HBVdb

Dataset for protein Pol of genotype C

[Download (right click)] [Edit] [Sequences] [Repertoires]

2613 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KJ717799_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPHLADEGLNRRVAEDPNVGNL
KJ803790_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPHLADEGLNRRVAEDPNVGNL
GQ358157_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
HQ700522_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
HQ700543_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
JQ341632_Pol_P-C      MPLSYQHFRRLLLL--DA--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ924622_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPXLADEGLNRRVAEDLNLGNL
AP011100_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU410079_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AP011101_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB241111_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU410080_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AP011099_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB241110_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU410081_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR014083_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR014078_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRPADEGLNRRVAEDLNLGNL
KR013870_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLKRRVAEDLNLGNL
KR013871_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR014077_Pol_P-C      MPLSYQHFRELLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR014082_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ924620_Pol_C-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173335_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JN827414_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JN827415_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF241410_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF241411_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF873544_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU679937_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGBP
KF873539_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KF873541_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KF873536_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGDP
KU679960_Pol_P-C      MPLSYQHFRKLLLL--DH--EAGPLEEELPRLADEGLNRRVAEDLNLGBP
KU679951_Pol_P-C      MPLSYQRFRXLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF873526_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF873528_Pol_P-C      MPLSYQHXRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNX
KF873529_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU679947_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDP
KU679957_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KU679936_Pol_P-C      MPLSYPHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KF873514_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KF873520_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
AB115417_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF925403_Pol_P-C      MHLSYQRFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB112348_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ717839_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
KJ803823_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
KJ717834_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803818_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF214671_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ717804_Pol_P-C      MPLSYQHFRKLLLL--DA--ESGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803794_Pol_P-C      MPLSYQHFRKLLLL--DA--ESGPLEEELPRLADEGLNRRVAEDLNLGNL
AB112471_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ717791_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEGLNRRFAEDLNLGNL
GQ924658_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF053161_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803754_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB112066_Pol_P-C      MPPSYQHSRKLLLL--DD--EAGPLERELPRLADEGLNRRVAEDLNLGNL
KF053193_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF053168_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803760_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF214675_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX276848_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF214670_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
JF899336_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089804_Pol_P-C      MPLSYQHFRKLLLL--ED--DAGPLEEELPRLADEGLNRRVAEDLNLGNP
KJ717825_Pol_P-C      MPLSYQRFLRLLLL--DH--EAGPLEEELPRLADEGLNRRFAEDLNLGNL
KJ803812_Pol_P-C      MPLSYQRFLRLLLL--DH--EAGPLEEELPRLADEGLNRRFAEDLNLGNL
KJ717827_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRCAEHLNLGNL
KJ803814_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRCAEHLNLGNL
KJ717828_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRCAEHLNLGNL
KJ803815_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRCAEHLNLGNL
KJ717826_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803813_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ717823_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRGAEDLNLGNL
KJ803811_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRGAEDLNLGNL
JQ801488_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765852_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC315399_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801482_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ429078_Pol_P-C      MPLSYQHFRKLLLL--DA--GAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801515_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KF214673_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU051425_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801491_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765849_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801486_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801521_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG826122_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF925409_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ027317_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF925377_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470909_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801523_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEEHPRLADEGLNRRVAEDLNLGNL
MF925394_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470916_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX774504_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX774506_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765830_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765828_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801520_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEKLPRLPHEGLNPLLAEDLNLGNL
MF925376_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470936_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLSLGNL
KX765821_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ023654_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF925398_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470914_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF925378_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
MF925367_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470908_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470906_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765842_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765822_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765820_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF925387_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765826_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF053176_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF925405_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF925395_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF925374_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF925359_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470913_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470907_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765837_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765832_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765818_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MH220971_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
MF925406_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470917_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470912_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765843_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765840_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEDELPRLADEGLNRRVAEDLNLGNL
KX765834_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765831_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765853_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG725248_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF925410_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF925408_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470920_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470918_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470915_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470911_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470910_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765846_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765838_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765829_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF925375_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765851_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX276850_Pol_P-C      MPLSYQHFRKLXLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
MF925365_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148476_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148547_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148483_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148491_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148566_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148513_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148474_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148575_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148567_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148561_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148555_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148537_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148512_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148465_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148489_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148488_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVTEDLNLGNL
KP148487_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148473_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148472_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148477_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148481_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148470_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148475_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148479_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148469_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148482_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148468_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148471_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148480_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148492_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148557_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148526_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148543_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148564_Pol_P-C      MPLSHQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148563_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148559_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADKGLNRRVAEDLNLGNL
KP148558_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148548_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148546_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148560_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148545_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148540_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KP148531_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148528_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148521_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148524_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148462_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRPADEGLNRRVAEDLNLGDL
KP148466_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148315_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148464_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148463_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148520_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148523_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148532_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148535_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148538_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148549_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148570_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148571_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148573_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148568_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148517_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148519_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148525_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148529_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148530_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148551_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148552_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148554_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148562_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148572_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP148574_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX276844_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ924604_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801518_Pol_P-C      MPLSCQHVRKLMLL--YD--EAGRIEEELPRIANEGLNRRVAEDVNLGNL
JN827420_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HM011468_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ358153_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
DQ089803_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF053183_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803776_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ924650_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ924642_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ023639_Pol_P-C      MPLSYQHFRKLLLL--DD--GAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ717802_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPHLADEGLNRRVAEDLNLGNL
KJ803792_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPHLADEGLNRRVAEDLNLGNL
HM011491_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ023641_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ023642_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ717811_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ717810_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803799_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JN827416_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX774503_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ717812_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803800_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU051424_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ924629_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPXEEELPLLADEGLNRQVAEDLNVGNV
JQ801505_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB300363_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ023658_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801500_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF053167_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF053169_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803759_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803761_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB074755_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ924615_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX276847_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KC774228_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801481_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801473_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765827_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765836_Pol_P-C      TPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
JN827417_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ023656_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306689_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306691_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306688_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306685_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306687_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306690_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306694_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF214676_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JN827424_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JN827425_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT987426_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801522_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPVEEELPRLADEGLNRRVAEDLNLGNL
JQ801497_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT307718_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT307719_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU051426_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU051427_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT987425_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801493_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADKGLNRRVAEDLNLGNL
GQ924612_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ924613_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ023648_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT364718_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT347089_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801519_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JN827423_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ924609_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGLLEEELPRLAXEGLNRRVAEDLNLGNX
FJ023645_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB117758_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801504_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
JN827418_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ184326_Pol_P-C      MPLSYQHFRKLLLL--ED--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB247916_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765848_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765850_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU051423_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT987423_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF214668_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801470_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ924616_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT364719_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT364720_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801503_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRPADEGLNRRVAEELNLGNL
JQ801502_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JN827422_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JN827421_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ924614_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ023649_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB074756_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
JQ341657_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774236_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801475_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765844_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765825_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801511_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765833_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801513_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GU563561_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ023647_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF068756_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ023657_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ924649_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT366463_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801496_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT364721_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT987424_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG826128_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG826134_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MG826137_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AP011106_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPHLADEGLNRRVAEDLNLGNL
AP011107_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG826136_Pol_P-C      MPLSYQHFRKLLLL--ND--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG826133_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG826135_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG826131_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG826132_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX276855_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLXLGDL
MG826129_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
AB111946_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG826140_Pol_P-C      MPLSYQHFRKLLLL--DH--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG826143_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG826138_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEDLNRRVAEDLNLGNL
MG826139_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ717790_Pol_P-C      MPLSYQHFRKLVLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803779_Pol_P-C      MPLSYQHFRKLVLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB112472_Pol_P-C      MLLSYQHFRKLLLL--DD--EAGPLEEEFPRLADEGLNRRVAEDLNLGNL
AB105174_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410515_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801472_Pol_P-C      MPLSYQHFRKLLLL--DH--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU498227_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG571359_Pol_P-C      MPLSYQHFRKLVLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KJ717809_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF053187_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803780_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF053177_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KJ803770_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AJ748098_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ023646_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLSLGNL
KF053164_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KJ803757_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KX765847_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765819_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765855_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HM011472_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
MK818227_Pol_P-C      MPLSYQHFRXLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801498_Pol_P-C      MPLSYQHFRKLLLL--EDHEEAGPLEEELPRLADEGLNRRVAEDLNLGDP
GQ924643_Pol_P-C      MPLSYQRFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
JX870000_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEXLPXLADEGLNRRVAEDLNLGNL
EU305540_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410496_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089768_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ924636_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPIEEELPRLADEGLNRRVAEDLNVGNV
DQ089772_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KJ410498_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
EU305541_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089761_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
FJ023643_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ023644_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341622_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU305542_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765845_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765839_Pol_P-C      MPLSYQRFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVTEDLNLGNL
KM875424_Pol_P-C      MPLSYQHFRKLLLL--ED--GAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410489_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089757_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
AF223960_Pol_P-C      MPLSYQHFRKLLLL--DA--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674475_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341651_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089765_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674514_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341661_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ349225_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF473543_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX276854_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KM875425_Pol_P-C      MPLSYQHFRKLLLL--ED--GAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC875268_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEALNLGNL
JX507212_Pol_P-C      MPLSYQHFRKLLLL--DN--EXGPLEEEPPRLADEGLNRRVAEDLNLGNL
JQ341664_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HM011495_Pol_P-C      MPLSYQHFRKLLLL--DX--EAGPLEEELPRLADEGLNRRVAEDLNLGNX
AF223957_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF053173_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803766_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410501_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410513_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC875264_Pol_P-C      MPLSYQHFRKLVLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ358154_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ717844_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803826_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC875272_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC875267_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC875273_Pol_P-C      MPLSYQHFRKLVLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC875270_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC875265_Pol_P-C      MPLSYQHFRKLVLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC875269_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC875271_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC875274_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801501_Pol_P-C      MPLSYQRFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AP011097_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG826123_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765823_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX504535_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801495_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341654_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341652_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377536_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089764_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB031262_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674463_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674435_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674399_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173323_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674489_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX765824_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX276852_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410495_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341650_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341616_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173324_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341618_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674471_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ023650_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674494_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674457_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410504_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
JQ341642_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341631_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674429_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674386_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341669_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341639_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLGLGNL
JQ341644_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341663_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341655_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341653_Pol_P-C      MPLSYQHFRKLLLL--DP--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
MF674486_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341649_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674398_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089758_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341635_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410494_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410492_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410491_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410499_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410511_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB112063_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGDL
JQ341614_Pol_P-C      MPLSYQHFRKLLLL--EG--DAGPLEEELPRLADEGLNRRVAEDLHLGDL
DQ089771_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KR013787_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013927_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013935_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB112065_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MF674390_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MF674504_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KR013841_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MF674484_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MF674417_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KR013838_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KR013835_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MF674408_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KR013839_Pol_P-C      MPLSYQHFRKLLLL--DD--VAGPLEEELPRLADEGLNHRVAEDLNLGNL
KR013836_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KR013837_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KR013840_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MF674467_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MF674418_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MF674472_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MF674454_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MF674468_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MF674388_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MF674412_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MF674402_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MF674501_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KJ717803_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KJ803793_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
DQ089773_Pol_P-C      MPLSYQHFRKLLFL--DD--EAAPLEEELPRLADEVLNRRVAEDLNLGNL
DQ089766_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774227_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ027324_Pol_P-C      MPLSYQHFRKLLLL--DH--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089760_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG571345_Pol_P-C      MPLSYQHFRKLLLL--DN--EASPLEEELPRLADEDLNRRVAEDLNLGNL
KJ410518_Pol_P-C      MPLSYQHFRKLLLL--ED--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX276846_Pol_P-C      MPLSYXHFRRLLLLEDED--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ801490_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
JQ341626_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341613_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
JQ027318_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDP
DQ089769_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341611_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089759_Pol_P-C      MPLSYQHFRKLLLL--DD--XAGPLEEELPRLADEGLNRRVAEDLNLGNL
