_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HQ700456_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700475_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
KJ598724_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KU964239_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
JF436920_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HQ700571_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700496_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
GQ377557_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715352_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715353_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562340_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
FJ386653_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386631_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
FJ386602_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGLFSLTRILTIPQSLDSWWTSLNFLGGA
FJ032336_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939603_MHBs_P-C      DPAPNMESTTSGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
EU939550_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871971_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGA
DQ478900_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTGILTIPQSLDSWWTSLNFLGGA
DQ478899_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ377165_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ377162_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089803_MHBs_P-C      DPAPNMESTTSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089791_MHBs_P-C      DPAPKMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY206384_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF182804_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGA
AB670253_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFLLTRILTILKNLDSWWTSLSFLGGA
AB367420_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEV
AB195936_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB112065_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014365_MHBs_P-C      DPAPNMETTTSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGA
JQ341634_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
X52939_MHBs_P-C        DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGT
EU093895_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU093898_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU881996_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ518813_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670277_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014379_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014392_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGA
MG826136_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KY881976_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276985_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ924643_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
GQ358153_MHBs_P-C      DPAPNMESTTSGFLGPLVVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGV
FJ899778_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787462_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787441_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715389_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562339_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562335_MHBs_P-C      DPAPNMENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562325_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386661_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFSLLTRILTIPQSLDSWWTSLNFLGGA
EU939657_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939579_MHBs_P-C      DPAPNMESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
EU939571_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939539_MHBs_P-C      DPAPNMENTTSGFLGPLLGLQAGFFLLTRILTILQSLDSWWTSLNFLGGA
EU916237_MHBs_P-C      DPAPNMENTASGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU796069_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU717215_MHBs_P-C      DPAPNMENTTSGFLGLLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGA
EU670263_MHBs_P-C      DPALNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
EU589336_MHBs_P-C      DPVPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU570067_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU560439_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGA
EU306721_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLNFLGGA
EF137802_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ370439_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ141667_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGA
DQ089775_MHBs_P-C      DPAPNMESTTSGFLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089761_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY066028_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB971715_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB931170_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670295_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AB670279_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367431_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB205123_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAEFFLLTRILTIPQSLDSWWTSLNFLGGA
AB112472_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB112348_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB112066_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB111123_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGA
AB042284_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB014396_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014393_MHBs_P-C      DLAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014380_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRIRTIPQSLDSWWTSLNFLGGV
AF461357_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF461363_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367404_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386579_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB031262_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGA
AB111946_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB112063_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386657_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
GQ377583_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089801_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU554540_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB111124_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB111125_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB246344_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826140_MHBs_P-C      DPAPNMESTTSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
MG571359_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEA
KY881891_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KX765855_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803826_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGA
KJ717844_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGA
JQ801491_MHBs_P-C      DPAPNMESTTSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
JN604135_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGA
JN604133_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
GQ475353_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377609_MHBs_P-C      DPAPNMEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377608_MHBs_P-C      DLAPNMENTTSGLLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGA
GQ377546_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ899772_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787453_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787454_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715377_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562333_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGA
FJ562310_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562295_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562261_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562256_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386623_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386603_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939619_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939609_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939594_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939592_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGT
EU796070_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU796072_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU562215_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU560438_MHBs_P-C      DPAPNMENAASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVT
AY206386_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY167090_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB971714_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367411_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367412_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367397_MHBs_P-C      DPAQNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195953_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195954_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB111114_MHBs_P-C      DPAPNMENTTSGFLGPLLGLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
AB014367_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089776_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXA
DQ089777_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVA
MH818373_MHBs_P-C      DPAPNMESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
MG826139_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLSFLGGA
KY470911_MHBs_P-C      DPAPNMENTTSGFLRPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGA
KX276846_MHBs_P-C      DPAPNMESTTSGXLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLSFLGEA
KJ598734_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ410515_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEA
KC792995_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KC792740_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JX125372_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGEV
JN827414_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GU721029_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ924616_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGA
GQ855376_MHBs_P-C      DPAPNMESTTSGFLRPLHVLQEGFFSLTRILTIPQSLDSWWTSLNFLEGA
GQ377620_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377555_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377529_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787468_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGA
FJ562276_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562264_MHBs_P-C      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ032350_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023645_MHBs_P-C      DPAPNMESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023639_MHBs_P-C      DPAPNMESTTSGFLGPLLVLXEGFFXLTRILTIPQSLDSWWTSLNFLGGA
EU939564_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939544_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU562217_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306725_MHBs_P-C      DPAPNMESTTSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ141657_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
DQ089787_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGA
DQ089773_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
DQ089772_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089766_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089760_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF533983_MHBs_P-C      GPAPNMESTTSGFLGPLLVLQAGFFLLTRILTVPQSLDSRWTSLNFLGGA
AB900099_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGV
AB697494_MHBs_P-C      DLAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367394_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB300372_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB198080_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195949_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195932_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB111119_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014399_MHBs_P-C      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598730_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KU964230_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
AF384371_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU560441_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787486_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ899776_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377571_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377599_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGA
GQ377615_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475349_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475345_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475341_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377623_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377597_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562298_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562269_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562266_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
FJ562248_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939613_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939573_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939568_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTITQSLDSWWTSLNFLGGA
EU554535_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU086837_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670289_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRXLTIPQSLDSWWTSLNFLGGA
DQ922650_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964358_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964349_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964363_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964182_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964174_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964176_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964178_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964179_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964181_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964183_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964184_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ027324_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGEX
JQ341649_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGX
MG826137_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGA
KY882003_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY470908_MHBs_P-C      DPAPNMENTTSGFLRPLLVLQAGFSSLTKILTIPQSLDSWWTSLNFLGGA
KR013871_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598733_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ598715_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598686_MHBs_P-C      DPAPNMENTTSGFLEPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598679_MHBs_P-C      DPAPNMENTTSGFLEPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF485389_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792902_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGA
KC792853_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFSLTRILTIPQRLDSWWTSLNFLGEA
KC774290_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341652_MHBs_P-C      DPAPKMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
JQ040132_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
JF828937_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HQ700506_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGA
HQ700457_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
GU357845_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ924655_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475328_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377631_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377533_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ184326_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787479_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787450_MHBs_P-C      DPAPNMETTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787448_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787445_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787443_MHBs_P-C      DPAPNMENTTSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787442_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787437_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715421_MHBs_P-C      DPAPNMESTTSGFLGPLLMLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715418_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715390_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715381_MHBs_P-C      DPAPNMESTTSGFLGPLLMLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715379_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715351_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715341_MHBs_P-C      DSAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGA
FJ562332_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562300_MHBs_P-C      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562288_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562280_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562273_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562249_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562238_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562235_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
FJ386673_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386628_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386627_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386604_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386601_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386597_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386592_MHBs_P-C      DPAPNMESTTSGFLXPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGA
FJ386577_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ032361_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ032346_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ032339_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ032338_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939626_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939616_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939614_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939595_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939587_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939538_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU916238_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871976_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306720_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306719_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306714_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306713_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU093911_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU093908_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
EU086842_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU082432_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EF137803_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ993692_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ993691_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ980547_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ975273_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ478885_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ377161_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ370438_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ141662_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ141660_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
DQ089792_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089765_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
DQ089762_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089757_MHBs_P-C      DPAPKMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY582136_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY206382_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AP011107_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AP011106_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AJ748098_MHBs_P-C      DPAPNMESTSSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF411411_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF411408_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF223955_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB931171_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB713885_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670281_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670251_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195952_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195948_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGA
AB113879_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB033550_MHBs_P-C      DPAQNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB014364_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475325_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881999_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881974_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881881_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881878_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY470873_MHBs_P-C      DPAPNMESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX774504_MHBs_P-C      DPAPNMESTTSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276984_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276963_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTISQSLDSWWTSLNFLGEA
KU964064_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR014083_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR014011_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013875_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFPGGA
KR013767_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KJ803766_MHBs_P-C      DPAPNMESITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598665_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KF779327_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
KF053173_MHBs_P-C      DPAPNMESITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792857_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEV
KC792818_MHBs_P-C      DPAPNMENTTSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
KC792746_MHBs_P-C      DPAPNMENTTSGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
KC774265_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774205_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JX429913_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGA
JQ801472_MHBs_P-C      DPALNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JQ341632_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGA
JQ341612_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ027318_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLSFLGGA
JN827415_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HQ700558_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700556_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700555_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSXWTSLNFLGEA
HQ700544_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700543_MHBs_P-C      DPALNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700529_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700522_MHBs_P-C      DPALNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700516_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700495_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HM750137_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM011493_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ924636_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ924629_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475331_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475322_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377628_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGA
GQ377619_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377601_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377543_MHBs_P-C      DPAPNMENTTXGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ899771_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ899769_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGA
FJ787449_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715404_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715391_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715376_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386679_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386605_MHBs_P-C      DPALNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ032334_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023656_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023646_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023644_MHBs_P-C      DPAPKMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023643_MHBs_P-C      DPAPKMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939653_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939642_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939586_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEV
EU939566_MHBs_P-C      DPAPNMESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU570072_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306690_MHBs_P-C      DPAPNMESATSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU305541_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLGSWWTSLNFLGGA
EU093917_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU093915_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU093910_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU093883_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU086845_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EF688062_MHBs_P-C      DPAPNMESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ141665_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089788_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089768_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
D12980_MHBs_P-C        DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
D10055_MHBs_P-C        DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY641563_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF363961_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB697502_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLXTRILTIPQSLDSWWTSLNFLGGA
AB670274_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670273_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670270_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195931_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB111120_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826132_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGP
MF925403_MHBs_P-C      DPAPNMESTTSGFLRHLPVLRAGFFWLTRILTIPQSLDSWWTSLNFLGGA
MF674417_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTTPQSLDSWWTSLNFLGGA
KY881886_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881874_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881870_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSPDSWWTSLNFLGGA
KU964243_MHBs_P-C      DPAPNMENTTSGFLQPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964241_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KU964238_MHBs_P-C      DPAPNMENTTSGFLQPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964236_MHBs_P-C      DPAPNMENTTSGFLQPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964220_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803823_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ803777_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGA
KJ803774_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803762_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGA
KJ717839_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ598738_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ598737_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ598732_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ598731_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ598729_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ598728_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ598727_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ598726_MHBs_P-C      DPAPNMENTTSGFLQPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598725_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ598723_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ598722_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ598721_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ598720_MHBs_P-C      DPAPNMENTTSGFLQPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF214673_MHBs_P-C      DPAPNMENTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGA
KF053184_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGA
KF053181_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF053170_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGA
KC792831_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774353_MHBs_P-C      DPAPNMENTASGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KC774319_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774207_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX125366_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX036326_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341620_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ040144_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ027321_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JN604140_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN315779_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700517_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM011486_MHBs_P-C      DPAPKMEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXA
GQ872211_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377536_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377530_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQXGFXLLTRILTIPQSLDSWWTSLNFLGGA
GQ377524_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787469_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562337_MHBs_P-C      DPAPNMESTTSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386651_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386618_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGA
FJ386614_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ032345_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023648_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU554542_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU554541_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU439015_MHBs_P-C      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EF384206_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089783_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089767_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
AF384372_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670249_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGA
MG826138_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MF674390_MHBs_P-C      DPAPNLHSTTSGFLDPQLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF488701_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY882001_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881890_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881815_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
KY470879_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY363260_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KX276959_MHBs_P-C      DPAPSMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT284758_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR014015_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR014010_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013853_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLSIRILTIPQSLDSWWTSLNFLGGA
KR013848_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013770_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSQDSWWTSLNFLGGA
KR013769_MHBs_P-C      DPVPNMENTTSGFLGPLLVLQAGFFSLTKIPTIPQSLDSWWTSLNFLGGA
KJ803809_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ717821_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF779242_MHBs_P-C      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF214671_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGA
KF214670_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX504537_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341654_MHBs_P-C      DPVPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341653_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341643_MHBs_P-C      DPAPNMENTTLGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ281123_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQXGFFXLTRILTIPQSLDSWWTSLNFLGGA
JQ040168_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JQ040141_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ027323_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN827417_MHBs_P-C      DPAPNMESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604243_MHBs_P-C      DPAPNMESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
HQ700476_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HM750136_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM750131_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GU434374_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ924633_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475356_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475348_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475336_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475330_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475321_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475314_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475310_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475308_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475307_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475306_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377640_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377637_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377636_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377624_MHBs_P-C      DPASNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377621_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377617_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377605_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377603_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377600_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377593_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377591_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377586_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
GQ377584_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377580_MHBs_P-C      DPATNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377579_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377577_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377576_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377574_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377572_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377552_MHBs_P-C      DPAPNMEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377551_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377528_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377527_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377526_MHBs_P-C      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377523_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377521_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377515_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377514_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ899777_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787447_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787439_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715409_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715407_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715403_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715402_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715383_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715382_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715380_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715378_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715374_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562330_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562329_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562327_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562324_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562323_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562313_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGA
FJ562308_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562304_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562293_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
FJ562291_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562285_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562283_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562282_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562281_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562275_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562274_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562272_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562268_MHBs_P-C      DXAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562258_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562255_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFSLTRILTILQSLDSWWTSLNFLGGA
FJ562252_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562251_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562244_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562242_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
FJ562239_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562232_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562218_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386685_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386670_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSXWTSLNFLGGA
FJ386659_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386644_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386639_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386637_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386630_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386619_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386609_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386598_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386591_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386588_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386587_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386574_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ032359_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939654_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939652_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939648_MHBs_P-C      DPALNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939618_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939611_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939610_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939605_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939604_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939600_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939591_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939590_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939585_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939582_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939570_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939567_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939562_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939554_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939543_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939541_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU916225_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU916210_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU872012_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU872010_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871982_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871979_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871978_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQTGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU717212_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU570068_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU554539_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU554538_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU554537_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306675_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306674_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306673_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU093918_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU093916_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU093914_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU093913_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU093912_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU093909_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU093907_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU093903_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU086847_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU086846_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU086844_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU086843_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU086839_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU082435_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU082431_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU082430_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU082429_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU082428_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU075342_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU075336_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU075335_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU075334_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EF494379_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EF384200_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ993693_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ986375_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ975272_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ922651_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ922649_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ141656_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089799_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089793_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
D23684_MHBs_P-C        DPAPNMETTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
D00630_MHBs_P-C        DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY641558_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY596108_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY247032_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY247031_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY167096_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY167091_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AP011098_MHBs_P-C      DPAQNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF461359_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF461358_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF458664_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF068756_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB900116_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB675677_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670311_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670302_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670285_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670282_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670276_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670275_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670269_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670267_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670261_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826143_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826128_MHBs_P-C      DPAPDMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MF925409_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILSIPQSLDSWWTSLNFLGGA
LC279256_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
LC279252_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGEA
KY881996_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881995_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881993_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881992_MHBs_P-C      DPAPNMESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881991_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881988_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881986_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881983_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881982_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881981_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881980_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881977_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881973_MHBs_P-C      DPAPNMENTTSGFLGPLLTLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881970_MHBs_P-C      DPAPNVESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881969_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881968_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881965_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881963_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881961_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881959_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRIPTIPQSLDSWWTSLNFLGGA
KY881938_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881936_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881935_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881934_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881933_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881932_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881931_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881930_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881929_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881928_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881927_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881926_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881925_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881924_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881923_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881921_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881919_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881917_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881916_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881892_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881887_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881885_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881880_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881877_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881876_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881872_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881871_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY629637_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470987_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDPWWTSLNFLGGA
KY470973_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470906_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470888_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470886_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470880_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY363287_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGA
KY363286_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGA
KY363252_MHBs_P-C      DPASNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276838_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
KU964222_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964218_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964213_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
KU964212_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
KU964211_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
KU964210_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
KU964209_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
KU964208_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
KU964207_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
KU964206_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
KU964204_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
KU964201_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
KU963911_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU051424_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT364751_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT284755_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR819180_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR014082_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR014078_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTISQSLDSWWTSLNFLGGA
KR014077_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013993_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013923_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013900_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013867_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KR013866_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRIPTIPQSLDSWWTSLNSLGGA
KR013846_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013817_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013799_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013777_MHBs_P-C      DPAPNTESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013771_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTTPQSLDSWWTSLNFLGGA
KJ803770_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803754_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
KJ717833_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ717791_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
KJ598717_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598710_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGA
KJ598707_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598678_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ598677_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ598676_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ598674_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ598673_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ598672_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ598671_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ598670_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598669_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ598668_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ598667_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ598666_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ598664_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ598663_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ410495_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ410494_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGEA
KJ410493_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ410491_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGEA
KJ173335_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173319_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173314_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173313_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF495606_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGA
KF053177_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF053161_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
KC793195_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGDA
KC793129_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGEA
KC793107_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGT
KC792716_MHBs_P-C      DPAPNMENTTLGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
KC792710_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792700_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KC774325_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774304_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774303_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774302_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774301_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGA
KC774281_MHBs_P-C      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774269_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGA
KC774219_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGA
KC774204_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX560520_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX504535_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGA
JX504534_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ429078_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341630_MHBs_P-C      DPAPXMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341628_MHBs_P-C      DPAPNMESTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604281_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604246_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604215_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604148_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604131_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828920_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828919_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828918_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828917_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828916_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828915_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828913_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM011491_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM011489_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM011472_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM011465_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GU563561_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ924650_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ924649_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ924615_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ924614_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ924613_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ924612_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ924609_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ924604_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ872210_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ855393_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475346_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475342_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475339_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475338_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475337_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475332_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475329_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475324_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475323_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475320_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475319_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475317_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475315_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475313_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475312_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475311_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475305_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377642_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377632_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ358154_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562307_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386687_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386596_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ349225_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023658_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023657_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023654_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023653_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023650_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023649_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023647_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023642_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023641_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939578_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939563_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU882005_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306694_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306691_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306689_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLNFLGGA
EU306688_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306687_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306685_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU305542_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ141668_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ141664_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSGWTSLNFLGGT
DQ141663_MHBs_P-C      DPAPNMESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089789_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089784_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089782_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089781_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
D50519_MHBs_P-C        DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF286594_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB697500_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670305_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670290_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670283_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670266_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670262_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367414_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ040139_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826129_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MG571335_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674489_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279255_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KY881997_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881994_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881990_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881979_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881971_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881966_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881962_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881915_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881889_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881888_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRVLTIPQSLDSWWTSLNFLGGA
KY881883_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881882_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY470925_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470905_MHBs_P-C      DPAPNMESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY363274_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGA
KY363268_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276853_MHBs_P-C      DPAPKMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276852_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAXFSLLTRILTIPQSLDSWWTSLNFLGGA