EF494379_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089763_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF223958_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341624_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF223961_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089762_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089770_Pol_P-C      MPLSYQHFRKLLLL--DD--EPGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410493_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
JX507214_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG571332_Pol_P-C      MPLSYQHFRKLLLL--ED--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341637_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX276851_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HM011488_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341621_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089785_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLAEEGLNRRVAEELNLGNP
AY167099_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089780_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
MF674430_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNHLVAEDLNLGTL
KF053181_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803774_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ717822_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803810_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377605_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377631_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089790_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089788_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
AB246346_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013857_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013855_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013854_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013856_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410514_Pol_P-C      MPLSYQHFRKLLFL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KF053185_Pol_P-C      MPLSYQHFRKLLLL--DV--AAGPLEEELPHLADEGLNRRVAEDLNLGDL
DQ089778_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVADDLNLGNL
JQ027320_Pol_P-C      MPLSYQLFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089787_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089776_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNHRVAEDLNLGNL
DQ089777_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MF674425_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674458_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013820_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX507211_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVADDLNLGNL
JQ341619_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNI
JQ341612_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ027321_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089789_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013823_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
GQ924655_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674428_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEELNLGNL
DQ089783_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLSLGNL
KR013826_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KM875428_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173285_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089791_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089775_Pol_P-C      MPLSYQHFRKLLLL--ED--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013825_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KR013824_Pol_P-C      MPLSYQRFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF223954_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF223956_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF223959_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF223955_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ246215_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674403_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410519_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173286_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341630_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341620_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEXLNLGNL
JQ027333_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ023653_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB205125_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674502_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX276841_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGTL
KX276840_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNX
KR013822_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPHLADEGLNRRVAEDLNLGDL
KR013821_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ040133_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EF688062_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089786_Pol_P-C      MPLSYPHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
DQ089779_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341628_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089792_Pol_P-C      MPLSYQHFRKLLLL--DD--XAGPLEXELPRLADEGLNRRVAEDLNLGNL
JQ341641_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674444_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089782_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MF674474_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB105173_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MF674442_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX276853_Pol_P-C      MPLSYQHFRKLLLL--ED--XAGPLEEELPRLADEXLNRRVAEDLXLGXX
HM011497_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013899_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEELNLGNL
JQ341659_Pol_P-C      MPLSYQHFRKLLLL--DD--XAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341615_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089781_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPHLADEGLNRRVAEDLNLGNL
MG571335_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ688403_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KM875405_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KM875404_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341647_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341633_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341617_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KM875406_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HM011486_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGXL
KR013905_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KR013902_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089784_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013770_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013900_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774351_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AB493839_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADDGLNRRVAEDLNLGNP
AB493844_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADDDLNRRVAEDLNLGNL
HQ700574_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700570_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700563_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700562_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700504_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700568_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700573_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700564_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700556_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700545_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700502_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700565_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KC793046_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700575_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HQ700495_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700496_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700544_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700566_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700572_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700559_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700561_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700555_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700558_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700569_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700457_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700490_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700567_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700456_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700475_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KU963904_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963900_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963901_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963902_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963903_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963905_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963906_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963907_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963908_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963909_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963910_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963911_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963912_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963913_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963914_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF495606_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
HQ700529_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KJ717821_Pol_P-C      MPLSYQHFRKLLLL--DH--EAGPLEEELPRLADEGLNRRVAEDLNLGTL
KJ803809_Pol_P-C      MPLSYQHFRKLLLL--DH--EAGPLEEELPRLADEGLNRRVAEDLNLGTL
EU939601_Pol_P-C      MPLSYQRFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670273_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC792831_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC792759_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
HQ700516_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLAEEGLNRRVAEDLNLGNP
GQ377555_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367417_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598672_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598678_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598662_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598674_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598676_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598663_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598665_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598666_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598667_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598668_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598664_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598669_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598670_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598671_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598673_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598677_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598731_Pol_P-C      MPLSYPHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964229_Pol_P-C      MPLSYPHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598722_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KJ598728_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964234_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964241_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KJ598739_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598724_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598732_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598733_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KU964239_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598725_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KU964237_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KJ598736_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598727_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964235_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598734_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598729_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598723_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598721_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598730_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598737_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964230_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964242_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598720_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KU964238_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KU964243_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KJ598726_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964236_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598735_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KJ598738_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964231_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964232_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964233_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964240_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY629637_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNLRVAEDLNLGNL
KC774235_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KY363260_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774240_Pol_P-C      MPLFYQHFRKLLLL--ND--KAGPLKKKLPRLKNKGLNRRVAEDLNLGNL
HM011493_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787441_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787439_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787479_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HQ700517_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470987_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KY470985_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KY470983_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KY470990_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KY470991_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KY470986_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KY470980_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEGLPRLADEGLNHRVAEDLNLGNL
KY470981_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEGLPRLADEGLNHRVAEDLNLGNL
KY470982_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEGLPRLADEGLNHRVAEDLNLGNL
KY470984_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEGLPRLADEGLNHRVAEDLNLGNL
KY470988_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEGLPRLADEGLNHRVAEDLNLGNL
KY670782_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MG826127_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KY629631_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KC774189_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
JX504537_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KC774335_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
JX661489_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPHLADEGLNRRVAEDLNLGNL
KR013778_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLDRRVAEDLNLGNL
DQ089796_Pol_P-C      MPLSYQRFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC792710_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774340_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ040166_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013860_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013859_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013861_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG826126_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KF779242_Pol_P-C      MPLSYQHFRKLLLL--DDGTEAGPLEEELPRLADEGLNRRVAEDLNLGNL
JN315779_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939617_Pol_P-C      MPLSYQHFRNVLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB485810_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
AB014396_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KM875423_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013786_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX661491_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX026878_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX026877_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
HM750136_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
HM750134_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939659_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KX276836_Pol_P-C      MPLSYQHFRKLLLL--DN--XAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC792902_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEDELPRLADEGLNRRVAEDLNLGDL
KC774348_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774181_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386679_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGDL
EU939585_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB111124_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB111125_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB246344_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF485390_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNXRVAEDLNLGNL
JQ040144_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HM011500_Pol_P-C      MPLSYQHFRKLLLL--DH--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
FJ899777_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939592_Pol_P-C      MPLSYQHFRKLLLL--DD--GAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB198081_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG826124_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KX276838_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNI
KC774268_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC792999_Pol_P-C      --LSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964324_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964332_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964323_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964333_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964328_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964322_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964330_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964318_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964319_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964320_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964321_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964325_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964326_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964327_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964329_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964331_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013762_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNCRVAEDLNLGNL
JQ040165_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562291_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF053170_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KJ803762_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KR013785_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774316_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEDELPRLADEGLNRRVAEDLNLGNL
KC774247_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HM750132_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377523_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939590_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939591_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173327_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173328_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC793024_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774276_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341634_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377600_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB971715_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB675677_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173433_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173434_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013813_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013784_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013783_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRAAEDLNLGNL
JQ027322_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
HM750131_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB971714_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ993692_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279249_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279248_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279247_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279246_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013810_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173316_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341643_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ993691_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ688404_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013812_Pol_P-C      MPQSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX504536_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ027323_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
HM011479_Pol_P-C      MPLSYQHFRKLLLL--DX--XAGPLEEELPRLADEGLNRRVAEDLXLGXL
KX276837_Pol_P-C      MPLSYQHFRKLLLL--DH--XAGPLEEELPRLADEGLNRRVAEXLXLGXL
KY022423_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013811_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803765_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC792862_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF053172_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598639_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173442_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173426_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013814_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC792799_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
V00867_Pol_P-C        MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774191_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
FJ386626_Pol_P-C      MPLSYQHFRKLLLL--DD--NAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013847_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013849_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013844_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013842_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEEPPRLADEGLNRRVAEDLNLGNL
KR013845_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013848_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF053184_Pol_P-C      MPLSYPHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KJ803777_Pol_P-C      MPLSYPHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
EU939539_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLHLGDL
AB931170_Pol_P-C      MPLSYQHFLKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB931171_Pol_P-C      MPLSYQHFLKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY057947_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ358158_Pol_C-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVADDLNLGNL
FJ386607_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386631_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670259_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC792880_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964020_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964021_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964022_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964023_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964024_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964025_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964026_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964028_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964029_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964030_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964031_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964032_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964033_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964027_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089801_Pol_P-C      MPLSYQHFRKLLLL--DD--XAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562298_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
X75665_Pol_P-C        MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KF214655_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562304_Pol_P-C      MPLSYQRFRKLLLL--DG--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089802_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
AY167091_Pol_P-C      MPLSYQHFRKLLLL--ED--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
AB900109_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KU964049_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964050_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964051_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964052_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964053_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964054_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964055_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964056_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964057_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964058_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964059_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964061_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964062_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964063_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964060_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
EU939654_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADDDLNRRVAEDLNLGNL
EU871978_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLAAEGLNRRVAEDLNLGNL
EU871979_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386624_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ372968_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MK321266_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNLRVAEELNLXNL
GQ377616_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
EU939651_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU919164_Pol_P-C      MPLSYQHFRKLLLL--DA--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
JF828916_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF828919_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF828918_Pol_P-C      MPLSYQHFRKLLSL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF828913_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF828915_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF828917_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU562216_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU562215_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU562217_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU871975_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU871977_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR819180_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774269_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774265_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562221_Pol_P-C      MPLSYQHFRKLVLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
EU882005_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377620_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
EU939594_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU554540_Pol_P-C      MPLSYQHFRRLLLL--DA--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787449_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGTL
FJ386611_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AB113878_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB195930_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB195931_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB195932_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ899789_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEEPPRLADEGLNRRVAEDLNLGNL
FJ787442_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787443_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377601_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377577_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774225_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB198082_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX429914_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX026888_Pol_P-C      MPLSYQLFRKLLLL--DD--EAGPLEEELLRLADEDLNRRVAEDLNLGNL
EU939582_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ899788_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939588_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939569_Pol_P-C      MPLSYQHFRKLLLL--DA--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
FJ562238_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562282_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386652_Pol_P-C      MPLSYQHFRKLLLL--DA--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939615_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU916225_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX560519_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774194_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939613_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386671_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562232_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU916219_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU916222_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939653_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KM229703_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774242_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377572_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386678_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939572_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386588_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367420_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
HQ622095_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306674_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306673_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306675_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU916223_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX560520_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774356_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475309_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670270_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787468_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787469_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPCLADEGLNRRVAEDLNLGNL
EU939550_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939536_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470875_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562306_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470879_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939597_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470885_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470873_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470890_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470874_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377540_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470892_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475332_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173283_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173284_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470891_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013850_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774190_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377598_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377563_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377517_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
FJ386639_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774233_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470887_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470882_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470877_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470889_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470888_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLDLGNL
KY470886_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLDLGNL
KY470883_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470884_Pol_P-C      MPLSYLHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470876_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470878_Pol_P-C      MPLSYLHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470881_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MH094411_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013798_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377528_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939548_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EF536066_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014399_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013961_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRHVAEDLNLGNL
KC774215_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774216_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY363261_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774289_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HQ700571_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
GQ377623_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377593_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939658_Pol_P-C      MPLSYQHFRKLLLL--DD--QAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939646_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ478885_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470970_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KY470976_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KY470975_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLDRRVAEDLNLGDL
KY470973_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KY470967_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KY470966_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KY470977_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KY470968_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KY470965_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KY470969_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KY470974_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KY470978_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KY470979_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KY470971_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KY470972_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KR013852_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEGELPRLADEGLNRRVAEDLNLGNL
KJ173313_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173314_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG893557_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279275_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KY363287_Pol_P-C      MPLSYQRFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY363286_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013868_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KR013851_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173296_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774278_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377518_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
FJ562264_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB900116_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670239_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670240_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367404_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB195936_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB195937_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB195938_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB642100_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670281_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MH887433_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013915_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774270_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774197_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939647_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013777_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013923_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774274_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774221_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ377632_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963915_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963916_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963917_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963918_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963919_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963921_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963922_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963923_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963924_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963925_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963926_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963927_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963928_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963929_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963920_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MH891502_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410508_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774346_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY596107_Pol_P-C      MPLSYQHFRKLLLL--DD--EVGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013797_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774283_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774245_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774229_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341670_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HQ700576_Pol_P-C      MPLSYQHFRKLLLL--DA--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
FJ032346_Pol_P-C      MPLSYQHFRKLVLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY247031_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC792911_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGBL
JQ040141_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562285_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470880_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964173_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774311_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939540_Pol_P-C      MPLSCQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598637_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598640_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173393_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173394_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881929_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT284756_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT284753_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU522068_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774313_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRAAEDLNLGNL
JX429909_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
DQ089793_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC792921_Pol_P-C      --LSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598641_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598642_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598660_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLVDEGLNRRVAEDLNLGNL
LC279276_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KY881932_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598679_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598635_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598636_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598659_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774272_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774266_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ924633_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562218_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939652_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939607_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013853_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598686_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774220_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774209_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EF536065_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ993693_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964170_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964169_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964182_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964179_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964184_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964183_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964174_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964176_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964178_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964181_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964177_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964171_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964172_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964175_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173317_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC792658_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774206_Pol_P-C      MPLSYRHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
FJ562284_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562233_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279259_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT284759_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KP027477_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ790199_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598661_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLVDEGLNRRVAEDLNLGNL
KC774355_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KC774331_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774184_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562332_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX661488_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ040155_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
KX276835_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774243_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774339_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ040151_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341665_Pol_P-C      MPLSYQHFRKLLLL--DX--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787450_Pol_P-C      --LSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
FJ787451_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774300_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLKLGNL
GQ377591_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AB675674_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AB675675_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AY206376_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AY206379_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774179_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774297_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013993_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KR013890_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGTL
KC774253_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774306_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
FJ386664_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774280_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KR013882_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGTL
KC774321_Pol_P-C      MPLSYQHFRKLLLL--DA--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774238_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KR013818_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774288_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEDLNRRVAQDLNLGNL
FJ562256_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
FJ562323_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPHLADEDLNRRVAEDLNLGNL
KC774303_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774207_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774302_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774308_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KR013819_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
FJ386623_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KR013817_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774325_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774304_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
EU939625_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNI
KC774296_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774282_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774330_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNP
KC774298_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
EU939626_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KT364752_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KT364751_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774285_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ377529_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774204_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774196_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774336_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386651_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774217_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386601_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173333_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KJ173334_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
KC774244_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562334_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774292_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
D28880_Pol_P-C        MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
S75184_Pol_P-C        MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
GQ377608_Pol_P-C      MPLSYQHFRKLVLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562250_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KY881890_Pol_P-C      MPLSYQHFQKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881883_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881872_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881887_Pol_P-C      MPLSYQHFRELLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881882_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881876_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881885_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881878_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881871_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881991_Pol_P-C      MPLSYQRFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881988_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881980_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881889_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRAAEDLNLGNL
KY881873_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881875_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881874_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881884_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881960_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY882002_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881997_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881993_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881978_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881974_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881973_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881891_Pol_P-C      MPISYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY882003_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881987_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881879_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881870_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881877_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY882001_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881990_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881989_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881979_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881971_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881966_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881962_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881961_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881888_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLDLGNL
KY881886_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881981_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881881_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881880_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLVDEGLNRRVAEDLNLGNL
KY881984_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562288_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386661_Pol_P-C      MPLSYQHFRRLLLL--DA--EAGPLEEELPRLADEGLNRRVAEDLNLGTL
KC774202_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
FJ562241_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
FJ787474_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774219_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964016_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964018_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964012_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964019_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964015_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964013_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964011_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964017_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939587_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX661497_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KR013909_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013869_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013908_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013773_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013776_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU916233_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013772_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNF
KR013771_Pol_P-C      MPLSYRHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLDLGNL
KR013774_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939579_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ899774_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ040152_Pol_P-C      MPLSYQHFRKLLLL--DD--XAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173435_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173436_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013866_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX429913_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX661496_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173319_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173321_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173281_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173282_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964004_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774343_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX026884_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562333_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939549_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013865_Pol_P-C      MPLSYQHSRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939648_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
AB198078_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC793107_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939584_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964064_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964078_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964076_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964065_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964066_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964067_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964068_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964069_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964070_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964071_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964072_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964073_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964074_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964075_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964077_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964336_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964337_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964338_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964339_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964340_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964342_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964344_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964345_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964346_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964347_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964348_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964334_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562330_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774251_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774185_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774250_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774255_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562230_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX661490_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
HM750137_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HM750138_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013863_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013864_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX661495_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562292_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF384371_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU560441_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787486_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ899776_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173431_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173432_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ040167_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774312_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939596_Pol_P-C      MPLSYQHFRKLVLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB176642_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGTL
KC774357_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU570073_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGTL
EU570074_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGTL
KC774200_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB900115_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEDLNRRVAEDLNLGDL
EU919168_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB113875_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB113876_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB049610_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013800_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HM750141_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939657_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014380_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939543_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014389_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014379_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013805_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNCRVAEDLNLGNL
AB014382_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
FJ787466_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787467_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939655_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939656_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB300360_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPHLADEGLNRRVAEDLNLGNL
AB014384_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
AB014383_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
FJ386602_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY167096_Pol_P-C      MPLSYQHFRKLLLL--DA--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670253_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774203_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF533983_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB205123_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013802_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013803_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013807_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013808_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013799_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562248_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367406_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279256_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB042284_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279254_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279255_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279257_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013801_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPCLADEGLNRRVAEDLNLGNL
KC774284_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
JX504539_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787464_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386575_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939640_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ377165_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014392_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014381_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173437_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173438_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774337_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774342_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377533_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774261_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774262_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470929_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KY470927_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KY470930_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KY470933_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KY470934_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KY470925_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEDLNRRVAEDLNLGNL
KY470926_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774345_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341648_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377526_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562325_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ032361_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF363961_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367414_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB111120_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774358_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HM750135_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAKDLNLGNL
FJ386685_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670241_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KJ598638_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774290_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY206382_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173331_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173332_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470900_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377578_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377514_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386662_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386659_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386618_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939616_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939614_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU916210_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367423_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB198083_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB195949_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ032359_Pol_P-C      MPLSYQHFRRLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ032360_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
X04615_Pol_P-C        MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279245_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX429916_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341636_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377584_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562318_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562266_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
EU939586_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLTDEGLNRRVAEDLNLGNL
AB670297_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB198080_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB111119_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306726_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306728_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB026811_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB026812_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB026813_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB026814_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306721_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306720_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ377164_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306719_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787453_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787454_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774361_Pol_P-C      MPLSYQHFRKLLLL--DA--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774354_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KC774333_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377524_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
FJ562281_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562265_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386576_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939610_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367407_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
AF461357_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEDELPRLADEGLNRRVAEDLNLGNL
AF461363_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEDELPRLADEGLNRRVAEDLNLGNL
KY470901_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470902_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470894_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB299858_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB426467_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279258_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774338_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377583_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562228_Pol_P-C      MPLSYQHFRKLLLL--ED--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386587_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU717212_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ032355_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLANEGLNRRVAEDLNLGNL
FJ032356_Pol_P-C      MPLSYPHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173446_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774360_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HM750140_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377624_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377535_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787445_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562272_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670251_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGDL
GQ259588_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377553_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173309_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774318_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX661492_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX429915_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377579_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377576_Pol_P-C      MPLSYQHFRKLQLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377527_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939538_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774192_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ899765_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