KU964228_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964227_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964226_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964225_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964224_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964223_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964217_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964216_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964215_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964214_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964032_MHBs_P-C      DPAPNMENTTSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963920_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013852_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013823_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013820_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013809_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013778_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013766_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KR013764_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSRWTSLNFLGGA
KR013763_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KP148524_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQARFFLLTRILTIPQSLDSWWTSLNSLGGA
KP148521_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQARFFLLTRILTIPQSLDSWWTSLNSLGGA
KP148512_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILAIPQSLDSWWTPLNFLGGA
KM359441_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803812_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEA
KJ803794_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQEGFFLLTRILTILQSLDSWWTSLNFLGGA
KJ803769_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ717825_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEA
KJ717804_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQEGFFLLTRILTILQSLDSWWTSLNFLGGA
KJ598660_MHBs_P-C      DPAPNMENTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598642_MHBs_P-C      DPAPNMENTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598641_MHBs_P-C      DPAPNMENTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ410521_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KF779300_MHBs_P-C      DPAPNMENMTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF485390_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF053175_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC875262_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792926_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792706_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774358_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGA
KC774296_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQRLDSWWTSLNFLGGA
KC774277_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774254_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774211_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774189_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JX507212_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
JX125375_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX125374_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX125373_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX125370_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801493_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JQ341651_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341650_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ040131_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN827423_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN827418_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604121_MHBs_P-C      DPAPNMESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM011500_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475357_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670243_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
X04615_MHBs_P-C        DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG571332_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
MF674408_MHBs_P-C      DPAPNMESTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881998_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881964_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881817_MHBs_P-C      DPAQNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470920_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470885_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY363283_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY363282_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY363281_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLARILTIPQSLDSWWTSLNFLGGA
KY363253_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765821_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276981_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276844_MHBs_P-C      DPAPNMESTASGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276839_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KU964348_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964347_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964346_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964345_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964344_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964343_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964342_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964340_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964339_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964338_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964337_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964336_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964334_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964200_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964171_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964078_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964077_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964075_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964074_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964073_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964072_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964071_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964070_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964069_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964068_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964067_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964066_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964065_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR014012_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013927_MHBs_P-C      DPAPNMESTTSGFLKPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013902_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
KR013882_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013877_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KR013876_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KR013874_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSFNFLGGA
KR013872_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KR013859_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWRTSLNFLGGA
KR013842_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013839_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013801_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013772_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803818_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803810_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ717834_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ717822_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ598743_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598716_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598662_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KJ410511_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ410499_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGEA
KJ173305_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF214655_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC793202_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC793142_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC793108_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGA
KC792775_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGEA
KC774335_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX504541_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
JX504539_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
JX125371_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801521_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801515_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JQ341658_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341648_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341641_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341636_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341616_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341615_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341613_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ281128_MHBs_P-C      DPVPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ281122_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ281114_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ040172_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ040166_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
JQ040165_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ040163_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ040162_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ040155_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGA
JQ040151_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
JN827420_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604258_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604254_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604231_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGA
JN604153_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604151_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN400089_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN400088_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN400087_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF899336_MHBs_P-C      VPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HQ622095_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM750141_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM750140_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM750138_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM750135_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM750134_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM750132_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089780_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670241_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MH891502_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826135_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MG826134_MHBs_P-C      DPATNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MG826133_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MG826131_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MG826127_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826126_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826124_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826123_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG725248_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925398_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925376_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925374_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925359_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674504_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674471_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674467_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674458_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674430_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
MF674425_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674399_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC373511_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279275_MHBs_P-C      DPAPNMENTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279257_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
LC279254_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KY882000_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881989_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881987_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881985_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881984_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881978_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881975_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGA
KY881967_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881960_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881943_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881942_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881941_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881940_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881939_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881937_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881922_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881920_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881918_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881884_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881879_MHBs_P-C      DPAPNMENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881875_MHBs_P-C      DPAPNTENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KY881812_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTPLNFLGGA
KY881802_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSPDSWWTSLNFLGGA
KY670782_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY629631_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470991_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470990_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470988_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470986_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470985_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470984_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470983_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470982_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470981_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470980_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470979_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470978_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470977_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470976_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470975_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470974_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470972_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470971_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470970_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470969_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470968_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470967_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470966_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470965_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470933_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470930_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDPWWTSLNFLGGA
KY470918_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KY470917_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470914_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470913_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470910_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KY470909_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470907_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470897_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470892_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470889_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470884_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470883_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470881_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470878_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470876_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765851_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765831_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765823_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276979_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276851_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964333_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964332_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964331_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964330_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964329_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964328_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964327_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964326_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964325_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964324_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964323_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964322_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964321_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964320_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964319_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964318_MHBs_P-C      DPAPSMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964205_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964203_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964202_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964177_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964172_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964170_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964169_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGA
KU964043_MHBs_P-C      EPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964033_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964031_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964030_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964029_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964028_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964027_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964026_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964025_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964024_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964023_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964022_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964021_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964020_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964014_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964012_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964002_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963914_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963913_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963912_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963910_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963909_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963908_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963907_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963906_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963905_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963904_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963903_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963902_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963901_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963900_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963880_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963878_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT987425_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT366463_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT364752_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR014048_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR014021_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013909_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLARILTIPQSLDSWWTSLNFLGGA
KR013905_MHBs_P-C      DPAPNMESTTSEFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013890_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
KR013870_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013862_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KR013854_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLWTRILTIPQSLDSWWTSLNFLGGA
KR013841_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013840_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013833_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013829_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQARFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013827_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013825_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLDFLGGA
KR013819_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013812_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013804_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLDFLGGA
KR013802_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013800_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013791_MHBs_P-C      DPAPNMENTISGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KR013782_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013776_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013774_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013773_MHBs_P-C      DPAPNTENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013768_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KR013765_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KR013762_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTISQSLDSWWTSLNFLGGA
KR013761_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KP148575_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148564_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148563_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148561_MHBs_P-C      DPAPNMESTTSGFLGPLLVLRAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148545_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148514_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148513_MHBs_P-C      GPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148469_MHBs_P-C      DPVPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148465_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803800_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ717812_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ717809_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598753_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598752_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598751_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598749_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598746_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598740_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598719_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598718_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598714_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598713_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598712_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598711_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598709_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598708_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598706_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598705_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598703_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598687_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KJ598681_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598680_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598646_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ410518_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ410492_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGEA
KJ410489_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173396_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173395_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173333_MHBs_P-C      DPAQNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173323_MHBs_P-C      DPAPNMESTTSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173316_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173309_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
KJ173282_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173281_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF214675_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF214667_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF053193_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC875273_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC875270_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC875269_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC875263_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTGILTIPQSLDSWWTSLNFLGGA
KC793123_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC793100_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGDA
KC793024_MHBs_P-C      DPAPNMENTTSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGA
KC793019_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792873_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGGA
KC792793_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGA
KC792691_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KC792658_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774357_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774356_MHBs_P-C      DPAPSMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774355_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774352_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774348_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774343_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774342_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774340_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774336_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774318_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774311_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774310_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774309_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774308_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774306_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGA
KC774285_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774283_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KC774271_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774270_MHBs_P-C      DPASNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774266_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774264_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774253_MHBs_P-C      DPAPNMETTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774252_MHBs_P-C      GPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774247_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774245_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774242_MHBs_P-C      DPAPNMETTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774235_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774232_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774231_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774227_MHBs_P-C      DPAQNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774226_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774225_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774224_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774221_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774217_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774209_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774208_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774202_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KC774200_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KC774196_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774194_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774192_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774187_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774185_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC315399_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX661497_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGI
JX661490_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX661489_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX507211_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
JX429907_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX125365_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX026888_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801523_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801518_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
JQ801501_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JQ801497_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801475_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801473_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ412089_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341626_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341621_MHBs_P-C      DPAPNMESTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGX
JQ341610_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWXTSLNFLGGA
JQ281127_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ040149_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ027320_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN827422_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604232_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVX
HM011479_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILIIPQSLDSWWTSLNFLGGV
KT366464_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826122_MHBs_P-C      DPAPNMESTASGFLGPLFVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
MF674514_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674486_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674435_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279274_MHBs_P-C      DPAPNMENTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279251_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279250_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470929_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470902_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470901_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470894_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470875_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY363275_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY363264_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765849_MHBs_P-C      DPAQNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276854_MHBs_P-C      DPAPNMESTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
KX276848_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964341_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
KU963929_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963928_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963927_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963926_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963925_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963924_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963923_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963922_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963921_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963919_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963918_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963917_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963916_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963915_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963873_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963872_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT987423_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT284757_MHBs_P-C      DPAPNMENTTSGFPGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013858_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013851_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013850_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013836_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013832_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013826_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013822_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP784761_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148559_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148535_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148477_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148476_MHBs_P-C      DPAPNMESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148474_MHBs_P-C      DPAPNMESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148473_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148472_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598693_MHBs_P-C      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598659_MHBs_P-C      DPAPNMENTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ410510_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173306_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC875261_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTVPQSLDSWWTSLNFLGGA
KC793110_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792940_MHBs_P-C      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792880_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXA
KC792679_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774329_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774321_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774300_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774289_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774288_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774284_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774279_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774267_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774260_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774256_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774214_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774213_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774191_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX504542_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX429918_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX429915_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX036327_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLGSWWTSLNFLGGA
JQ801495_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341662_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341657_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341633_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341631_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341618_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341614_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ040152_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ040145_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXA
JQ027333_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN827421_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604147_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MH220971_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG893553_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925395_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925365_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674444_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQRLDSWWASLNFLGGA
MF674429_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881972_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881809_MHBs_P-C      DPAPNMENTASGFLGPLLVLQEGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470891_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470890_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470887_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470882_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY363254_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765832_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765830_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963884_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963881_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963879_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963876_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR014043_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013908_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013864_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KR013861_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KR013860_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KR013849_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013845_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGA
KR013844_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013838_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013837_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013811_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013808_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013805_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KR013796_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGA
KR013795_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGA
KR013794_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013793_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013792_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148568_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598768_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ410514_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173308_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173307_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173304_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173291_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC793040_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KC792999_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792927_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792834_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792817_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KC792762_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792680_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792669_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX661493_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801504_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801498_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801490_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341669_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXA
JQ341665_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341661_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341644_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341642_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341637_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341624_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JQ341622_MHBs_P-C      DPATNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341617_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341611_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ281124_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ281121_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ281120_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ281119_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ281118_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ281117_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ281116_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ281113_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ281112_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ040133_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN827425_MHBs_P-C      DPAPNMESTSSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN827424_MHBs_P-C      DPAPNMESTSSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN827416_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604286_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604256_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604182_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604144_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN604129_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFRGGA
JN604118_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM011497_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
V00867_MHBs_P-C        DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK818227_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MH887433_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MH094411_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG893560_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG893558_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG893557_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG893556_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826125_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925410_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925408_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925406_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925405_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925394_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925387_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925377_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925375_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925369_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925367_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674502_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674501_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674494_MHBs_P-C      DPAPNMESTTSEFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674484_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674475_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674474_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674472_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674468_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674457_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674454_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674442_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674428_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674418_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674412_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674403_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674402_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674398_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674388_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF674386_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF488703_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC373512_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC318703_MHBs_P-C      DPAPNMENTISGFPGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC318702_MHBs_P-C      DPAPNMENTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279276_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279262_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279261_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279260_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279259_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279258_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279249_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279248_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279247_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279246_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279245_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC090200_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881777_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881776_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881775_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881774_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881773_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881772_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881771_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881770_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881769_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881768_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881767_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881766_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881765_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881764_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881763_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881762_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881758_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881755_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881754_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881751_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881750_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881749_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881748_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881744_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881743_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881742_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881739_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881738_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881737_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY881736_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470937_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470936_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470934_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470927_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470926_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470916_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470915_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470912_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470904_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLARILTIPQSLDSWWTSLNFLGGA
KY470903_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470900_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470899_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470896_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470895_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470877_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470874_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY363284_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY022423_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX774506_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX774503_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765853_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765850_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765848_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765847_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765846_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765845_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765844_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765843_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765842_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765840_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765839_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765838_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765837_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765836_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765834_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQEGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765833_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765829_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765828_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765827_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765826_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765825_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765824_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765822_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765820_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765819_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765818_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276976_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276973_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276968_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGA
KX276965_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLGSWWTSLNFLGGA
KX276964_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276960_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276847_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276835_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276831_MHBs_P-C      DPAPNTENTTSGFLGPLLVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGA
KU964364_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964199_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964198_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964197_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964196_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964195_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964194_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964193_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964192_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964191_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964190_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964189_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964188_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964187_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964186_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964185_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964175_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964173_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964063_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964062_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964061_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964060_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964059_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964058_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964057_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964056_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964055_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964054_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964053_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964052_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964051_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964050_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964049_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964048_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964047_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964046_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964045_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964044_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964041_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964040_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964039_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964038_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964037_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964036_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964035_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964034_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964019_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964018_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLWGA
KU964017_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KU964016_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964015_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964013_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964011_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KU964004_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLEGA
KU963997_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963996_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963992_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963899_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963898_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963897_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963896_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963895_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963894_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963893_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963892_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963891_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963890_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963889_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963888_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963887_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963886_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963885_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963882_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963877_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963875_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963874_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963871_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU051427_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU051426_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU051425_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU051423_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT987426_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT987424_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT364721_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT364718_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT347089_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT307719_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT307718_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT284759_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT284756_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT284754_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT284753_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR014092_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KR013984_MHBs_P-C      DSAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013961_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013943_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013903_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KR013899_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013873_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013869_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KR013868_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KR013857_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013856_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013855_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013835_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013834_MHBs_P-C      DPAPNTENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013831_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013830_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013828_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013824_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013821_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013815_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013814_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013813_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGA
KR013810_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013807_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013798_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013797_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013786_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013784_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013783_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013781_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013780_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013779_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148574_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148573_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148572_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148571_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148570_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148567_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148566_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148562_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148560_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148558_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148557_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148555_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148554_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148552_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148551_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148549_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148548_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148547_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148546_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148543_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148540_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148538_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148537_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148534_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148532_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148531_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148529_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148528_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148526_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148525_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148523_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148520_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148517_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148492_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148491_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148489_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148488_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148483_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148482_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148481_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148480_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148479_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148475_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
KP148471_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148468_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148466_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGA
KP148464_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148463_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148462_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148315_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP027477_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KM875429_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KM875428_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KM875424_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KM875423_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KM875406_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KM875405_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KM875404_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KM229703_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KM213037_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803815_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803813_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803811_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803799_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803793_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803792_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803779_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803776_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803765_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803761_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803759_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ790199_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ717828_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ717826_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ717823_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ717811_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ717810_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ717803_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ717802_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ717790_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598769_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598754_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598750_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598748_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598747_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598745_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598744_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598742_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598741_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598702_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598701_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598699_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598698_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598697_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598696_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598695_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598691_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598690_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598689_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598688_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598661_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598658_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598656_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598652_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598651_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598649_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598647_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598644_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598639_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598638_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598636_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598635_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ410519_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ410513_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ410508_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ410504_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ410501_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ410496_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173446_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173444_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173443_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173442_MHBs_P-C      DPAPNMENTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173441_MHBs_P-C      DPAPNMENTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173440_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173439_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173438_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173437_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173436_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173435_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173434_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173433_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173432_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173431_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173430_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173429_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173428_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173427_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173426_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173394_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173393_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173392_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173391_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173337_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173334_MHBs_P-C      DPAQNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173332_MHBs_P-C      DPALNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173331_MHBs_P-C      DPALNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173328_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173327_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173324_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173321_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KJ173317_MHBs_P-C      DPASNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173315_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173312_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173311_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173310_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173303_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173302_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWSSLNFLGGA
KJ173301_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWSSLNFLGGA
KJ173296_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173295_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173294_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173293_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173292_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173289_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173288_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173287_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173286_MHBs_P-C      DPAQNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173285_MHBs_P-C      DPAQNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173284_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173283_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF214676_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF214668_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF053185_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF053183_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF053176_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF053172_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF053169_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF053167_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC875274_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC875272_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC875271_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC875267_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC875265_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC875264_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC793201_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC793187_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC793119_MHBs_P-C      DPAQNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC793103_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILXIPQSLDSWWTSLNFLGGX
KC793051_MHBs_P-C      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC793050_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC793039_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792965_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792962_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792961_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792941_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792923_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792921_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792911_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIXQSLDSWWTSLNFLGGA
KC792803_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792799_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGA
KC792792_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792790_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792776_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792771_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792759_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFXGVT
KC792739_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792713_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792708_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792704_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792695_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792690_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792682_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792672_MHBs_P-C      DPATNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792655_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774361_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774360_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774359_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774354_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774351_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774347_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774346_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774345_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774339_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774338_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774337_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774334_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774333_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774331_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774330_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774327_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774326_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774320_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774316_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774315_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774314_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774313_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774312_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774299_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774298_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774297_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774295_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774293_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774292_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774287_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774286_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774282_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774280_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774278_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774276_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774275_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774274_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774272_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774268_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGA
KC774262_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774261_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774259_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774257_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774255_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774251_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774250_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774249_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774248_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774244_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774243_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774241_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774240_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774239_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774238_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774237_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774236_MHBs_P-C      DLAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774233_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774229_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774228_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774223_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774220_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774218_MHBs_P-C      DPASNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774216_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774215_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774210_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774206_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774203_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774199_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774197_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774195_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774190_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774184_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774182_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774181_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774180_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774179_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX870000_MHBs_P-C      DPAPNMETTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX661496_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX661495_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX661492_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX661491_MHBs_P-C      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX661488_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX560519_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX507214_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX504546_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX504545_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX504544_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX504536_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX429917_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX429916_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX429914_MHBs_P-C      DPAQNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX429912_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX429909_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX429906_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX429905_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX429904_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX429903_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX026884_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX026880_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX026878_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801522_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801520_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801519_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801513_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801511_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801509_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801505_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801503_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801502_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801500_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801496_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801488_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801486_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801482_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801481_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801470_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ688404_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ688403_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341670_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341663_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341659_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ281125_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ027317_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM011488_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXX
MF674463_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX276840_MHBs_P-C      DPAPNMESXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803780_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF053187_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC793097_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC793074_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC793035_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341639_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ027322_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGXA
KX276836_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148530_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148519_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC793003_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792862_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFXLTXILTIPQSLDSWWTSLNFLGGA
JQ341668_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341790_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK321266_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX765852_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC792968_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341655_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGA
KX276855_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIXQRLDSWWTSLNFLGGA
KX276837_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTXILIIPQSLDSWWTSLNFLGGV
HM011495_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGA
JQ341660_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ341664_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ598735_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ598736_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KJ598739_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KU964229_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KU964231_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KU964232_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KU964233_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KU964234_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KU964235_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KU964237_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KU964240_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
KU964242_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
AB115417_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSHSFLGGT
AB367392_MHBs_P-C      DPAPNMENTTSGFLGPLLGLQAGFFLLTKILTIPQSLDLWWTSLNFLGGA
EU919169_MHBs_P-C      DPVPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700569_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700577_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILIIPQSLDSWWTSLNFLGEA
EU919168_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
EU939644_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEV
GQ358158_MHBs_C-C      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
GQ358157_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
GQ372968_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
FJ899773_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700578_MHBs_P-C      DPAPNMESTTSGYLGPLLVLQAVFFLLTRILTIPQSLDSWWTSRNFLGET
AB176642_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQXAFFLLTRILTIPQSLDSWWTSLNFLGEA
FJ899770_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGET
DQ089796_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
AB014362_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
AB493839_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
AB493844_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
JN604222_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700576_MHBs_P-C      DPALNMENTTSGFXGPLLVXQAVFFLLTRILTIPQSLDSWWTSLSFLGEA