FJ899761_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
FJ899764_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470897_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470896_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964198_Pol_P-C      MPLSYQHFRKILLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774239_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX504546_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX504545_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX429918_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377637_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377551_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562308_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386632_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386609_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470895_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470899_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964185_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964186_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964189_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964190_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774241_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ040131_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGDL
AB198079_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX429917_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX504544_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB198077_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562283_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470904_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774315_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ040145_Pol_P-C      MPLSXQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377552_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC318703_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
LC318702_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KY470905_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470903_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964192_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964191_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964188_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964187_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173310_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173287_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADESLNRRVAEDLNLGNL
KC774231_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774320_Pol_P-C      MPLSYQHFRKLVLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173392_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173391_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ040163_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774237_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KU964193_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964194_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964195_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964196_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964197_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964199_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU570072_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADDDLNRRVAEDLNLGNL
AY220702_Pol_P-C      MPLSYQPFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGDL
FJ562300_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
FJ386628_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY206386_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGSL
AF458665_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774264_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939568_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF411412_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014391_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU717215_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ032340_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ032341_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC792995_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939564_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
D23684_Pol_P-C        MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386630_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939605_Pol_P-C      MPLSYQYFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ922651_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774214_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AY220699_Pol_P-C      MPLSYQHFRRLLLL--DA--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY206381_Pol_P-C      MPLSYQHFRRLVLL--DD--EAGPLEEELPRLTDEGLNRRVAEDLNLGNL
KU964341_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386653_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAKDLNLGNL
EU919169_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670261_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ899769_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ899770_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939563_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ899771_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774319_Pol_P-C      MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNP
KC774271_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ377609_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
FJ386577_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ975274_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDPNLGNL
KY881810_Pol_P-C      MPLSYQHLRKLLLL--ND--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013858_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774205_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ899772_Pol_P-C      MPLSYQDLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU916204_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787470_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNI
FJ787471_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNI
KR013827_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939562_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU916224_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU589336_Pol_P-C      MPLSYQHFRKLVLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670258_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB300372_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR014043_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013815_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562258_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562249_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562235_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939567_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964343_Pol_P-C      MPLSYQHFRKLLLL--ED--ESGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774226_Pol_P-C      MPLSYQPFRKLLLL--NN--KAGPLKKKLPPLPNKGLNRRVAEDLNLGGF
KC774211_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADDVLNRRVAEDLNLGNL
JX504542_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787448_Pol_P-C      MPLSYQHFRKLLLL--DD--AAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386614_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU554535_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774254_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774256_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KC774277_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964014_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377546_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562239_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386657_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU439015_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ975273_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774281_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774199_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377599_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939619_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU871976_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU579443_Pol_P-C      MPLSYQHFRRLVLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU554536_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
D23681_Pol_P-C        MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
D23680_Pol_P-C        MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670282_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB300359_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014362_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT284754_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173288_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774309_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774208_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ040132_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
FJ562276_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939600_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939570_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939544_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670311_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ922649_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ980547_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881816_Pol_P-C      MPLSYQHFRKLLLL--DA--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881815_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881811_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR014049_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598703_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774286_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF436920_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ922650_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089799_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB471848_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB471850_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB471849_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881818_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR014092_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC875263_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC875262_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774301_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774213_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
JQ040149_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562324_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562269_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ518813_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386579_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF461358_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF461359_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881804_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881813_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881817_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881809_Pol_P-C      MPLSYQHFRKLLLL--DA--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964355_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013862_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774347_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377575_Pol_P-C      MPLSYQHFRKLQLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562274_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939546_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881814_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013834_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KJ598777_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598716_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598707_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598717_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598689_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173443_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173444_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC793097_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774287_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774210_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX504541_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ341658_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386670_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
FJ386598_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939644_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939618_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670254_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881819_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPHLADEGLNRRVAEDLNLGNL
KY881807_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881803_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881806_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY206384_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881736_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881737_Pol_P-C      MPLSYQHFRKLLLL--DD--EVGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881738_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881739_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881742_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881743_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881744_Pol_P-C      MPLSYQHFRKLLLL--DD--EVGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881748_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881749_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881750_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881751_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881754_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881755_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881758_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881762_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881763_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881764_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881765_Pol_P-C      MPLSYQHFRKLLLL--DD--EVGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881766_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881767_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881768_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881769_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881770_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881771_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881772_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881773_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881774_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881775_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881776_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881777_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963875_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963877_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963882_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGINRRVAEDLNLGNL
KU963871_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963872_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963873_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963874_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963876_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963879_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963881_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963884_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963885_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963878_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963880_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU871980_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU871998_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG893558_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG893553_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881805_Pol_P-C      MPLSYQHFRKLLLL--DA--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598768_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598718_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598709_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173295_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC792834_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386591_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939611_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY206392_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEELNLGNL
AB670289_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670269_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB246345_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377571_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377615_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG893560_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGHLEEELPRLADEGLNRRVAEDLNLGNL
KU964361_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013831_Pol_P-C      MPLSYQHFRKLLLL--DD--ETGPLEEELPRLADEDLNRRVAEDLNLGDL
KJ598767_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598719_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598693_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ410521_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
JX429906_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ040168_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GU434374_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377642_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377640_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377621_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377597_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377521_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
EU439016_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF458664_Pol_P-C      MPLSYQHFRELLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB900099_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670276_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173301_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173302_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC090200_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598715_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598714_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598710_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598698_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598680_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173305_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173289_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774218_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX429912_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562242_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KJ598769_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173337_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173306_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774299_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ040162_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB642099_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB300365_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU871982_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377515_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377574_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377619_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279262_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279261_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279260_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964362_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964360_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964356_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964353_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013833_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEGLNLGNL
KR013829_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KR013828_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KJ598773_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173430_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173428_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173427_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173315_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173294_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173293_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774359_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774327_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774293_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774249_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX429904_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562275_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964364_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964358_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964349_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964363_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964365_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964359_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964357_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964354_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964352_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ040161_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADVGLNRRVAEDLNLGNL
KU964350_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013830_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KJ598711_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598708_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598706_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598705_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598687_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598681_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598712_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598713_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013832_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KP784761_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173429_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774314_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774248_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ040154_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JQ040172_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386617_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386689_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
X52939_Pol_P-C        MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ377562_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386589_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939573_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562307_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562268_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ032331_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT284757_Pol_P-C      MPLSYQHFRKVLLL--ED--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939612_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377545_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774260_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774267_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
MG893556_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386613_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939593_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU562218_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939552_Pol_P-C      MPLSYQHFRKLLLL--NN--QAGPLEKELPRLANEGLNRRVAKDLNLGNL
JQ040135_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377585_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562301_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB198076_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT284758_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377554_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562225_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386672_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774329_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377559_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377570_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KX276839_Pol_P-C      MPLSYPHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HM750139_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386620_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964215_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964219_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964214_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964216_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964217_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964220_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964218_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964228_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964225_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964222_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964226_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964227_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964224_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964221_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964223_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB697502_Pol_P-C      MPLSYQHFRKLLLL--DN--EVGPLEEELPRLADEGLNRRVAEDLNLGNP
FJ787455_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787456_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939555_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386597_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598757_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598765_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598756_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787452_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598780_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598776_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598761_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598770_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598779_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598778_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598766_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598771_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598772_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598775_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY066028_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU796072_Pol_P-C      MPLSYQHFRKLLLL--DG--EADPLEEELPRLADEGLNRRVAEDLNLGNL
AF411408_Pol_P-C      MPLSYQHFRKLLLL--DD--EADPLEEELPRLADEGLNRRVAEDLNLGNL
AF411411_Pol_P-C      MPLSYQHFRKLLLL--DD--EADPLEEELPRLADEGLNRRVAEDLNLGNL
EU796070_Pol_P-C      MPLSYQHFRKLLLL--DG--EADPLEEELPRLADEGLNRRVAEDLNLGNL
EU796069_Pol_P-C      MPLSYQHFRKLLLL--DA--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY206389_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475330_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598653_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598657_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598655_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598654_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598648_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLVDEGLNRRVAEDLNLGNL
KJ598647_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598649_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598651_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598658_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306713_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306729_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ377160_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306725_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGGL
EU439005_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306727_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306724_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGTLEEELPRLADEGLNRRVAEDLNLGNL
EU306722_Pol_P-C      MPLFYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ377161_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ377162_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ377163_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306714_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013984_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR014048_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRFADEGLNRRVAEDLNLGNL
EU939609_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU554541_Pol_P-C      MPLSYQYFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU554542_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ032345_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939603_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY167090_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881976_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881959_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881968_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881941_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881940_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881918_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881998_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881943_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881920_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881921_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881922_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881942_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881967_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881939_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881969_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881985_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881970_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY882000_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881996_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881992_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881986_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881983_Pol_P-C      MPLPYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881964_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881963_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881937_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881975_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881916_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881923_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881924_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881925_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881926_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881927_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881928_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881930_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881931_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881933_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881934_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881935_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881936_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881938_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881965_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881977_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881982_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881995_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881915_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881917_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881919_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU872008_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB195952_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB195953_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB195954_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562335_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598743_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367434_Pol_P-C      MPLSYQHFRKLLLL--DD--EACLLEEELPRLADEGLNRRVAEDLNLGNL
FJ787462_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ032350_Pol_P-C      TPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ032351_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598699_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598750_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598748_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598742_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598746_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598751_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598754_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598740_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598749_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598753_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598702_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598752_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598741_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598745_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598747_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598744_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367410_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU872002_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
EU872003_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
EU872001_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
EU872004_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
EU872000_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
FJ562327_Pol_P-C      MPLSYHHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386604_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787437_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLSRRVAEDLNLGNL
LC279274_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KR013874_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963996_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964002_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963992_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963997_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013876_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013872_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939557_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173318_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AB670249_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963897_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963886_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963887_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963888_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963889_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963890_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963891_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963892_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963893_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963895_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963896_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963898_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963899_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU963894_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939642_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386595_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939561_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU872010_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY306136_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013877_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013875_Pol_P-C      TPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGSL
GQ377617_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562329_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013873_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964045_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964044_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964043_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964040_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964039_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964034_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964035_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964037_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964038_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964041_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964042_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964046_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEELNLGNL
KU964047_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964048_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KU964036_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
FJ562244_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386574_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY596108_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562279_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386638_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ377557_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AY220701_Pol_P-C      MPLSYQLFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KR013789_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
DQ993181_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
EU939566_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KR013942_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ377586_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGDP
KC774195_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
JX429907_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KJ173439_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KJ173440_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AF182802_Pol_P-C      MPLSYQHFRKLLLL--DD--KAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU871970_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU871972_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU871973_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU871974_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU871971_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF182803_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF182804_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU871969_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GU721029_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562310_Pol_P-C      MPLSYQHFRKLLLL--DA--QAGPLEEELPRLADEDLNRRVAEDLNLGNL
FJ562245_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX429903_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562255_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ032339_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ032336_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ032338_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562293_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013791_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013943_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386673_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB288026_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386663_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ032334_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
EU939595_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY881812_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377628_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386644_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KU964200_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KU964202_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KU964203_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KU964205_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KU964212_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KU964209_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KU964206_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
KU964201_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KU964204_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KU964207_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KU964208_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KU964211_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KU964213_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KU964210_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
FJ562337_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386637_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562252_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562315_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562313_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386592_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377530_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173304_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173307_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173308_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774279_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939545_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014371_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KC774224_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377580_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562251_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
FJ386619_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562273_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014369_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HM011465_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX504534_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173311_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173312_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173291_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173292_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173303_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774310_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367397_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377636_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB050018_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KT284755_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173395_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173396_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774295_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774326_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX661493_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC373511_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC373512_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU670263_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADDGLNRRVAEDLNLGNL
AB014393_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014378_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014365_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY363252_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB697510_Pol_P-C      MPLSYQHFRKLLFL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
D23682_Pol_P-C        MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
D23683_Pol_P-C        MPLSYQHFRKLLLL--DN--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367421_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGTL
AB367432_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367804_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KR013796_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEELNLGNL
KR013794_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013793_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013795_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU579442_Pol_P-C      MPLSYQHFRKLVLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB111114_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562320_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU560440_Pol_P-C      MPLSYQHFRKLVLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY363258_Pol_P-C      MPLSYPHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
GQ475351_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377618_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ787457_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNF
FJ787458_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY363283_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY363264_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475318_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KJ410510_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774187_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
AB367412_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB300362_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY641562_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670306_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGTL
AB670267_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB195948_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475348_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU881996_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ475355_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB697500_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB362932_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014363_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
AB670302_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670292_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY363253_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ872210_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475341_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475344_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670274_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGXL
AB195947_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475321_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475307_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014374_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475345_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY363254_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEDLNRRVAEDLNLGNL
EU939542_Pol_P-C      MPLSYQHFRRLVLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ899767_Pol_P-C      MPLSYQHFRRLVLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR014008_Pol_P-C      MPLSYQHLRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR014016_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR014012_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLKLGNL
KR014017_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR014010_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR014011_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR014015_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR014018_Pol_P-C      MPLSYQHLRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY641559_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KY363275_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670298_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
FJ386625_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY641560_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670238_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AY641561_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY363278_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY363279_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670309_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AB298720_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADAGLNRRVAEDLNLGNL
AB298721_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADAGLNRRVAEDLNLGNL
AB014385_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670237_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY363284_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670285_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670305_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670279_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB113879_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475347_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AB195945_Pol_P-C      MPLSYQHFRRLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AB367416_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367803_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADECLNRRVAEDLNLGNL
GQ475316_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ475327_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ475334_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ475350_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
D00630_Pol_P-C        MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AF286594_Pol_P-C      MPLSYQHFRKLLLL--DA--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
AB670277_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB640730_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670287_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367427_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
JQ341662_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ475313_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ475320_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
FJ562319_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386647_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939649_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AB670294_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367411_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB033550_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB300361_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAKELNLGNL
GQ475328_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY363281_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475331_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ475311_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
DQ890381_Pol_P-C      MPLSYQHFRKLLLLDVDN--KAGPLEEELPRLADEDLNRRVAEDLNLGNL
AB367418_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AB367402_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014377_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ536410_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ536412_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475329_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475317_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY247032_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367403_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475322_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475312_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ475305_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475346_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014367_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGBL
AB367395_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB033556_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB033553_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB033551_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB033552_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475339_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475336_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AB642095_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
AB697490_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AP011098_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475310_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ475314_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475349_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367424_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367396_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF485389_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475306_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ475308_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ475315_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KY363268_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774352_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLKYRVAEDLNLGNL
AB670262_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGTP
AB367401_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
AB367392_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF828921_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF828931_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF828923_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF828924_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF828926_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF828925_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF828930_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF828929_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF828922_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF828928_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
D12980_Pol_P-C        MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JF828937_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014372_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279250_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279252_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB471852_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
AB471853_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
AB471851_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNL
MH818373_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNP
AB670272_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
AB106895_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB042282_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
AB042283_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
AB670295_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670260_Pol_P-C      MPLSYQHFRKLLLL--DV--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014360_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB111122_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AB111123_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AB111121_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
AY641558_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JN400088_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JN400087_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNPGNL
JN400089_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNPGNL
AB670263_Pol_P-C      MPLSYQHFRKLLLL--DE--DAGPLEEELPRLADEGLNRRVAEDLNLGNP
AB670242_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRHVAEELNLGNL
AB367399_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ683578_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670252_Pol_P-C      MPLSYQHFRKLLLL--DD--EGGPLEEELPRLADEGLNRRVAEDLNLGNL
AB300368_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB222714_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB222715_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ872211_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475338_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475319_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
D50519_Pol_P-C        MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670275_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB485808_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB365451_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLAEEGLNRRVAEDLNLGNL
AB670266_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670301_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475337_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670278_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670256_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367398_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014376_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB026815_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB014394_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279253_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670247_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB202071_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB182589_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
LC279251_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367422_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
AB195943_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB195944_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB205124_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEGLPRLADEGLNRRVAEDLNLGNL
D50518_Pol_P-C        MPLSYQHFRKLLLL--DA--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
D50517_Pol_P-C        MPLSYQHFRKLLLL--DA--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670291_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB195942_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670283_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367394_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670288_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
D50520_Pol_P-C        MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670310_Pol_P-C      MPLSYQHFRKLVLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670300_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
GQ475357_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475354_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475324_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB642097_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGXL
AB670265_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
EU939541_Pol_P-C      MPLSYQHFRKLLLL--DD--KAGPLKKKLPRLANKGLNRRVAKNLNLGNL
EU560438_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADDGLNRRVAEDLNLGDL
AB900113_Pol_P-C      MPLSYQHFRKLLLL--DN--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
EU560439_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADDGLNHRVAEDLNLGNL
KC774334_Pol_P-C      MHLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAKDLNLGNL
KC774180_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GU357845_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774353_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAKDLNLGNL
FJ562299_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU547562_Pol_P-C      MPLSYQHFRKLLLL--EQ--DAGPLEEELPRLADEGLNRRVAEDLNLGNP
FJ386596_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386687_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475356_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ089797_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB367431_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
EU916237_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDPNLGNL
EU916238_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
GQ377538_Pol_P-C      MPLSYQHFLKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013761_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562280_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939571_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670264_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KC774252_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGNI
GQ377541_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939578_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU554537_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ478899_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013765_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013764_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ562243_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013769_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013766_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386627_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013763_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013768_Pol_P-C      MSLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
JX429905_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013779_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774232_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386603_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU570068_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU554538_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU554539_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377603_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ377531_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013782_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013781_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774275_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774223_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774257_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774259_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KM213037_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386605_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HM011489_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC774182_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KC792775_Pol_P-C      ---------LLLDP--EA--EAGPLEEELPRLADEGLNRRVAEDLNLGNP
AY206388_Pol_P-C      MPLSYQHFRKLLLL---D--EAGPLEEELPRLADEGLNRLVADDLNLGNL
FJ899773_Pol_P-C      -PLSYQHFRKLLLL--DD--EAGPLEEELPRLANEGLNRRVAEDLNLGNL
JQ341660_Pol_P-C      -----QHFRKLLLL--DD--EXGPLEEELPRLADEGLNRRVAEDLNLGNL
MG826125_Pol_P-C      -PLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB485809_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
DQ089795_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013969_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KR013974_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ899783_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU589345_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670268_Pol_P-C      MPLSYXHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGTL
AB670304_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY363276_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU939556_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
EU939599_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLAYEGLNRRVAQDLNLGNP
EU939553_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HM011481_Pol_P-C      MPLSYQHFXKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB112408_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB074047_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
DQ315781_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
DQ315783_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ023640_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF214677_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGDL
KR013903_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KY470937_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLGLGNL
MF925369_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU306671_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPHLADEGLNRRVAEDLNLGNL
HQ700578_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNHRVAEDLNLGDL
EU522071_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
HQ700506_Pol_P-C      MPLSYQHFRKLLLL--DE--EAGPLEEELPRLADEDLNRRVAEDLNLGNP
FJ386612_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF779327_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF053175_Pol_P-C      MPLSCQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ803769_Pol_P-C      MPLSCQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AY641563_Pol_P-C      MPLSYQHFRKLLLL--DD--AAGPLEEELPRLADEDLNRRVAEDLNLGNL
FJ032333_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
FJ386665_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
KJ598774_Pol_P-C      MPLSYQHFRKLLLL--DD--DAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ227692_Pol_P-C      MPLSYQHFRKLLSL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU916229_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB697494_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KF779300_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
AB670290_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475342_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ475353_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEDLNRRVAEDLNLGNL
FJ032332_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
EU872012_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598644_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598652_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598645_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598650_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598656_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598646_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598695_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598690_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598691_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598696_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598697_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598701_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ598688_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ227697_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ227695_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ227693_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGSL
GQ227694_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
GQ227696_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ899763_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ899775_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
FJ386650_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
KJ173441_Pol_P-C      MPLSYQHFRKLLLL--DD--EAGPLEEELPRLADEGLNRRVAEDLNLGNL
                                :              :          :.   :.       

KJ717799_Pol_P-C      NVSIPWTHKVGNFTGLYSYPVPVVNPEWQIPSFPDIHLQEDIVNRCQQLK
KJ803790_Pol_P-C      NVSIPWTHKVGNFTGLYSYPVPVVNPEWQIPSFPDIHLQEDIVNRCQQLK
GQ358157_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQYV
HQ700522_Pol_P-C      NVSIPWTHKVGNFTGLYSSTTPVFNPEWQTPSFPNIHLREDIINRCQQYV
HQ700543_Pol_P-C      NVSIPWTHKVGNFTGLYSSTTPVFNPEWQTPSFPNIHLREDIINRCQQFV
JQ341632_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQFV
GQ924622_Pol_P-C      NVSIPWTHKVGNFTGLYSSNVPVFNPEWQTPSFPDIHLQEDIINRCQQFV
AP011100_Pol_P-C      NVSIPWTHKVGNFTGLYSSNVPVFNPDWQTPSFPDIHLQEDIIDRCQQFV
EU410079_Pol_P-C      NVSIPWTHKVGNFTGLYSSNVPVFNPEWQTPSFPDIHLQEDIINRCQQFV
AP011101_Pol_P-C      NVSIPWTHKVGNFTGLYSSNVPVFNPDWQTPSFPDIHLQEDIINRCQQFV
AB241111_Pol_P-C      NVSIPWTHKVGNFTGLYSSNVPVFNPEWQTPSFPDIHLQEDIINRCQQFV
EU410080_Pol_P-C      NVSIPWTHKVGNFTGLYSSNVPVFNPEWQTPSFPDIHLQEDIINRCQQFV
AP011099_Pol_P-C      NVSIPWTHKVGNFTGLYSSNVPVFNPEWQTPSFPDIHLQEDIINRCQQFV
AB241110_Pol_P-C      NVSIPWTHKVGNFTGLYSSNVPVFNPEWQTPSFPDIHLQEDIINRCQQFV
EU410081_Pol_P-C      NVSIPWTHKVGNFTGLYSSNVPVFNPEWQTPSFPDIHLQEDIINRCQQFV
KR014083_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIIHRCRQFV
KR014078_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIIHRCEQFV
KR013870_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIIHRCQQFV
KR013871_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIIHRCQQFV
KR014077_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIIHRCQQFA
KR014082_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIIHRCQQFV
GQ924620_Pol_C-C      NVSIPWTHKVGNFTGLYSSSVPVFNPEWQTPSFPDIHLQEDIINRCQQFV
KJ173335_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIITRCQQFV
JN827414_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQFV
JN827415_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQFV
AF241410_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPDIHLQEDIINRCQQFV
AF241411_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQFV
KF873544_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQXYV
KU679937_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLHEDIINRCZQYV
KF873539_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
KF873541_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
KF873536_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLHEDIIHRCQQYV
KU679960_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPTFPDIHLHEDIIHRCQQYV
KU679951_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQYV
KF873526_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQYV
KF873528_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIIBRCQQYV
KF873529_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQYV
KU679947_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQYV
KU679957_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPDIHLREDIINRCQQYV
KU679936_Pol_P-C      NVSIPWTHKVGNFTGLYSSSVPVFNPEWQTPSFPDIHLREDIINRCQQYV
KF873514_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQYV
KF873520_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQYV
AB115417_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
MF925403_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCEQFV
AB112348_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPYIHLKEDIINRCQQFV
KJ717839_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKQDLLNRCQQYV
KJ803823_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKQDLLNRCQQYV
KJ717834_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ803818_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KF214671_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPSFNSDWQTPSFPHIHLKKDIIINYQQFV
KJ717804_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KJ803794_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
AB112471_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KJ717791_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
GQ924658_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLKEDIINRCQQYV
KF053161_Pol_P-C      TVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
KJ803754_Pol_P-C      TVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
AB112066_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KF053193_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQFV
KF053168_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KJ803760_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KF214675_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KX276848_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIIBRCQQYV
KF214670_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCEQFV
JF899336_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQYV
DQ089804_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ717825_Pol_P-C      NATIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPYIHLKEDIINRCQQYV
KJ803812_Pol_P-C      NATIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPYIHLKEDIINRCQQYV
KJ717827_Pol_P-C      KSPIPWTHKVGNHTGLYSSTVPLFNPDWQTPSFPNIHLKEDIINRCQQYV
KJ803814_Pol_P-C      NVSIPWTHKVGNHTGLYSSTVPLFNPDWQTPSFPNIHLKEDIINRCQQYV
KJ717828_Pol_P-C      KSPIPWTHKVGNHTGLYSSTVPLFNPDWQTPSFPNIHLKEDIINRCQQYV
KJ803815_Pol_P-C      NVSIPWTHKVGNHTGLYSSTVPLFNPDWQTPSFPNIHLKEDIINRCQQYV
KJ717826_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
KJ803813_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
KJ717823_Pol_P-C      NATIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
KJ803811_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
JQ801488_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLKEDIINRCQQYV
KX765852_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLKEDIINRCQQYV
KC315399_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ801482_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIINRCQQFV
JQ429078_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
JQ801515_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQFV
KF214673_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KU051425_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
JQ801491_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQFV
KX765849_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ801486_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
JQ801521_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MG826122_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MF925409_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQFV
JQ027317_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
MF925377_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KY470909_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIITRCQQFV
JQ801523_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MF925394_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KY470916_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIITRCQQYV
KX774504_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
KX774506_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX765830_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
KX765828_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQFV
JQ801520_Pol_P-C      NVSIPWTHKVGNFTGLYSSTLPVFNPDWQTPSFPNIHLKEDIINRCQQYV
MF925376_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KY470936_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX765821_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
FJ023654_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQFV
MF925398_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KY470914_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIITRCQQFV
MF925378_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MF925367_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIVSRCQQFV
KY470908_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIITRCQQFV
KY470906_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIITRCQQFV
KX765842_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX765822_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCEQYV
KX765820_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
MF925387_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KX765826_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KF053176_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MF925405_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCEQFV
MF925395_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
MF925374_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
MF925359_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KY470913_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIITRCQQFV
KY470907_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIITRCQQFV
KX765837_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
KX765832_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWKTPSFPPIHLKEDIINRCQQYV
KX765818_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MH220971_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
MF925406_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KY470917_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIITRCQQFV
KY470912_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIITRCQQFV
KX765843_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQFV
KX765840_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
KX765834_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KX765831_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX765853_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
MG725248_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
MF925410_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
MF925408_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KY470920_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIITRCQQFV
KY470918_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIITRCQQFV
KY470915_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIITRCQQFV
KY470911_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIITRCQQFV
KY470910_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIITRCQQFV
KX765846_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX765838_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
KX765829_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
MF925375_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KX765851_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KX276850_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPXIHLKEDIINRCQQFV
MF925365_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KP148476_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148547_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148483_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148491_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148566_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148513_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148474_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148575_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148567_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148561_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148555_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148537_Pol_P-C      NVSIPWTHKAGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148512_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148465_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148489_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148488_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148487_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148473_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148472_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148477_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148481_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148470_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148475_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148479_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148469_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148482_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148468_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148471_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148480_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148492_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148557_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148526_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148543_Pol_P-C      NVNIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148564_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148563_Pol_P-C      NVSIPWTHKVGNFTGLYSPTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148559_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148558_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148548_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148546_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148560_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148545_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148540_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148531_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWRTPSFPHIHLKEDIINRCQQYV
KP148528_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148521_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQCV
KP148524_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQCV
KP148462_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KP148466_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148315_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148464_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148463_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148520_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148523_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148532_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148535_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148538_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148549_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148570_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148571_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148573_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148568_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148517_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148519_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148525_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148529_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148530_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148551_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148552_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148554_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148562_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148572_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KP148574_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX276844_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
GQ924604_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
JQ801518_Pol_P-C      NVSIPWTHKVGNFTGLYSFTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JN827420_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIINRCQQYV
HM011468_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
GQ358153_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQFV
DQ089803_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KF053183_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KJ803776_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
GQ924650_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
GQ924642_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
FJ023639_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ717802_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSDWQTPSFPHIHLKEDIINRCQQFV
KJ803792_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSDWQTPSFPHIHLKEDIINRCQQFV
HM011491_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCEQYV
FJ023641_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPDIHLKEDIINRCQQYV
FJ023642_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
KJ717811_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ717810_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ803799_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JN827416_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX774503_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ717812_Pol_P-C      NASIPWTHKVGNFTGLYSSTAPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ803800_Pol_P-C      NASIPWTHKVGNFTGLYSSTAPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KU051424_Pol_P-C      NVSIPWTHKVGNFTGLYSSTAPVFNPDWQTPSFPHIHLKEDIINRCQQYV
GQ924629_Pol_P-C      XVSIPWTHKVGNFAGLYSSTVPVFNPDWQTPSFPNIHLKEDILNRCQQYV
JQ801505_Pol_P-C      NVSIPWTHKVGNFTGLYSSSVPVFNPDWQTPSFPQIHLKEDIINRCQQYV
AB300363_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
FJ023658_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
JQ801500_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
KF053167_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
KF053169_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
KJ803759_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
KJ803761_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
AB074755_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
GQ924615_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
KX276847_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIINRCQQFV
KC774228_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQYV
JQ801481_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQYV
JQ801473_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX765827_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIINRCQQYV
KX765836_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIINRCQQYV
JN827417_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIINRCQQYV
FJ023656_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
EU306689_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQYV
EU306691_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQYV
EU306688_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQYV
EU306685_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQYV
EU306687_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQYV
EU306690_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQYV
EU306694_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQYV
KF214676_Pol_P-C      NVNIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
JN827424_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JN827425_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KT987426_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
JQ801522_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
JQ801497_Pol_P-C      NVNIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KT307718_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KT307719_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KU051426_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KU051427_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KT987425_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
JQ801493_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
GQ924612_Pol_P-C      TVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
GQ924613_Pol_P-C      TVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
FJ023648_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KT364718_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KT347089_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
JQ801519_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JN827423_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
GQ924609_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
FJ023645_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCEQYV
AB117758_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ801504_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPAFPHIHLKEDIINRCQQYV
JN827418_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
GQ184326_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
AB247916_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX765848_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX765850_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KU051423_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KT987423_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KF214668_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
JQ801470_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
GQ924616_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KT364719_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KT364720_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
JQ801503_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
JQ801502_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
JN827422_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
JN827421_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
GQ924614_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
FJ023649_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
AB074756_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
JQ341657_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPNWQTPSFPHIHLKEDIINRCQQYV
KC774236_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ801475_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPFFPHIHLKEDIINRCQQYV
KX765844_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPFFPHIHLKEDIINRCQQYV
KX765825_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ801511_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX765833_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ801513_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
GU563561_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
FJ023647_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
AF068756_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
FJ023657_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
GQ924649_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KT366463_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
JQ801496_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KT364721_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KT987424_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
MG826128_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQYV
MG826134_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQFV
MG826137_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQYV
AP011106_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQYV
AP011107_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQRYV
MG826136_Pol_P-C      NVSIPWTHKVGNFTGLYSSSVPVFNSEWQTPSFPDIHLREDIINRCQQYV
MG826133_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQYV
MG826135_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQYV
MG826131_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQYV
MG826132_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQFV
KX276855_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQXPSFPDIHLREDIINRCQQYV
MG826129_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQYV
AB111946_Pol_P-C      NVNIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
MG826140_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQFV
MG826143_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQFV
MG826138_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVCNPDWQTPSFPHIHLKEDIITRCQQFV
MG826139_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQFV
KJ717790_Pol_P-C      NVVIPWTHNVVNFIGVYSSSVAVVNPDGQTPSFPNIHLQEDIINRCQQYV
KJ803779_Pol_P-C      NVVIPWTHNVVNFIGVYSSSVAVVNPDGQTPSFPNIHLQEDIINRCQQYV
AB112472_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
AB105174_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ410515_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
JQ801472_Pol_P-C      NVSIPWTHKVGNFTGLYSSTAPVFNPDWQTPSFPHIHLKEDIINRCEQYV
EU498227_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MG571359_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIIQRCQQYV
KJ717809_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KF053187_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ803780_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KF053177_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ803770_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
AJ748098_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWLTPSFPNIHLKEDIINRCQQYV
FJ023646_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIIDRCQQYV
KF053164_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPNWQTPSFPHIHLKEDIINRCQQYV
KJ803757_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPNWQTPSFPHIHLKEDIINRCQQYV
KX765847_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KX765819_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KX765855_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
HM011472_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MK818227_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ801498_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIIDRCQQYV
GQ924643_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JX870000_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPLFNPDWQTPSFPHIHLKEDIINRCQQYV
EU305540_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ410496_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQYV
DQ089768_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
GQ924636_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
DQ089772_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ410498_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQYV
EU305541_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
DQ089761_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
FJ023643_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
FJ023644_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341622_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIIDRCQQYV
EU305542_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX765845_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
KX765839_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KM875424_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ410489_Pol_P-C      TVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
DQ089757_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
AF223960_Pol_P-C      NVSIPWTHKVGNFTGLYSSTAPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MF674475_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341651_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
DQ089765_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPLIHLKEDIINRCQNYV
MF674514_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341661_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPHIHLKEDIINRCQQYV
FJ349225_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
AF473543_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX276854_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIIBRCQQYV
KM875425_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KC875268_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JX507212_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPQIHLKEDIINRCQQYV
JQ341664_Pol_P-C      NVSIPWTHKXGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
HM011495_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
AF223957_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPHWQTPSFPHIHLKEDIINRCQQYV
KF053173_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ803766_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ410501_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ410513_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KC875264_Pol_P-C      NVSIPWTDKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
GQ358154_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQEYV
KJ717844_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ803826_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KC875272_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KC875267_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KC875273_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRRQQYV
KC875270_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KC875265_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KC875269_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KC875271_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KC875274_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ801501_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
AP011097_Pol_P-C      NVSIPWTHKVGNFTGLYSSTAPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MG826123_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX765823_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JX504535_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDILNRCQQYV
JQ801495_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341654_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341652_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
GQ377536_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
DQ089764_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
AB031262_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIISRCQQYV
MF674463_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MF674435_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MF674399_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ173323_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MF674489_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX765824_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX276852_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ410495_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341650_Pol_P-C      NXSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341616_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ173324_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341618_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MF674471_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
FJ023650_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MF674494_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MF674457_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ410504_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341642_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIIBRCQQYV
JQ341631_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFPHIHLKEDIINRCQXYV
MF674429_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MF674386_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341669_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPHFPHIHLKEDIINRCQQYV
JQ341639_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341644_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341663_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341655_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341653_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MF674486_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341649_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MF674398_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
DQ089758_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341635_Pol_P-C      TVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQFV
KJ410494_Pol_P-C      TVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KJ410492_Pol_P-C      TVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDISNRCQQFV
KJ410491_Pol_P-C      TVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQFV
KJ410499_Pol_P-C      TVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQFV
KJ410511_Pol_P-C      DVSIPWTHRVGNFTGLYSSTVPCFNPEWQTPSFPNIHLQEDIINRCQQYV
AB112063_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPNIHLKEDIINRCQQYV
JQ341614_Pol_P-C      NXNVPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
DQ089771_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KR013787_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KR013927_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KR013935_Pol_P-C      NVSIPWTHKVANFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
AB112065_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQYV
MF674390_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQYV
MF674504_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KR013841_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLREDIINRCQQYV
MF674484_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPNIHLKEDIINRCQQYV
MF674417_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQYV
KR013838_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KR013835_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINGCQQYV
MF674408_Pol_P-C      NVNIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPNIHLKEDIINRCQQYV
KR013839_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KR013836_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KR013837_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KR013840_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MF674467_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQYV
MF674418_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQYV
MF674472_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQYV
MF674454_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQYV
MF674468_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQYV
MF674388_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQYV
MF674412_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIIHRCQQYV
MF674402_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQYV
MF674501_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQYV
KJ717803_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQYV
KJ803793_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQYV
DQ089773_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDCQTPFFPHIHLKEDIINRCQQYV
DQ089766_Pol_P-C      NVNIPWTHKVGNFTGLYSSTVPVFNPDWQTPTFPLIHLKEDIINRCQQYV
KC774227_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ027324_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPHWQTPSFPHIHLKEDIINRCQQYV
DQ089760_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MG571345_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ410518_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX276846_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ801490_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQYV
JQ341626_Pol_P-C      NVSIPWTHKVGNFTGLYSSSVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341613_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLTEDIINRCQKYV
JQ027318_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
DQ089769_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341611_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
DQ089759_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
EF494379_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
DQ089763_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPYIHLKEDIINRCQQYV
AF223958_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341624_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
AF223961_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
DQ089762_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
DQ089770_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KJ410493_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
JX507214_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
MG571332_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
JQ341637_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQFV
KX276851_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQYV
HM011488_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPDWHTPSFPHIHLKEDIINRCQQYV
JQ341621_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWKTPSFPHIHLKEDIINRCQQYV
DQ089785_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCEQYV
AY167099_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIVNRCQQYV
DQ089780_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLKEDIINRCQQYV
MF674430_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQFV
KF053181_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KJ803774_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KJ717822_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KJ803810_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
GQ377605_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
GQ377631_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
DQ089790_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQZXV
DQ089788_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIIBRCQQYV
AB246346_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KR013857_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQFV
KR013855_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQFV
KR013854_Pol_P-C      NVSIPWTHKVGNSTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQFV
KR013856_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQFV
KJ410514_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KF053185_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQYV
DQ089778_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLKEDIINRCQQYV
JQ027320_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIIERCQQYV
DQ089787_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
DQ089776_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
DQ089777_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
MF674425_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQYV
MF674458_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQYV
KR013820_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIIKRCQQYV
JX507211_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
JQ341619_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQFV
JQ341612_Pol_P-C      SVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
JQ027321_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
DQ089789_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KR013823_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSLPHIHLKEDIINRCQQYV
GQ924655_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
MF674428_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPNIHLKEDIINRCQQYV
DQ089783_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KR013826_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIIKRCQQYV
KM875428_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQFV
KJ173285_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
DQ089791_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
DQ089775_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KR013825_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KR013824_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
AF223954_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWKTPSFPHIHLKEDIINRCQQYV
AF223956_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
AF223959_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
AF223955_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
DQ246215_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQFV
MF674403_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQDYV
KJ410519_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KJ173286_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCZQYV
JQ341630_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
JQ341620_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPVFPHIHLKEDIINRCQQYV
JQ027333_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
FJ023653_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
AB205125_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
MF674502_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KX276841_Pol_P-C      NASIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDLINRCQQYV
KX276840_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPXIHLKEDIINRCQQYV
KR013822_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KR013821_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
JQ040133_Pol_P-C      NVSIPWTHKVGNFTGLYSSSVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
EF688062_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
DQ089786_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLKEDIINRCQQYV
DQ089779_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
JQ341628_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQPPSFPHIHLKEDIINRCQQFV
DQ089792_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
JQ341641_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
MF674444_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPTFPHIHLKEDIINRCQQYV
DQ089782_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIVNRCQQYV
MF674474_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIVNRCQQYV
AB105173_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
MF674442_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPRIHLKEDIINRCQQYV
KX276853_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
HM011497_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KR013899_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
JQ341659_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
JQ341615_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
DQ089781_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
MG571335_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWXTPSFPHIHLXEDIINRCQQYV
JQ688403_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
KM875405_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPAFPHIHLKEDIINRCQQYV
KM875404_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPAFPHIHLKEDIINRCQQYV
JQ341647_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPRIHLKEDIINRCQQYV
JQ341633_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIIDRCQQYV
JQ341617_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KM875406_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
HM011486_Pol_P-C      BVSIPWTHKVGNFTGLYSSTXPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KR013905_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KR013902_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
DQ089784_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KR013770_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KR013900_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KC774351_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQFV
AB493839_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQYV
AB493844_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700574_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700570_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIIDRCQQYV
HQ700563_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700562_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700504_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700568_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPKWQTPSFPDIHLKEDIINRCQQYV
HQ700573_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700564_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700556_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700545_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700502_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700565_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
KC793046_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPXWQTPSFPNIHLHEDIINRCQQYV
HQ700575_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPDIHLKEDIINRCQQYV
HQ700495_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700496_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700544_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700566_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700572_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700559_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700561_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700555_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700558_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700569_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700457_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700490_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700567_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700456_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
HQ700475_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
KU963904_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPAWQTPSFPHIHLQEDIINRCQQYV
KU963900_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPAWQTPSFPHIHLQEDIINRCQQYV
KU963901_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPAWQTPSFPHIHLQEDIINRCQQYV
KU963902_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPAWQTPSFPHIHLQEDIINRCQQYV
KU963903_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPAWQTPSFPHIHLQEDIINRCQQYV
KU963905_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPAWQTPSFPHIHLQEDIINRCQQYV
KU963906_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPAWQTPSFPHIHLQEDIINRCQQYV
KU963907_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPAWQTPSFPHIHLQEDIINRCQQYV
KU963908_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPAWQTPSFPHIHLQEDIINRCQQYV
KU963909_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPAWQTPSFPHIHLQEDIINRCQQYV
KU963910_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPAWQTPSFPHIHLQEDIINRCQQYV
KU963911_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPAWQTPSFPHIHLQEDIINRCQQYV
KU963912_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPAWQTPSFPHIHLQEDIINRCQQYV
KU963913_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPAWQTPSFPHIHLQEDIINRCQQYV
KU963914_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPAWQTPSFPHIHLQEDIINRCQQYV
KF495606_Pol_P-C      NVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFPHIHLQEDIINRCQQYV
HQ700529_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQYV
KJ717821_Pol_P-C      DVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIIDRCQQYV
KJ803809_Pol_P-C      DVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIIDRCQQYV
EU939601_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPKIHLHEDIINKCEQYV
AB670273_Pol_P-C      TVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQFV
KC792831_Pol_P-C      NVSIPWTHKVGNFTGLYSSKVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KC792759_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIBRCQQYV
HQ700516_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQYV
GQ377555_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLQEDIIDRCQQYV
AB367417_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLREDIINRCQQYV
KJ598672_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598678_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598662_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598674_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598676_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598663_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598665_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598666_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598667_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598668_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598664_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598669_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598670_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598671_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598673_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598677_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598731_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KU964229_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598722_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598728_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KU964234_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KU964241_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598739_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598724_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598732_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598733_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KU964239_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598725_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KU964237_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598736_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598727_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KU964235_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598734_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598729_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598723_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598721_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598730_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598737_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KU964230_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KU964242_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598720_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KU964238_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KU964243_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598726_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KU964236_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598735_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KJ598738_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KU964231_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KU964232_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KU964233_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KU964240_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
KY629637_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPQIHLQEDIINRCQQYV
KC774235_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KY363260_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIIDRCQQYV
KC774240_Pol_P-C      NVSIPWTHKGGNFTGLYSSTEPAFNPEWQTPSFPHIHLQEHIFNRCQQYV
HM011493_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQYV
FJ787441_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIINRCQQYV
FJ787439_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIINRCQQYV
FJ787479_Pol_P-C      NVSIPWTHKVGNFAGLYSSTVPVFNSEWQTPSFPHIHLQEDIINRCQQYV
HQ700517_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KY470987_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLREDIIDRCQQYV
KY470985_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KY470983_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KY470990_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KY470991_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KY470986_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KY470980_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KY470981_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KY470982_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KY470984_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KY470988_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KY670782_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
MG826127_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KY629631_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KC774189_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQFV
JX504537_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KC774335_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQFV
JX661489_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KR013778_Pol_P-C      NVSIPWTHKVGNFTGLYSSSVPVFNPEWQTPSLPHIHLQEDIINRCQQYV
DQ089796_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KC792710_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIIDRCQQYV
KC774340_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLREDIINRCEQYV
JQ040166_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KR013860_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KR013859_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KR013861_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
MG826126_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KF779242_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQYV
JN315779_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQYV
EU939617_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
AB485810_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLQEDIINRCQQYV
AB014396_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KM875423_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQYV
KR013786_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIIDRCQQYV
JX661491_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNSEWQTPSFPQIHLQEDIIDRCQQYV
JX026878_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVLVFNSEWQTPSFPHIHLQEDIIDRCQQYV
JX026877_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
HM750136_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQFV
HM750134_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQFV
EU939659_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KX276836_Pol_P-C      BVSIPWTHKVGNFTGLYSSTVPVFNPEWQXPSFPHIHLXEDIINRCQQYV
KC792902_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KC774348_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KC774181_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
FJ386679_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
EU939585_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
AB111124_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
AB111125_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
AB246344_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KF485390_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
JQ040144_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
HM011500_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
FJ899777_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPYIHLQEDIINRCQQYV
EU939592_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
AB198081_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQFV
MG826124_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KX276838_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KC774268_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLHEDIINRCQQYV
KC792999_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964324_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KU964332_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KU964323_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KU964333_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KU964328_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KU964322_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KU964330_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KU964318_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KU964319_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KU964320_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KU964321_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KU964325_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KU964326_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KU964327_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KU964329_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KU964331_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KR013762_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
JQ040165_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLHEDIINRCQQYV
FJ562291_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KF053170_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KJ803762_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KR013785_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIIDRCQQYV
KC774316_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KC774247_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
HM750132_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIINRCQQYV
GQ377523_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLKEDIIDRCQQYV
EU939590_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
EU939591_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KJ173327_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KJ173328_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KC793024_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KC774276_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLHEDIINRCQQYV
JQ341634_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNXEWQTPSFPHIHLQEDIIBRCQQYV
GQ377600_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
AB971715_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
AB675677_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KJ173433_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQYV
KJ173434_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQYV
KR013813_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KR013784_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIIDRCQQYV
KR013783_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIIDRCQQYV
JQ027322_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
HM750131_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
AB971714_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
DQ993692_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
LC279249_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
LC279248_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
LC279247_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
LC279246_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KR013810_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KJ173316_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
JQ341643_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
DQ993691_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
JQ688404_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KR013812_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
JX504536_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
JQ027323_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
HM011479_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLXEDIINRCQQYV
KX276837_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLXEDIINRCQQYV
KY022423_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIIDRCQQYV
KR013811_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KJ803765_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KC792862_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KF053172_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KJ598639_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KJ173442_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KJ173426_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KR013814_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KC792799_Pol_P-C      NVSIPWTHXVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
V00867_Pol_P-C        NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KC774191_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQFV
FJ386626_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KR013847_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQYV
KR013849_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQYV
KR013844_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQYV
KR013842_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQYV
KR013845_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQYV
KR013848_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQSPSFPHIHLQEDIINRCQQYV
KF053184_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLQEDIINRCQQYV
KJ803777_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLQEDIINRCQQYV
EU939539_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLHEDIINRCQQYV
AB931170_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
AB931171_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
AY057947_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIITRCQQYV
GQ358158_Pol_C-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQFV
FJ386607_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
FJ386631_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLKEDIIHRCQQFV
AB670259_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQYV
KC792880_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964020_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964021_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964022_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964023_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964024_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964025_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964026_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964028_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964029_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964030_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964031_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964032_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964033_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964027_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
DQ089801_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
FJ562298_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
X75665_Pol_P-C        NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQYV
KF214655_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCEQYV
FJ562304_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
DQ089802_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPHIHLQEDIINRCQQYV
AY167091_Pol_P-C      NVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQYV
AB900109_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964049_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964050_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964051_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964052_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964053_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964054_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964055_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964056_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964057_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964058_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964059_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964061_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964062_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964063_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KU964060_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
EU939654_Pol_P-C      NGSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPHIHLQEDIINRCQQYV
EU871978_Pol_P-C      NVSIPWTHKVGNFTRLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQYV
EU871979_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQYV
FJ386624_Pol_P-C      NVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFPHIHLQEDIINRCQQFV
GQ372968_Pol_P-C      NVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFPHIHLQEDIINRCQQFV
MK321266_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
GQ377616_Pol_P-C      NVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFPHIHLQEDIINRCQQYV
EU939651_Pol_P-C      NVNIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIINRCEQYV
EU919164_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
JF828916_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIIDRCQQYV
JF828919_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIIDRCQQYV
JF828918_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIIDRCQQYV
JF828913_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIIDRCQQYV
JF828915_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIIDRCQQYV
JF828917_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIIDRCQQYV
EU562216_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
EU562215_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
EU562217_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQGDIINRCQQYV
EU871975_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
EU871977_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KR819180_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQYV
KC774269_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQYV
KC774265_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPRIHLQEDIIDRCQQYV
FJ562221_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCEQYV
EU882005_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
GQ377620_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
EU939594_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIINRCQQYV
EU554540_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPTFPHIHLQEDIIDRCQQYV
FJ787449_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
FJ386611_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
AB113878_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
AB195930_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
AB195931_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
AB195932_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
FJ899789_Pol_P-C      NVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFPNIHLQEDIINRCQQYV
FJ787442_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
FJ787443_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
GQ377601_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
GQ377577_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KC774225_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
AB198082_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
JX429914_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
JX026888_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIIDRCQQYV
EU939582_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
FJ899788_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQYV
EU939588_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
EU939569_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
FJ562238_Pol_P-C      NVSIPWTHKVGNFTGLYSSSVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
FJ562282_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
FJ386652_Pol_P-C      NVSIPWTHKVGNFTGLYSSSVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
EU939615_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
EU916225_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
JX560519_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KC774194_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQYV
EU939613_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
FJ386671_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQFV
FJ562232_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
EU916219_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQYV
EU916222_Pol_P-C      NASIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLKEDIINRCQQYV
EU939653_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KM229703_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KC774242_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
GQ377572_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
FJ386678_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
EU939572_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
FJ386588_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
AB367420_Pol_P-C      NVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
HQ622095_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
EU306674_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIIDRCQQYV
EU306673_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIIDRCQQYV
EU306675_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIIDRCQQYV
EU916223_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQFV
JX560520_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQFV
KC774356_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIINRCQQYV
GQ475309_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQYV
AB670270_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
FJ787468_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
FJ787469_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
EU939550_Pol_P-C      NVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCEQFV
EU939536_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQFV
KY470875_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
FJ562306_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQYV
KY470879_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
EU939597_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KY470885_Pol_P-C      NVGIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KY470873_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KY470890_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSLPHIHLQEDIINRCQQCV
KY470874_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
GQ377540_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIIDRCQQFV
KY470892_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
GQ475332_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIERCQQYV
KJ173283_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KJ173284_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KY470891_Pol_P-C      NVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQYV
KR013850_Pol_P-C&