HQ700566_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700563_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700574_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700572_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700567_MHBs_P-C      DPALNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700559_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700561_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700502_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700504_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700545_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700573_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700565_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700562_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700564_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
FJ032340_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
FJ032341_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
FJ386632_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGEA
EU939649_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEA
AB014391_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
EU075338_MHBs_P-C      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
AB014389_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
AF411412_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
FJ715375_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
EU939640_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
AB014384_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGEA
FJ386662_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
AB670259_MHBs_P-C      DLAQNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
DQ141658_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ141659_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ141661_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ899761_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWLTSLNFLGGA
FJ899764_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGA
FJ899765_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWLTSLNFLGGA
AB675674_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB675675_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB106895_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367422_MHBs_P-C      DPAPKMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195942_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195943_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195944_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB697510_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU872000_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU872001_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU872002_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU872003_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU872004_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670298_MHBs_P-C      DPAPNMESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367435_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB112471_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787467_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDLWWTSLNFLGGA
FJ787464_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787465_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787466_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGA
D23682_MHBs_P-C        DPAPNMESTTSGFLGPLLVLQAVFFSLTRIHTILQSLDSWWTSLNFLGGA
D23683_MHBs_P-C        DPAPNMESTTSGFLGPLLVLQAVFFSLTRIHTILQSLDSWWTSLNFLGGA
FJ715405_MHBs_P-C      DPAPNMESTTSGFLGPLLMLQAGFLLLTRVLTIPQSLDSWWTSLNFLGGA
FJ715406_MHBs_P-C      DPAPNMESTTSGFLGPLLMLQAGFLLLTRVLTIPQSLDSWWTSLNFLGGA
FJ562315_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY206389_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ377163_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU306727_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670307_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ899789_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
DQ089786_MHBs_P-C      DPAPNMESISSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB697490_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
AB367410_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB367401_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367396_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367424_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367416_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
AB367803_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
FJ386625_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089790_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670264_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
AB368297_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367423_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014382_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGX
AB014363_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLBSWWTSLNFLGGA
JF828928_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828921_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828922_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670260_MHBs_P-C      DHAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB026815_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ475347_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ475355_MHBs_P-C      DPAPNMESTTSGFXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JF828929_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828924_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828925_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828926_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828930_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828923_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EF536065_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EF536066_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGA
GQ377559_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715355_MHBs_P-C      DPAPNMDNTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562228_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGV
FJ386671_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939561_MHBs_P-C      DPAPNMESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939542_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGA
EU916219_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTTPQSLDSWWTSLNFLGGA
EU872008_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089785_MHBs_P-C      DPAPNMESTTSGFLGPLLVXQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY641561_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY167099_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGA
AB247916_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB198081_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB105174_MHBs_P-C      DPAPNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU916223_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU916224_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU916222_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB117758_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB205125_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB026811_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB026812_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB026813_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB026814_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB074755_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB074756_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB105173_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB299858_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB300363_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB426467_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF223954_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF223956_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF223957_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF223958_MHBs_P-C      DPALNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF223959_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF223960_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF223961_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF473543_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AP011097_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY862869_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089764_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089769_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089771_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU305540_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089779_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089770_MHBs_P-C      DPAPNMESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ089778_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB198082_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715358_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715357_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939617_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386652_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562284_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGA
AB642099_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB111118_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB050018_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014383_MHBs_P-C      DPAQNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014381_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014371_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670301_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB198077_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB198078_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB198079_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB246345_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB288026_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB298720_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB298721_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB300359_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB300365_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367407_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB471848_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB471849_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB471850_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB642100_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB198083_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ032333_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386624_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386665_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB300361_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377538_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ899788_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939615_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386678_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB033552_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB033556_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB033551_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ899767_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGA
FJ715397_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
FJ562250_MHBs_P-C      DPAPNMENTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562221_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
FJ386689_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939647_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939596_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939548_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670306_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014378_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGEA
LC279253_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGEA
GQ475351_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377540_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715422_MHBs_P-C      GPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715392_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386664_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386620_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU579442_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ683578_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ536412_MHBs_P-C      DLAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ536410_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
AB195945_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB182589_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787457_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787458_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475316_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475327_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475334_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB205124_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY057947_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY206392_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562233_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562265_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377575_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377578_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ475318_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB042282_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB042283_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB033553_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB202071_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670252_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014376_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB642095_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB900115_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB300368_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386613_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
FJ386672_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
EU939593_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ040161_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670238_MHBs_P-C      DPAQNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367403_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670256_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562319_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ899775_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939540_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ899763_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ227696_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939572_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWLTSLNFLGGA
AB642097_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGYFLLTRILTIPKSLDSWWTSLNFLGGA
AB014374_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014377_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195947_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB222714_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB222715_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB300362_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB362932_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB365451_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367399_MHBs_P-C      DPAQNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB471851_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB471852_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB471853_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB485808_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB640730_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB014394_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367432_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367804_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377618_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377616_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377598_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377563_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377553_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377518_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGA
GQ377517_MHBs_P-C      DLAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ227697_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ227695_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ227694_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ227693_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ227692_MHBs_P-C      DLAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715370_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715368_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715367_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715366_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715365_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715364_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715350_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715343_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715342_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562318_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562243_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQGGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386589_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGA
FJ386576_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386575_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939656_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
EU939655_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
EU939597_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGA
EU939536_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU562218_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU560440_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU554536_MHBs_P-C      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGA
AB670297_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ032331_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB198076_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562301_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
EU939612_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
AB670291_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWLTSLNFLGGA
HM750139_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377585_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377570_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377562_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377554_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377545_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377541_MHBs_P-C      DPAPNMEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715395_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562225_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939552_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670287_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB670242_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGA
AB670247_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF182802_MHBs_P-C      DPAPNMQNTTSGFLGPLLALQAGFSLLTRILTIPQSLDSWWTSLNFLGGA
EU939659_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGA
FJ787470_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787471_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715415_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
FJ715416_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGA
EU939651_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
AB300360_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU093900_MHBs_P-C      DPAPNMENTTSGFLGPLLGLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
AB670278_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGA
AB195937_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGA
AB195938_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGA
EU579443_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGA
AB367395_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386647_MHBs_P-C      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367398_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB111122_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562230_MHBs_P-C      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWT