HBVdb

Dataset for protein HBSP of genotype D

[Download (right click)] [Edit] [Sequences] [Repertoires]

1014 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


JN040804_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN--LNL
JN257177_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNNINXL
X65258_HBSP_P-D        MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNEQ
DQ486023_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLEDEGLNRRVAEDLNLGN-LNDL
DQ336685_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LLDP
DQ464174_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
DQ464172_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLQEELPHLADEGLNRRVAEDLNLRN-LTDP
DQ336686_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
DQ336687_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
DQ336688_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
DQ336692_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
AY236164_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELSHLADEGLNRRVAEDLNLGN-LNDP
DQ486022_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELSHLADEGLNRRVAEDLNLGN-LNDP
AB270537_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
AY236160_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
DQ336674_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
DQ336675_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
DQ336676_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
DQ336677_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
DQ336678_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
DQ336679_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
DQ336690_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
DQ464176_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
DQ464177_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
DQ464178_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
DQ486021_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
JN688710_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADQGLNHRVAEDLNLGD-LNDH
MK052963_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
MK052966_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
MK052971_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRPADEGLNRRVAEDLNLGN-LNDP
MK052947_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDHNLGN-LNDP
MK052948_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
MK052951_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
MK052954_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
MK052949_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDFNLGN-LNDP
MK052950_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
MK052959_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
MK052974_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADDGLNRRVAEDLNLGN-LNDP
MK052972_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDH
MK052973_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDH
MK052975_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDH
MK052952_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
MK052953_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
MK052955_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
MK052956_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
MK052958_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
MK052960_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
MK052961_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KP090180_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
JN688712_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLTLGT-LNDP
JN688695_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPIEEELPRLADEGLNRRVAEDLNLGN-LNDP
JN664919_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
JN040818_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
JN040755_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LTDP
JN040752_HBSP_P-D      MPLSYQSFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDH
EU939680_HBSP_P-D      MPLSYQHFRRLLLLDNEAGTLEEELPRLADEGLNRRVAEDLNLGN-LNDP
EU921419_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGN-PNDP
EU921418_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGN-LNDP
DQ336689_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELSHLADEGLNRRVAEDLNLGN-LNDP
AY233296_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDP
DQ486025_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGN-LNDP
AB493846_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGN-LNDP
HQ236015_HBSP_P-D      MPLSYQHFRRLVLLDDDAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
KU736926_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KU736927_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
JN040808_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRIAEDLNLGN-LNDL
JF754603_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
FJ904433_HBSP_C-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGN-XNDL
AB270539_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
AY233291_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
AY233292_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
AY233294_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
DQ464173_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
DQ464175_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KP090179_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPQEEELPRLADEGLNRRVAEDLNLGN-LNDP
KF679998_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KC875324_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPPEEELPRLADEGLNRRVAEDLNLGN-LNDP
JN688683_HBSP_P-D      MPLSYQHFRRLVLLNNKAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
JN664920_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
JN257190_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNLRVAEDLNLGN-LNDL
JF754632_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
JF754606_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
HM750151_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
GQ922001_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KT366507_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
KT366497_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
KF679993_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
KF679992_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
KF679990_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGD-PNDP
JN688711_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPVEEELPRLADEGLNRRVAEELNLGN-LNDP
HQ236014_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDP
JN257160_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRXVAXDLNLGN-LNDL
JN257161_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRXVAXDLNLGN-LNDL
EU414141_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLXDEGLNRRVAEDLNLGN-LNDP
EU414142_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KX196235_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
X97849_HBSP_P-D        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDP
X65257_HBSP_P-D        MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
LT992454_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
LT992438_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KX196225_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KX196224_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KT749821_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEELHLGN-LNDP
KT347090_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KP090181_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLRN-LNDP
KM519455_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KF779214_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KF679996_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KF679994_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KF679989_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KC875331_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KC875330_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KC875329_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KC875328_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KC875326_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KC875325_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KC875323_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KC875322_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KC774460_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDP
KC774437_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KC774436_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
JX898694_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
JN688708_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDP
JN688685_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
JN688679_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
JN642126_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
GQ922002_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
GQ922000_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGN-PNDP
GQ183478_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDP
GQ183473_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDP
FJ692507_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
FJ692506_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
FJ562338_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
FJ349232_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
EU594434_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
EU414143_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRXAEDLNLGN-LNDP
EU594382_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
DQ336682_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGK-LNDL
DQ336680_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGK-LNDL
DQ336684_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGK-LNDL
DQ336681_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGK-LNDL
GU456674_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEDELPRLADEDLNRRIAEDLNLGD-LNDL
AY090452_HBSP_P-D      MPLSYQHFRSVLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGK-LNDP
JN642133_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDH
JN688713_HBSP_P-D      MPLSYQHFRRLLLLDEKAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDP
JN040784_HBSP_P-D      MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456639_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPIEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY090453_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB330367_HBSP_P-D      MPLSYQCFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040772_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAENLNLGN-LNDH
JN040767_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGH-LNDL
JF754629_HBSP_P-D      MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
GU456654_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGT-PNDR
GU456652_HBSP_P-D      MPLSYQCFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB119254_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456675_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754624_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040768_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257182_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257200_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
JN040782_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGN-PDDL
GU456672_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ167301_HBSP_P-D      MPLSYQHFLRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGT-LNDL
GQ167302_HBSP_P-D      MPLSYQHFLRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGT-LNDL
GQ184322_HBSP_P-D      MPLSYQHFLRLLLLDEEAGPLEEELPRLADEGLDRRVAEDLNLGT-LNDL
AY741794_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAQDLNLGD-LNDL
AY741795_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAQNLNLGD-LNDL
AY741796_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAQNLNLGD-LNDL
KF922432_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
JN642157_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLHLGD-LNDL
JN642153_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040773_HBSP_P-D      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLHLGD-LNDL
JN040766_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRLVAEDLNLGK-LNDL
JN040760_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040758_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754626_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGT-LNDL
JF754617_HBSP_P-D      MPLSYQCFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
JF754598_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456681_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183448_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGI-LNDL
FJ904427_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ349235_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
AB270541_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
AB674405_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
KP168419_HBSP_P-D      MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
KF471654_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
JQ927384_HBSP_P-D      MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
JN040774_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
JN040750_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
JF754604_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
HQ700439_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-PNDL
GU456671_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
GU456670_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
FJ904438_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-PNDL
FJ349220_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
EU787443_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
AF121242_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
AF121241_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
AF121240_HBSP_C-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
AB674415_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-PNDL
AF121239_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
JF754611_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456678_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNGL
JN792907_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADQGLNRRVAEDLNLGN-LNDL
JN792908_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADQGLNRRVAEDLNLGN-LNDL
JN257165_HBSP_P-D      MPLSYQHFRRLLFLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-PNDL
JN257166_HBSP_P-D      MPLSYQHFRRLLFLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-PNDL
KM606754_HBSP_P-D      MPLSYQHFRSVLLLDDEAGPLQEELPRLADEDLNRRVAEYLNLGN-HNDH
JN040820_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
JN040814_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
JN040822_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-PNDL
JN040810_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ922005_HBSP_P-D      MPLSYPHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGT-LNDH
GQ205380_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGT-LNDL
EF103277_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
AB674420_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB674417_HBSP_P-D      MPLSYQHFRRLLLLDQEAGPLEEELPRLADEGLNRRVADDLNLGN-LNDL
AB674418_HBSP_P-D      MPLSYQHFRRLLLLDQEAGPLEEELPRLADEGLNRRVADDLNLGN-LNDL
AB104712_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY721612_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ349233_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456638_HBSP_P-D      MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040826_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642142_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC774444_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB048701_HBSP_P-D      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDH
AJ627219_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDH
FJ692533_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDH
GQ922003_HBSP_P-D      MPLSYPHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDH
GQ922004_HBSP_P-D      MPLSYPHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDH
HQ700458_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-PNDH
KM606744_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDH
FJ692532_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPXLADEDLNRRVAEDLNLGN-LNDH
KM606752_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAENLNLGN-LNDH
KU736924_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDH
KU736925_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDH
KY629633_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KM524342_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF170739_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EU594407_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594427_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
FJ904426_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AJ627220_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
AB674424_HBSP_P-D      MPLSYQLFRRLLLLDPEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB674411_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LTDL
AB119255_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AJ344116_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EU594396_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
JN257150_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257170_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257171_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB109479_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGN-LNDL
AJ627222_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADXDLNHRVAEDLNLGN-LNDL
EU594398_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGN-LNDL
KT366494_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707497_HBSP_P-D      MPLSYQQFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642147_HBSP_P-D      MPLSYQHFPRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
DQ336683_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB188244_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
X80926_HBSP_P-D        MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGN-LNDL
X80924_HBSP_P-D        MPLSYQHFRRLVLLDNEAGPLEEELPRLADEDLNHRVAEDLNLGN-LNDL
MF618349_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KT366499_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KM577671_HBSP_P-D      MPQSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KJ470895_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LTDL
KF471645_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LTDL
KF471641_HBSP_P-D      MPLSYQHFRRLLCLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875279_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642162_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDL
JN642159_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDL
FJ349218_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707689_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257186_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KJ470896_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF471646_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875292_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707487_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257167_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
X72702_HBSP_P-D        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
MH932714_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
MF925393_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
MF925379_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
MF925364_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
MF925363_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
MF925358_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
M32138_HBSP_P-D        MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRHVAEELNLGN-LNDL
LT992444_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
LT992439_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KX827301_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-PNDL
KX827291_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KX827290_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-PNDL
KX276857_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-XNDL
KX260231_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
KX196236_HBSP_P-D      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KX196228_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KX196227_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KX196215_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KX196212_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KX196211_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KX196209_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KX196208_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KU668449_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KT749828_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLANEDLNRRVAEDLNLGN-LNDL
KT749827_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
KT366511_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KT366510_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KT366509_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KT366506_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KT366496_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KT366495_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KT366493_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KT366491_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KT151620_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KR905424_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KR905423_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KP322601_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KP322600_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KP322599_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KM577669_HBSP_P-D      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-PNDL
KM577668_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-PNDL
KM524356_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KM524355_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KM524354_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KM524353_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KM524352_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KM524351_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KM524347_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KM524344_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KM524341_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KM524338_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KJ470894_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KJ470893_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF779220_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-PNDL
KF679997_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF679995_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF471660_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF471658_HBSP_P-D      MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF471657_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF471653_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNEL
KF471644_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF061169_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875312_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875309_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875308_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875307_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875306_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875301_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875299_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875297_HBSP_P-D      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875296_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875295_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875294_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875293_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875290_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875289_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875288_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875287_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875286_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875283_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC875277_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JX096958_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
JX096957_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
JX096956_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
JX096954_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
JQ707706_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707705_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707704_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707703_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707702_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707701_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707700_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707699_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707698_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707697_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707696_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707695_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707694_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707693_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707692_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707691_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707690_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707688_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707687_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707686_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707685_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707684_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707683_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707682_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707530_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707529_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707528_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707527_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707526_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707525_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707524_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707523_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707522_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707521_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707520_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707519_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707518_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707517_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707516_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707515_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707514_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707513_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707512_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707510_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707508_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707507_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707505_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707504_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707503_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707502_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707501_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707500_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707499_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707496_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707495_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707494_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707493_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNEL
JQ707492_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707490_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707489_HBSP_P-D      MPLSYRHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707488_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707486_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707485_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707484_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707483_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707482_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707481_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707480_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707479_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707478_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707477_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707476_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN664941_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN664939_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN664930_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN664928_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN664927_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642167_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRHVAEELNLGN-LNDL
JN642163_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNEL
JN642149_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642144_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642143_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642131_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257214_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257215_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KJ470889_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY161150_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
AY161151_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
AY161152_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
AY161153_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
AY161154_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
AY161155_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
AY161156_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
HQ700478_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700553_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
X59795_HBSP_P-D        MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB270547_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB222711_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGN-LNDR
AB126581_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642156_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGN-LNDR
JN257163_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642155_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HM750155_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
HM750156_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
AB270549_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB246348_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EU787437_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040775_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EF103275_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700468_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY945307_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLANEGLNRRVAEDLNLGN-LNDR
EU939681_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
FJ899792_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
KC774477_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
KY629630_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
AY741797_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAENLNLGN-LNDL
KF061167_HBSP_P-D      MPLSYXHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB246347_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KT366498_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KT366500_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KT366501_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KT366502_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB270550_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-PTDL
GQ183470_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LTDL
GU456657_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LTDL
HQ700472_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-PTDL
HQ833468_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LTDL
MF925391_HBSP_P-D      MPLSYQHFRSVLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KM524348_HBSP_P-D      MPLSYQLFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN792912_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEQELPRLADEGLNRRVAEDLNLGN-LNDL
JN792911_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEQELPRLADEGLNRRVAEDLNLGN-LNDL
JN642148_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDL
JN642128_HBSP_P-D      MPLSYQHFPRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754630_HBSP_P-D      MPLSCQHFRRLLLLDNESGPLEEELPRLADEGLNRRVAEDLNLGN-PNDL
JF754590_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HM750152_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEKELPRLADEGLNRRVAEDLNLGN-LNDL
FJ386590_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700454_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EU594433_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
AB104710_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB222712_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN792904_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN792906_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KM606753_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB104709_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754601_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KY629634_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVADELNLGN-LNDL
KC774445_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLANEGLNRRVAKDLNLGN-LNDL
HQ700455_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLAXEGXNXRVAKDXNXGN-LNDL
EU787445_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB222709_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB270540_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-PNDL
AB270542_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB270543_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB270548_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB583680_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
LC365689_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KX827300_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KT366508_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KP995100_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF061168_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC774462_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN792910_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN792909_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN792903_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN664931_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642166_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGN-LNDL
JN642164_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642158_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642150_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257211_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257185_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257179_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257176_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-VNXL
JN040830_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040794_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040792_HBSP_P-D      MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040791_HBSP_P-D      MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040781_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040780_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040751_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ833471_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ833470_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ833469_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ833465_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700489_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700488_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700487_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700484_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700483_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700482_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700481_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700480_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700479_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700477_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700474_HBSP_P-D      MPLSYHHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700473_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700471_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700470_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700469_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700467_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
HQ700466_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700464_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700463_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-PNDL
HQ700459_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700451_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700450_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700449_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700448_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700447_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700446_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700445_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700444_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700443_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700442_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700441_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700440_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HM750154_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HM750153_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU357846_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ377589_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183481_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183480_HBSP_P-D      MPLSYRHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183469_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183468_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183467_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183466_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183465_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183464_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183463_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183462_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183461_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183460_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183459_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183458_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183457_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183456_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183455_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183454_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183453_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183452_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183451_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183450_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183449_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ349230_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EU919197_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EU787447_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EU787446_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EU787442_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EU787441_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EU787440_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EU787439_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEDLPRLADEGLNRRVAEDLNLGN-LNDL
EU787438_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EU787436_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EU594397_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EU414135_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EF103281_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EF103280_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
DQ464181_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB674404_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AF280817_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KJ647352_HBSP_P-D      MPLSYQXFRRLLLLDDESGPLEEELPRLADEDLNRRVADDLNLGN-LSDL
JX310733_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF192830_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF192831_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF192832_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF192834_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
MF618348_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KM524358_HBSP_P-D      MPLSYQHFRRLLLLDDESGPLEEELPRLADEGLNRRVAEDLNLGT-LNDL
JN040802_HBSP_P-D      MPLSYQHFRRLLLLEDDAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
GQ477454_HBSP_P-D      MPLSYQHFRNVLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
JN257148_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDH
AB555496_HBSP_P-D      MPLSYQHFWRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LYDL
AB674435_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642134_HBSP_P-D      MPLSYQHFRRLLLLDAESGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ904415_HBSP_P-D      MPLSYQHFRSILLLDDEAGPLEEELPRVAVEGVNRRVAEDLNLGN-LNDL
AB222710_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040797_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040817_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257183_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KX276856_HBSP_P-D      MPLSYQHFRSVLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGT-LNDL
KT749823_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
KF584160_HBSP_P-D      MPLSYXRFRXLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-XNDL
KF584161_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF584162_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF584163_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF584164_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF584165_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF584166_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KY382412_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KY382414_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040812_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040807_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040796_HBSP_P-D      MPLSYQRFRSVLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
JN040788_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040765_HBSP_P-D      MPLSYQYFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754612_HBSP_P-D      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEDLNRRVADDLNLGT-LNDL
JF754599_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
JF754623_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
JF754593_HBSP_P-D      MPLSYQHFRRLLFLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456651_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LHDL
GU456647_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDVNLGN-LNDL
GU456643_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456641_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LTDL
GU456640_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754610_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456637_HBSP_P-D      MPLSCQHFRRLVLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ477456_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADQDLNRRVAEDLNLGN-LNDL
FJ349219_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
FJ349213_HBSP_P-D      MPLSYQHFRRLVLLDNDTGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
EU414136_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY721607_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
AY161157_HBSP_P-D      MPLSYQHFRRPLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB674431_HBSP_P-D      MPLSYHHFRRLVLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB674423_HBSP_P-D      MPLSYQHFRSVLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGT-LNDL
AB674419_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGT-LNDL
AB674416_HBSP_P-D      MPLSYQHFRRVLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-PNDL
AB555497_HBSP_P-D      MPLSYQHFWRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB210821_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAKDLNLGN-LNDL
AB210822_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAKDLNLGN-LNDL
AB210820_HBSP_P-D      MPLSYQHFRRLLLLEDESGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
AB267090_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ904435_HBSP_P-D      MPLSYQHFRRLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456679_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
X85254_HBSP_P-D        MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDP
KX357622_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGT-LNDL
KM577670_HBSP_P-D      MPLSYQYFRRLVLLDNDAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
JN642165_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642135_HBSP_P-D      MPLSYQHFRRLLLLDNNAGPLEEELPRLADEGLNRRVAEDLSLGN-LNDL
JN642132_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LTDL
JN257203_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040778_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADAGLNRRVAEDLNLGN-LNDL
HQ236016_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDL
GU456673_HBSP_P-D      MPLSYQHFRRLLLLEDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ904424_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDL
AY721606_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB555501_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LTDL
DQ111986_HBSP_P-D      MPLSYQHFRRLVLLDXDAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
FJ562309_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB674403_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ477457_HBSP_P-D      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
GU456669_HBSP_P-D      MPLSYQHFRRLLLLDPDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700510_HBSP_P-D      MPLSYQHFRRLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040783_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040785_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707491_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPVEEELPRLADEGLNRRVAEDLNLGN-LNDL
MF925390_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
MF925383_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KM524346_HBSP_P-D      MPLSYQHFRRLLLLDDKAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF471642_HBSP_P-D      MPLSYQHFRRLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707511_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707509_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707506_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JQ707498_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257178_HBSP_P-D      MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ833466_HBSP_P-D      MPLSYQHFRRLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ833467_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ904402_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGVNRRVAEDLNLGN-XNDL
AB078031_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB078033_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB090268_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB090269_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB090270_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB109475_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB109476_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB109477_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB109478_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB110075_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB116266_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB119251_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB119252_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGN-LNDL
AB119253_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGN-LNDL
AB119256_HBSP_P-D      MPLSYHHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-PNDL
AB120308_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGN-LNDL
AB188242_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
AB205126_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB205127_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB205128_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
AB330369_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
AB330370_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
AB471856_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB471857_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB674406_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB674407_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB674408_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB674409_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AF043593_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
AF043594_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
AJ627223_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AJ627224_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY161159_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY161160_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY721605_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY721610_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY721611_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY796031_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY796032_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EF103276_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
EF103279_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLANEGLNRRVAEDLNLGN-LNDL
EU414138_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594399_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594400_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594401_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594402_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594403_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU414139_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEEXPRLADEDLNRRVAEDLNLGN-LNDL
EU594404_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594405_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594408_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594409_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594410_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594411_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594412_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594413_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594414_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594415_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594416_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594417_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594418_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594419_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594420_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594421_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594422_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594423_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594424_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594425_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594426_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594428_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594429_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594430_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594431_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
EU594432_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
FJ349205_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
FJ349206_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLHLGN-LNDL
FJ349215_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ349216_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ349217_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ349228_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ349229_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ349234_HBSP_P-D      MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ904395_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ904412_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ904418_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ904420_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ904421_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ904422_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ904399_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLAXEGXNRRVAEDLNLGN-LNDL
FJ904429_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ904431_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ904439_HBSP_P-D      MPLSYQHFRRLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ904443_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ904445_HBSP_P-D      MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183471_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183472_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183474_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183475_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEKLPRLADEGLNRRVAEDLNLGN-LNDL
GQ183476_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183477_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183479_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183482_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183483_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183484_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ183485_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ477452_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
GQ477455_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
GQ477458_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ924652_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456635_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
GU456653_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456655_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456656_HBSP_P-D      MPLSYQHFRRLLLLDDESGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
GU456658_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456659_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456660_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456661_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456662_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456663_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456664_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456667_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456668_HBSP_P-D      MPLSYRHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456676_HBSP_P-D      MPLSYHHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456677_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456680_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456683_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700511_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700512_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700513_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
HQ700514_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754588_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
JF754592_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754594_HBSP_P-D      MPLSYQHFRRLLLLDDESGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754597_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
JF754605_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754615_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754621_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
JF754622_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754627_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754628_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754631_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGN-LNDL
JF754634_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754635_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-PNDL
JN040754_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040756_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040757_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040759_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040761_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040762_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040769_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040770_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040771_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040776_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-PNDL
JN040779_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040786_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040790_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040819_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040821_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-PNDL
JN040824_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAENLNLGN-LNDL
JN257151_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257153_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257159_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-XNDL
FJ904446_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB078032_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
AB104711_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
AB188241_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDR
FJ904410_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
GU456684_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
JF754600_HBSP_P-D      MPLSYQHFRRLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
JF754609_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
FJ904419_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456665_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456666_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AJ627215_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LTDL
AJ627216_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LTDL
AJ627218_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LTDL
FJ349208_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LTDL
FJ904432_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LTDL
JN040777_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LTDL
JN040811_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LTDL
AB555500_HBSP_P-D      MPLSYQHFRRLLLLDXEAGPLEEELPRLADEDLNRRVAEDLNLGT-PNDL
GQ477453_HBSP_P-D      MPLSYQHFRRLLLLDAEAGPLEEELPRLADEDLNRRVAEDLNLGT-PNDL
KC875340_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGT-LNDL
KC875341_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGT-LNDL
KJ647355_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LTDP
KF053178_HBSP_P-D      MPLSYQRFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC774440_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGN-LNDL
JQ687530_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLKEELPRLANEDLNRRVAKDLNLGN-LNDL
JN642161_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642145_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGRHRRVAEDLNLGN-LNDL
JN642129_HBSP_P-D      MPLSYQHFRRLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040816_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGN-LNDL
JF754619_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGT-LNDL
JF754595_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LTDL
AB674425_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEDELPRLADEGXNRRVAEDLNLGN-LNDL
JN040800_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LDDL
JN040801_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LDDL
AB674413_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB674426_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AF151735_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY161158_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGN-LNDL
AY373431_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY661792_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AB674422_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGXNRRVAEDLNLGN-LNDL
AY661793_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY721609_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY741798_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAENLNLGN-LNDL
AY796030_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
DQ315778_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
FJ349231_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GQ477459_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456636_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456642_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-PNDL
GU456644_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456646_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456648_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456649_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
GU456650_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754591_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
JF754596_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754602_HBSP_P-D      MPLSYQHFRRLLLLDHEAGPLEEELPRLADEDLNRRVAEDLNLGN-PNDL
JF754608_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JF754633_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040793_HBSP_P-D      MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040799_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040805_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040806_HBSP_P-D      MPLSYQHFRRLLLLDDETGSLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040809_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040813_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
JN040815_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040823_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040827_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040828_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN040829_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257149_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257152_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257155_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
AY721608_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642136_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642154_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGT-LNDL
GU456645_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LTDL
AB674428_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-PDDL
AB222713_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDH
AB674427_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-PNDL
JF754607_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
JN040795_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLHLGD-LNDL
JN257201_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-LNDL
KF471640_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGD-PNDL
KM524339_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LDDL
KF471647_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
Z35716_HBSP_P-D        MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
Y07587_HBSP_P-D        MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
X97848_HBSP_P-D        MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLWN-LNDH
X02496_HBSP_P-D        MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KX357639_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDH
KX357638_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDH
KX357637_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDH
KT963508_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KJ647350_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
KF779382_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDH
KF471659_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF471655_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF471652_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF471651_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KF471650_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
KF471649_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
KC774459_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JX096955_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDL
JQ687531_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGN-LNDH
JN688722_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDH
JN688678_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDH
JN664948_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGN-LNDH
JN664918_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
JN642151_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642146_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDH
JN642140_HBSP_P-D      MPLSYQHFRRLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN642138_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDR
JN642130_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257209_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257205_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257199_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257196_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257195_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257194_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257193_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257188_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257187_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257173_HBSP_P-D      MPLSYRHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257172_HBSP_P-D      MPLSYRHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257169_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
JN257162_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDX
JN257202_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGN-LNDL
                       ** *   *   : *:  :*. :.. .     .     *            

JN040804_HBSP_P-D      QIPARDHAEPARLLLKEPLRIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257177_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
X65258_HBSP_P-D        QQPVRDHAKPARLLLKATLCFPHVAVPKLRMEIAPVFPSHRLGLSQNTYG
DQ486023_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPGAVPKLWTEIAPVFPSHHLGLSENSYG
DQ336685_HBSP_P-D      RPPARVLAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ464174_HBSP_P-D      QPPARVHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ464172_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ336686_HBSP_P-D      RPPARDHAGPARLLLKEPLCILPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ336687_HBSP_P-D      RPPARDHAGPARLLLKEPLCILPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ336688_HBSP_P-D      RPPARDHAGPARLLLKEPLCILPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ336692_HBSP_P-D      RPPARDHAGPARLLLKEPLCILPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY236164_HBSP_P-D      QPPARDHAESARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ486022_HBSP_P-D      QPPARDHAESARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB270537_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYG
AY236160_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ336674_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ336675_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ336676_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ336677_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ336678_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ336679_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ336690_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ464176_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ464177_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ464178_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ486021_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN688710_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MK052963_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHHGLSENSYG
MK052966_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHHGLSENSYG
MK052971_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHHGLSENSYG
MK052947_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSRRHGLSENSYG
MK052948_HBSP_P-D      QQPARDHAEPARLLHKEPLCIPPVAVQNLRTEIAPVFPSRRHGLSENSYG
MK052951_HBSP_P-D      QQPARDHAEPARLLHKEPLCIPPVAVQNLRTEIAPVFPSRHHGLSENSYG
MK052954_HBSP_P-D      QQPARDHAEPARLLHKEPLCIPPVAVQNLRTEIAPVFPSRRHGLSENSYG
MK052949_HBSP_P-D      QQPARDHAELARLLLKQPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYG
MK052950_HBSP_P-D      QQPARDHAELARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYG
MK052959_HBSP_P-D      QQPARDHAELARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYG
MK052974_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MK052972_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MK052973_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
MK052975_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
MK052952_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MK052953_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MK052955_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MK052956_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MK052958_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MK052960_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MK052961_HBSP_P-D      QQPARDHAEPARLLLKEPLCTPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KP090180_HBSP_P-D      QPPARDHAEPAQLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYG
JN688712_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYG
JN688695_HBSP_P-D      RPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYG
JN664919_HBSP_P-D      QPPARDHAKPARLLLTEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYG
JN040818_HBSP_P-D      QQPARDHAGPAPLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040755_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
JN040752_HBSP_P-D      RPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU939680_HBSP_P-D      QPPARDHAEPARFLLKEPLCIPLVAVPKLRTEIAPVFPSHHPGLSENSYG
EU921419_HBSP_P-D      QPPARDHVEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU921418_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSQNSYG
DQ336689_HBSP_P-D      RQPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY233296_HBSP_P-D      QQPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ486025_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVPNLRMEIAPVFPSHHPGLSENSYG
AB493846_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
HQ236015_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KU736926_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFXSHHPGLSENSYG
KU736927_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040808_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754603_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ904433_HBSP_C-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
AB270539_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHPGLSENSYG
AY233291_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY233292_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY233294_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ464173_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ464175_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KP090179_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF679998_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875324_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN688683_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYG
JN664920_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYG
JN257190_HBSP_P-D      QPPAWDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754632_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754606_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HM750151_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ922001_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KT366507_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KT366497_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF679993_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF679992_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF679990_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN688711_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYG
HQ236014_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257160_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257161_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYG
EU414141_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU414142_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KX196235_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
X97849_HBSP_P-D        QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
X65257_HBSP_P-D        QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
LT992454_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
LT992438_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KX196225_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KX196224_HBSP_P-D      QPPARDYAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KT749821_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KT347090_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KP090181_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KM519455_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF779214_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF679996_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF679994_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF679989_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875331_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875330_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875329_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875328_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875326_HBSP_P-D      QPPARDHAAPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875325_HBSP_P-D      QPPARDHAAPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875323_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875322_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC774460_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC774437_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC774436_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JX898694_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPTVAVPNLRTEIAPVFPSHHPGLSENSYG
JN688708_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN688685_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN688679_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
JN642126_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ922002_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ922000_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ183478_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ183473_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ692507_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ692506_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ562338_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ349232_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594434_HBSP_P-D      QPPARDHAEPARLLLKDPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYG
EU414143_HBSP_P-D      QPPARDHAAPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594382_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ336682_HBSP_P-D      QPPARDHAEPARLLLKESLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ336680_HBSP_P-D      QPPARDHAEPARLLLKESLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ336684_HBSP_P-D      QPPARDHAEPARLLLKESLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ336681_HBSP_P-D      QPPARDHAEPARLLLKESLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456674_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPHVAVQNLRTEIAPVFPSHHHGLSENSYG
AY090452_HBSP_P-D      QPPARDHAKPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642133_HBSP_P-D      QPPARDHAEPARLLLKETLRIPPVAVQNLRTEIAPVFPSHHLGLSENSYG
JN688713_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN040784_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYG
GU456639_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHHGLSENSYG
AY090453_HBSP_P-D      QPPAWDHARPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYG
AB330367_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040772_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYG
JN040767_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754629_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVVVSNLRTEIAPVFPSHHPGLSQNSYG
GU456654_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456652_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB119254_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456675_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754624_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040768_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257182_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257200_HBSP_P-D      QPPARDHAEPARLLLKESLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN040782_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
GU456672_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGVSENSYG
GQ167301_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ167302_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ184322_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AY741794_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY741795_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY741796_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF922432_HBSP_P-D      QPPARDPAEPARHLLKEPLCIPPVAVQNLRTETAPVFPSHHHGLSENSYG
JN642157_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642153_HBSP_P-D      QPPARDPAKPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYG
JN040773_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040766_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040760_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHHGLSENSYG
JN040758_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYG
JF754626_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHLGLSENSYG
JF754617_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754598_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYG
GU456681_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHHGLSENSYG
GQ183448_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
FJ904427_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRKEIAPVFPSHHHGLSENSYG
FJ349235_HBSP_P-D      QLPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AB270541_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AB674405_HBSP_P-D      QPPARDHAKPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KP168419_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRMETAPVFPSHHPGLSENSYG
KF471654_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ927384_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
JN040774_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN040750_HBSP_P-D      QPPAWDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754604_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
HQ700439_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GU456671_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456670_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ904438_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
FJ349220_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU787443_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYG
AF121242_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
AF121241_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
AF121240_HBSP_C-D      QPPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
AB674415_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHXGLSENSYG
AF121239_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754611_HBSP_P-D      RLPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHPGLSENSYG
GU456678_HBSP_P-D      RPPARNSAEPARLLLKEPLCISPVAVQNLREEIAPVFPSHHPGLSQNSYG
JN792907_HBSP_P-D      QPPARDHAGLARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN792908_HBSP_P-D      QPPARDHAGLARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN257165_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYG
JN257166_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYG
KM606754_HBSP_P-D      RPPARDPAGPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
JN040820_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHPGLSENSYG
JN040814_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040822_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040810_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPAAVQNLWTEIAPVFPSHHPGLSENSYG
GQ922005_HBSP_P-D      RPPARDPAEPARLLLKEPLCIPLVAVQNLRMETAPVFPSHHPGLSENSYG
GQ205380_HBSP_P-D      QPPARDHAEPARLLLTEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
EF103277_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYG
AB674420_HBSP_P-D      QLPVRDHAKPARLLLKAPLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTYG
AB674417_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB674418_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB104712_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYG
AY721612_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYG
FJ349233_HBSP_P-D      RLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456638_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040826_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642142_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC774444_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB048701_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
AJ627219_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHRPGLSENSYG
FJ692533_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVQNLRMETALVFPSHRPGLSENSYG
GQ922003_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
GQ922004_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
HQ700458_HBSP_P-D      RPQARDPAEPARLLLKEPLCIPPVVVQNLRTETAPVFPSHHPGLSENSYG
KM606744_HBSP_P-D      QPPARDPAGPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLSENSYG
FJ692532_HBSP_P-D      QPPARDPAEPARLLLKEPLCFPPVAVQNLRMETAPVFPSHRPGLSENSYG
KM606752_HBSP_P-D      QPPARDPAGPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
KU736924_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYG
KU736925_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYG
KY629633_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPLAAVXNLRTEIAPVFPSHHLGLSENSYG
KM524342_HBSP_P-D      QPPARDHAEPARLLLTEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KF170739_HBSP_P-D      QPPARDHAEPARLLLKETLCIPPVAVPNLRTEIAPVFPSHHPGPSGNSYG
EU594407_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSQNSYG
EU594427_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSQNSYG
FJ904426_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSQNSYG
AJ627220_HBSP_P-D      QPPARDHAEPARLLLKETLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB674424_HBSP_P-D      QRPARDHAEPARVLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB674411_HBSP_P-D      QRPVRDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB119255_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYG
AJ344116_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYG
EU594396_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYG
JN257150_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYG
JN257170_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYG
JN257171_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYG
AB109479_HBSP_P-D      PPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AJ627222_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594398_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KT366494_HBSP_P-D      QPPARNHAEPARLLFKESLYSPPVAVPNVRKEIAPVFPSHHPGLSENSYG
JQ707497_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642147_HBSP_P-D      RPPARDHAEPARLLLKEPLCIPPAVVQNLRTEIAPVFPSHHPGLSENSYG
DQ336683_HBSP_P-D      QPPARDHAEPARLLLKESLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB188244_HBSP_P-D      QPPARDHAEPARLLLKEPLCGPHVAVPNLRTEIAPVFPSHRPGLSQNTYG
X80926_HBSP_P-D        QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
X80924_HBSP_P-D        QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MF618349_HBSP_P-D      QPPARDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KT366499_HBSP_P-D      QPPARDHAKPARLLLKEPLCIPPVAVPNLRTQIAPVFPSHHLGLSENSYG
KM577671_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KJ470895_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
KF471645_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF471641_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875279_HBSP_P-D      QPPARDHSEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642162_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642159_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYG
FJ349218_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707689_HBSP_P-D      QPPTRDHAEPARLLLKEPLCIPPVAVPNFRTEIAPVFPSHHPGLSENSYG
JN257186_HBSP_P-D      QRPARXHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KJ470896_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSZNSYG
KF471646_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHPGLSENSYG
KC875292_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHPGLSENSYG
JQ707487_HBSP_P-D      QPPAWDHAEPARLLFKELLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257167_HBSP_P-D      QPPARDHAEPARLLLKEPLXIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
X72702_HBSP_P-D        QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MH932714_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MF925393_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MF925379_HBSP_P-D      QPPAWDHAEPARLLFKAPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
MF925364_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MF925363_HBSP_P-D      QPPAWDHAEPARILFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MF925358_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
M32138_HBSP_P-D        QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
LT992444_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRMEIAPVFPSHHPGLSENSYG
LT992439_HBSP_P-D      RPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
KX827301_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KX827291_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KX827290_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KX276857_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KX260231_HBSP_P-D      QPPAWDHAKPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSEDSYG
KX196236_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KX196228_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KX196227_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KX196215_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KX196212_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KX196211_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KX196209_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KX196208_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KU668449_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KT749828_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KT749827_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
KT366511_HBSP_P-D      QPPAWDHAEPARLLFKEPLYIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
KT366510_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KT366509_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KT366506_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KT366496_HBSP_P-D      QPPAWDHAEPARQLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KT366495_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KT366493_HBSP_P-D      QPPAWDHAKPARLLFKEPLYIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KT366491_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KT151620_HBSP_P-D      QPPAWDHAGPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KR905424_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KR905423_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KP322601_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KP322600_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KP322599_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KM577669_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KM577668_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KM524356_HBSP_P-D      QPPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KM524355_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KM524354_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KM524353_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KM524352_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KM524351_HBSP_P-D      QPPAWDHAKPARLLFKEPLCIPTVAVPNLRTEIAPVFPSHHPGLSENSYG
KM524347_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KM524344_HBSP_P-D      QPPARDHAKPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KM524341_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KM524338_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KJ470894_HBSP_P-D      QPPARDPAEPARLLLKEPLCFPPVAVQNLRTETAPVFPSHHPGLSENSYG
KJ470893_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPHVAVQNLRMETAPVFPSHHPGLSENSYG
KF779220_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF679997_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF679995_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF471660_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF471658_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF471657_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPTVAVPNLRTEIAPVFPSHHPGLSENSYG
KF471653_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF471644_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF061169_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875312_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875309_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875308_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875307_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875306_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875301_HBSP_P-D      QPPARDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875299_HBSP_P-D      QPPARDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875297_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875296_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875295_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875294_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875293_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875290_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875289_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875288_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875287_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875286_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875283_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875277_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JX096958_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
JX096957_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JX096956_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JX096954_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707706_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707705_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707704_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707703_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707702_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707701_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707700_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707699_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707698_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707697_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707696_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707695_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707694_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707693_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707692_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707691_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707690_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707688_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707687_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707686_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707685_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707684_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707683_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707682_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707530_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707529_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707528_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707527_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707526_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707525_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707524_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707523_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707522_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707521_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707520_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707519_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707518_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707517_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707516_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707515_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707514_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707513_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707512_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707510_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707508_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707507_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707505_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707504_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707503_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707502_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707501_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707500_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707499_HBSP_P-D      QPPAWDHAEPARPLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707496_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707495_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707494_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707493_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707492_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707490_HBSP_P-D      QPPAWDHAGPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707489_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707488_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707486_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707485_HBSP_P-D      QPPAWDHAEPARPLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707484_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707483_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707482_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707481_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707480_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707479_HBSP_P-D      QPPAWDHAEPARPLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707478_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707477_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707476_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN664941_HBSP_P-D      QPPAWDHAEPARRLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN664939_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN664930_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN664928_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN664927_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642167_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642163_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642149_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642144_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642143_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYG
JN642131_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257214_HBSP_P-D      QPPARDHAEPARLLLKEPLXFPPVAVPNLRTXIAPVFPSHHPGLSENSYG
JN257215_HBSP_P-D      QPPARDHAEPARLLLKEPLXFPPVAVPNLRTXIAPVFPSHHPGLSENSYG
KJ470889_HBSP_P-D      QPPARDPAEPARLLLKEXLXIPPVAVXNLRMETAPVFPSHHPGLSENSYG
AY161150_HBSP_P-D      QPPARDHAEPARLLLKETLFIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AY161151_HBSP_P-D      QPPARDHAEPARLLLKETLFIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AY161152_HBSP_P-D      QPPARDHAEPARLLLKETLFIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AY161153_HBSP_P-D      QPPARDHAEPARLLLKETLFIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AY161154_HBSP_P-D      QPPARDHAEPARLLLKETLFIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AY161155_HBSP_P-D      QPPARDHAEPARLLLKETLFIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AY161156_HBSP_P-D      QPPARDHAEPARLLLKETLFIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700478_HBSP_P-D      QPPARDHAEPARLLLKTTLCIPHVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700553_HBSP_P-D      QPPARDHAEPARLLLKTTLCIPHVAVPNLRTEIAPVFPSHHLGLSENSYG
X59795_HBSP_P-D        QPPARDHAGPARLLLKATLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AB270547_HBSP_P-D      QPPAREHAEPARPLLAEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AB222711_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AB126581_HBSP_P-D      QPPARDHAEPGRLLVKEPLCIPPGAGPNLWTEIAPVFPSHHPGLSENSYG
JN642156_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHLGLSENSYG
JN257163_HBSP_P-D      QPPARDHAKPARLLLKEPLCIPPAAVPNLWTEIAPVFPSHHPGLSENSYG
JN642155_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPAAVPNLWTEIAPVFPSHHPGLSENSYG
HM750155_HBSP_P-D      QPPARVPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HM750156_HBSP_P-D      QPPARVPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AB270549_HBSP_P-D      QPPARDHAEPARLLLKEPLYIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AB246348_HBSP_P-D      QPPARDPAEPARLLLKEPLYIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
EU787437_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYG
JN040775_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
EF103275_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700468_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AY945307_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLWENSYG
EU939681_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPLVAVPNPRTEIAPVFPSHHLGLSENSYG
FJ899792_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPLVAVPNPRTEIAPVFPSHHLGLSENSYG
KC774477_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KY629630_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVXNPRTEIAPVFPSHHLGLSENSYG
AY741797_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KF061167_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AB246347_HBSP_P-D      QPPARDHAEPARLLLEEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KT366498_HBSP_P-D      QPPARDHAEPARLLLEEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KT366500_HBSP_P-D      QPPARDHAEPARLLLEEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KT366501_HBSP_P-D      QPPARDHAEPARLLLEEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KT366502_HBSP_P-D      QPPARDHAEPARLLLEEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AB270550_HBSP_P-D      QPPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183470_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GU456657_HBSP_P-D      QPPARDHAKPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700472_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ833468_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVQNPRTEIAPVFPSHHLGLSENSYG
MF925391_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHLGLSENSYG
KM524348_HBSP_P-D      QPPARDHAEPARLLLKDPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN792912_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN792911_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN642148_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN642128_HBSP_P-D      QPPARDHAKPARLLHKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JF754630_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIALVFPSHHLGLSENSYG
JF754590_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSQNSYG
HM750152_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
FJ386590_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHLGLSENSYG
HQ700454_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHLGLSENSYG
EU594433_HBSP_P-D      QPPAREHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB104710_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHLGLSENSYG
AB222712_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHLGLSENSYG
JN792904_HBSP_P-D      QPPARDHAELARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN792906_HBSP_P-D      QPPARDHAELARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KM606753_HBSP_P-D      QPPARDPAEHARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHLGLSENSYG
AB104709_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHPGLSENSYG
JF754601_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHPGLSENSYG
KY629634_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KC774445_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700455_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHLGLSENSYG
EU787445_HBSP_P-D      QPPARDPAEHARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYG
AB222709_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AB270540_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AB270542_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AB270543_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AB270548_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AB583680_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
LC365689_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KX827300_HBSP_P-D      QPPARDHAEPARHLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KT366508_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KP995100_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHLGLSENSYG
KF061168_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KC774462_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYG
JN792910_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN792909_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN792903_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN664931_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN642166_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN642164_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN642158_HBSP_P-D      QPPARDHAEPARLLLKEPICIPHVAVPNLRTEIAPVFPSHHLGLSENSYG
JN642150_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN257211_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVXNLRTEIAPVFPSHHLGLSENSYG
JN257185_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN257179_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN257176_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN040830_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN040794_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN040792_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN040791_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN040781_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN040780_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN040751_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ833471_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYG
HQ833470_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYG
HQ833469_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYG
HQ833465_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYG
HQ700489_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700488_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700487_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700484_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700483_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700482_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700481_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHLGLSENSYG
HQ700480_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700479_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700477_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700474_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700473_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700471_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700470_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700469_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700467_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700466_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700464_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700463_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700459_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700451_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700450_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700449_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700448_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700447_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700446_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700445_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700444_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700443_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700442_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700441_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HQ700440_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
HM750154_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPLVAVPNPRTEIAPVFPSHHLGLSENSYG
HM750153_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYG
GU357846_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ377589_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183481_HBSP_P-D      QPPARDHAEPARLLFKEPLCIPLVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183480_HBSP_P-D      QPPARDHAEPARLLLKDPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183469_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183468_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183467_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183466_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183465_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183464_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183463_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183462_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183461_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183460_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183459_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183458_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183457_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183456_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183455_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183454_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183453_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183452_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183451_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183450_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
GQ183449_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
FJ349230_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
EU919197_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPTVAVPNPRTEIAPVFPSHHLGLSENSYG
EU787447_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPLVAVPNPRTEIAPVFPSHHLGLSENSYG
EU787446_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
EU787442_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYG
EU787441_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHLGLSENSYG
EU787440_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYG
EU787439_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPLVAVPNPRTEIAPVFPSHHLGLSENSYG
EU787438_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYG
EU787436_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
EU594397_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
EU414135_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
EF103281_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
EF103280_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
DQ464181_HBSP_P-D      QPPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAHVFPSHHLGLSENSYG
AB674404_HBSP_P-D      QPPARXHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AF280817_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KJ647352_HBSP_P-D      QPPAWDHAKPAQLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSKNSYG
JX310733_HBSP_P-D      QLPAWEHAEAARLLLQEPLCIPPVAVPNLRXEIAPVFPSHHHGLSEDSYG
KF192830_HBSP_P-D      QPPAREHAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
KF192831_HBSP_P-D      QPPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
KF192832_HBSP_P-D      QPPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
KF192834_HBSP_P-D      QPPAREPAKPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
MF618348_HBSP_P-D      QPPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
KM524358_HBSP_P-D      QPPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
JN040802_HBSP_P-D      QLPVRDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHPGLSENSYG
GQ477454_HBSP_P-D      QPPAREHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257148_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB555496_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB674435_HBSP_P-D      QLPARDHAESARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642134_HBSP_P-D      QLPAREHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSRHHGLSENSYG
FJ904415_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYG
AB222710_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN040797_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
JN040817_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHLGLSENSYG
JN257183_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KX276856_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYG
KT749823_HBSP_P-D      PLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYG
KF584160_HBSP_P-D      QLPARDHAEPARLLLKAPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
KF584161_HBSP_P-D      QLPARDHAEPARLLLKAPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
KF584162_HBSP_P-D      QLPARDHAEPARLLLKAPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
KF584163_HBSP_P-D      QLPARDHAEPARLLLKAPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
KF584164_HBSP_P-D      QLPARDHAEPARLLLKAPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
KF584165_HBSP_P-D      QLPARDHAEPARLLLKAPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
KF584166_HBSP_P-D      QLPARDHAEPARLLLKAPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
KY382412_HBSP_P-D      QLPARDHAEPARLLLKAPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
KY382414_HBSP_P-D      QLPARDHAEPARLLLKAPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040812_HBSP_P-D      QQPARDHAELARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040807_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGVSENSYG
JN040796_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040788_HBSP_P-D      QPPARDHAEPARLLLEEPLCLPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040765_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754612_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754599_HBSP_P-D      QPPARDHAEPARLLLKEPLCIHPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754623_HBSP_P-D      QPPARDHAEPARLLLKEPLCIHPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754593_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456651_HBSP_P-D      QLPARDHAELARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYG
GU456647_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456643_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
GU456641_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHPGLSENSYG
GU456640_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYG
JF754610_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYG
GU456637_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHRPGLSENSYG
GQ477456_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ349219_HBSP_P-D      QPPARDHAEPARLLLTEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ349213_HBSP_P-D      RPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU414136_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTQIAPVFPSHHPGLSENSYG
AY721607_HBSP_P-D      QPPARDHAEPAQLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY161157_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB674431_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYG
AB674423_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB674419_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYG
AB674416_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB555497_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB210821_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB210822_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB210820_HBSP_P-D      QPPARDHAEPARLLHKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB267090_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ904435_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
GU456679_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
X85254_HBSP_P-D        QPPARDHAAPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
KX357622_HBSP_P-D      QLPARVHAEPARLLLKEPLCIPPVAVQNLRTETAHVFPSHHPGLSENSYG
KM577670_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642165_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPAAVQNLRTEIAPVFPSHHPGLSENSYG
JN642135_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYG
JN642132_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYG
JN257203_HBSP_P-D      QLPARDHAEPARLLLEEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040778_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
HQ236016_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456673_HBSP_P-D      QPPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ904424_HBSP_P-D      QPPARDHAEPARHLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY721606_HBSP_P-D      QPPVRDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB555501_HBSP_P-D      QQPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ111986_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
FJ562309_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYG
AB674403_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ477457_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456669_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
HQ700510_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040783_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040785_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707491_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MF925390_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
MF925383_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KM524346_HBSP_P-D      QPPAWDHAKPARLLFKEPLCIPTVAVPNLRTEIAPVFPSHHPGLSENSYG
KF471642_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707511_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707509_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707506_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ707498_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257178_HBSP_P-D      QPPAXDHAEPARLLLKEPLCIPPVAVPNLRTETAPVFPSHHPGLSENSYG
HQ833466_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVXNPRTEIAPVFPSHHLGLSENSYG
HQ833467_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVXNPRTEIAPVFPSHHLGLSENSYG
FJ904402_HBSP_P-D      RPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB078031_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB078033_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB090268_HBSP_P-D      QPPAWDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB090269_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB090270_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB109475_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB109476_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB109477_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB109478_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB110075_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB116266_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB119251_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB119252_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB119253_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB119256_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB120308_HBSP_P-D      QPPAWDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB188242_HBSP_P-D      RPPAWDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB205126_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB205127_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYG
AB205128_HBSP_P-D      QPPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB330369_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB330370_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB471856_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB471857_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB674406_HBSP_P-D      QPPARDHARPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHXPGLSENSYG
AB674407_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB674408_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB674409_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AF043593_HBSP_P-D      QPPAWDHAEPARPLFKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
AF043594_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
AJ627223_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AJ627224_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
AY161159_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYG
AY161160_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYG
AY721605_HBSP_P-D      RPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY721610_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY721611_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHPGLSENSYG
AY796031_HBSP_P-D      QPPARDHAEPARLLLKGPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY796032_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EF103276_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EF103279_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYG
EU414138_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
EU594399_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594400_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594401_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594402_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594403_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU414139_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594404_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594405_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594408_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594409_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594410_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594411_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594412_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594413_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594414_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594415_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594416_HBSP_P-D      RPPAWDHAEPARLLFKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594417_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594418_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594419_HBSP_P-D      QPPAWDHAGPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594420_HBSP_P-D      QPPAWDHAGPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594421_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594422_HBSP_P-D      QPPAWDHAGPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594423_HBSP_P-D      QPPAWDHAGPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594424_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594425_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594426_HBSP_P-D      QPPARDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594428_HBSP_P-D      QPPAWDHAGPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594429_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594430_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594431_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
EU594432_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ349205_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ349206_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ349215_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ349216_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ349217_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ349228_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ349229_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ349234_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ904395_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPHVAVQNLRMETAPVFPSHHPGLSENSYG
FJ904412_HBSP_P-D      RPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ904418_HBSP_P-D      RPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ904420_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYG
FJ904421_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYG
FJ904422_HBSP_P-D      QPPARDXAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ904399_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ904429_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
FJ904431_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ904439_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
FJ904443_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ904445_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ183471_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ183472_HBSP_P-D      QPPAWDHAEPARQLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ183474_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ183475_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ183476_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ183477_HBSP_P-D      QPPAWDHAEPARQLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ183479_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ183482_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ183483_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ183484_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ183485_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ477452_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ477455_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ477458_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHPGLSENSYG
GQ924652_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456635_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456653_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456655_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
GU456656_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456658_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456659_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456660_HBSP_P-D      RPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456661_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYG
GU456662_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456663_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456664_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456667_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456668_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456676_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
GU456677_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
GU456680_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456683_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
HQ700511_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
HQ700512_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
HQ700513_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
HQ700514_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754588_HBSP_P-D      QPPARDHAEPARPLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754592_HBSP_P-D      QPPARDPAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754594_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754597_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754605_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754615_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754621_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754622_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754627_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754628_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754631_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754634_HBSP_P-D      RPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754635_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040754_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040756_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHRPGLSENSYG
JN040757_HBSP_P-D      QPPARDHAEPARPLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040759_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040761_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040762_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040769_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040770_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040771_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040776_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040779_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040786_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040790_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040819_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040821_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040824_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257151_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
JN257153_HBSP_P-D      QPPARDHAGPARRLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257159_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ904446_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB078032_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB104711_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB188241_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ904410_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
GU456684_HBSP_P-D      QPQARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754600_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
JF754609_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ904419_HBSP_P-D      QPPARDHAELARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYG
GU456665_HBSP_P-D      QPPARDHAELARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
GU456666_HBSP_P-D      QPPARDHAELARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AJ627215_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
AJ627216_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
AJ627218_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
FJ349208_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYG
FJ904432_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040777_HBSP_P-D      QPPARDHAEPARLLLKTPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040811_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB555500_HBSP_P-D      QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ477453_HBSP_P-D      PPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHRPGLSENSYG
KC875340_HBSP_P-D      RPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC875341_HBSP_P-D      RPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KJ647355_HBSP_P-D      QPPARDLAKPAXLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSXNSYG
KF053178_HBSP_P-D      QPPAWDHAEHARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KC774440_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ687530_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642161_HBSP_P-D      QLPARDHAELARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642145_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642129_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040816_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHPGLSENSYG
JF754619_HBSP_P-D      QPPARDHAEHARLLLKEPLCIPPVAVQNLRTEIAHVFPSHHPGLSENSYG
JF754595_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB674425_HBSP_P-D      QLPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040800_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040801_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB674413_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB674426_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AF151735_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRKEIAPVFPSHHPGLSENSYG
AY161158_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY373431_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY661792_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB674422_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY661793_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY721609_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY741798_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY796030_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
DQ315778_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
FJ349231_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GQ477459_HBSP_P-D      QLPARDHAEPARLLLKAPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456636_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456642_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456644_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456646_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456648_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456649_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456650_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754591_HBSP_P-D      QLPARDHAEPARLLHKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754596_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754602_HBSP_P-D      QLPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754608_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754633_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040793_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040799_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040805_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040806_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040809_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040813_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040815_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHPGLSENSYG
JN040823_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040827_HBSP_P-D      QLPARDHAEPARRLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040828_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040829_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257149_HBSP_P-D      QLPARDHAXPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257152_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257155_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AY721608_HBSP_P-D      QPPARDHAEHARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642136_HBSP_P-D      RPPARDHAEHARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642154_HBSP_P-D      QLPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYG
GU456645_HBSP_P-D      QRPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB674428_HBSP_P-D      QRPARDHAEPARVLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB222713_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
AB674427_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JF754607_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYG
JN040795_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257201_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF471640_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KM524339_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF471647_HBSP_P-D      QLPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYG
Z35716_HBSP_P-D        QQPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
Y07587_HBSP_P-D        QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
X97848_HBSP_P-D        QPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
X02496_HBSP_P-D        QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KX357639_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYG
KX357638_HBSP_P-D      QPPARDHAEPARPLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYG
KX357637_HBSP_P-D      QPPARDHAEPARPLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYG
KT963508_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
KJ647350_HBSP_P-D      LPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF779382_HBSP_P-D      QPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
KF471659_HBSP_P-D      QQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF471655_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF471652_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF471651_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
KF471650_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYG
KF471649_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYG
KC774459_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRMEIAPVFPSHHPGLSENSYG
JX096955_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JQ687531_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN688722_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN688678_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN664948_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN664918_HBSP_P-D      QPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642151_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642146_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642140_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642138_HBSP_P-D      RPPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN642130_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257209_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257205_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257199_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257196_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257195_HBSP_P-D      QPPARDHAGPARRLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257194_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257193_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257188_HBSP_P-D      QLPARDHAEPARLLLKEPLCXPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257187_HBSP_P-D      QLPARDHAEPARLLLKEPLCXPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257173_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVVVQNLRTEIAPVFPSHHPGLSENSYG
JN257172_HBSP_P-D      QPPARDHAEPARLLLKEPLCIPPVVVQNLRTEIAPVFPSHHPGLSENSYG
JN257169_HBSP_P-D      QLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257162_HBSP_P-D      QXPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
JN257202_HBSP_P-D      QRPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYG
                          .      .  *    :     .  : .   * ** *.  *   ::**

JN040804_HBSP_P-D      SGPQPVSHGSVY-
JN257177_HBSP_P-D      SGPQPVSPGSVY-
X65258_HBSP_P-D        SGPQSVSLGSVY-
DQ486023_HBSP_P-D      SGPQPVPSGSVY-
DQ336685_HBSP_P-D      RGPQPVSPGSVY-
DQ464174_HBSP_P-D      RGPQPVSPGSVY-
DQ464172_HBSP_P-D      RGPQPVSPGSVY-
DQ336686_HBSP_P-D      RGPQPVSPGSVY-
DQ336687_HBSP_P-D      RGPQPVSPGSVY-
DQ336688_HBSP_P-D      RGPQPVSPGSVY-
DQ336692_HBSP_P-D      RGPQPVSPGSVY-
AY236164_HBSP_P-D      RGPQPVSPGSVY-
DQ486022_HBSP_P-D      RGPQPVSPGSVY-
AB270537_HBSP_P-D      SGPQPVSPGSVY-
AY236160_HBSP_P-D      RGPQPVPPGSVY-
DQ336674_HBSP_P-D      RGPQPVSPGSVY-
DQ336675_HBSP_P-D      RGPQPVSPGSVY-
DQ336676_HBSP_P-D      RGPQPVSPGSVY-
DQ336677_HBSP_P-D      RGPQPVSPGSVY-
DQ336678_HBSP_P-D      RGPQPVSPGSVY-
DQ336679_HBSP_P-D      RGPQPVSPGSVY-
DQ336690_HBSP_P-D      RGPQPVSPGSVY-
DQ464176_HBSP_P-D      RGPQPVSPGSVY-
DQ464177_HBSP_P-D      RGPQPVSPGSVY-
DQ464178_HBSP_P-D      RGPQPVSPGSVY-
DQ486021_HBSP_P-D      RGPQPVSPGSVY-
JN688710_HBSP_P-D      SGPQPVSPGSVY-
MK052963_HBSP_P-D      SGPQPVSPGSVY-
MK052966_HBSP_P-D      SGPQPVSPGSVY-
MK052971_HBSP_P-D      SGPQPVSPGSVY-
MK052947_HBSP_P-D      SGPQPVSPGSVY-
MK052948_HBSP_P-D      SGPQPVSPGSVY-
MK052951_HBSP_P-D      SGPQPVSPGSVY-
MK052954_HBSP_P-D      SGPQPVSPGSVY-
MK052949_HBSP_P-D      SGPQPVSPGSVY-
MK052950_HBSP_P-D      SGPQPVSPGSVY-
MK052959_HBSP_P-D      SGPQPVSPGSVY-
MK052974_HBSP_P-D      SGPQPVSPGSVY-
MK052972_HBSP_P-D      SGPQPVSPGSVY-
MK052973_HBSP_P-D      SGPQPVSPGSVY-
MK052975_HBSP_P-D      SGPQPVSPGSVY-
MK052952_HBSP_P-D      SGPQPVSPGSVY-
MK052953_HBSP_P-D      SGPQPVSPGSVY-
MK052955_HBSP_P-D      SGPQPVSPGSVY-
MK052956_HBSP_P-D      SGPQPVSPGSVY-
MK052958_HBSP_P-D      SGPQPVSPGSVY-
MK052960_HBSP_P-D      SGPQPVSPGSVY-
MK052961_HBSP_P-D      SGPQPVSPGSVY-
KP090180_HBSP_P-D      SGPQPVSPGSVY-
JN688712_HBSP_P-D      GGPQPVSPGSVY-
JN688695_HBSP_P-D      SGPQPVSPGSVY-
JN664919_HBSP_P-D      SGPQPVSPGSVY-
JN040818_HBSP_P-D      SGPQPVSPGSVY-
JN040755_HBSP_P-D      SGPQPVSPGSVY-
JN040752_HBSP_P-D      SGPQPVSPGSVY-
EU939680_HBSP_P-D      SGPQPISPCSVY-
EU921419_HBSP_P-D      SGPQPVSPGSVY-
EU921418_HBSP_P-D      SGPQPVSPGSVY-
DQ336689_HBSP_P-D      RGPQPVSPGSVY-
AY233296_HBSP_P-D      SGPQPVSPGSVY-
DQ486025_HBSP_P-D      SGPQPVSPGSVY-
AB493846_HBSP_P-D      SGPQPVSPGSVY-
HQ236015_HBSP_P-D      SGPQPVSPGSVY-
KU736926_HBSP_P-D      SGPQPVSLGSVH-
KU736927_HBSP_P-D      SGPQPVSLGSVH-
JN040808_HBSP_P-D      SGPQPVSPGSVY-
JF754603_HBSP_P-D      SGPQPVSPGSVY-
FJ904433_HBSP_C-D      SGPQPVSPGSVY-
AB270539_HBSP_P-D      SGPQPVSPGSVY-
AY233291_HBSP_P-D      SGPQPVSPGSVY-
AY233292_HBSP_P-D      SGPQPVSPGSVY-
AY233294_HBSP_P-D      SGPQPVSPGSVY-
DQ464173_HBSP_P-D      RGPQPVSPGSVY-
DQ464175_HBSP_P-D      RGPQPVSPGSVY-
KP090179_HBSP_P-D      SGPQPVSPGSVY-
KF679998_HBSP_P-D      SGPQPVSHGSVY-
KC875324_HBSP_P-D      SGPQPVSPGSVY-
JN688683_HBSP_P-D      SGPQPVSPGSVY-
JN664920_HBSP_P-D      SGPQPVSPGSVY-
JN257190_HBSP_P-D      XGPQPVSPGSVY-
JF754632_HBSP_P-D      SGPQPVSPGSVY-
JF754606_HBSP_P-D      SGPQPVSPGSVY-
HM750151_HBSP_P-D      SGPQPVSLGSVY-
GQ922001_HBSP_P-D      SGPQPVSPGSVY-
KT366507_HBSP_P-D      SGPQPVSPGSVY-
KT366497_HBSP_P-D      SGPQPVSPGSVY-
KF679993_HBSP_P-D      SGPQPVSPGSVY-
KF679992_HBSP_P-D      SGPQPVSPGSVY-
KF679990_HBSP_P-D      SGPQPVSPGSVY-
JN688711_HBSP_P-D      SGPQPVSPGSVY-
HQ236014_HBSP_P-D      SGPQPVSPGSVY-
JN257160_HBSP_P-D      SGPQPVSPGSVY-
JN257161_HBSP_P-D      SGPQPVSPGSVY-
EU414141_HBSP_P-D      SGPQPVSPGSVY-
EU414142_HBSP_P-D      SGPQPVSPGSVY-
KX196235_HBSP_P-D      SGPQPVSPGSVD-
X97849_HBSP_P-D        SGPQPVSPGSVY-
X65257_HBSP_P-D        SGPQPVSPGSVY-
LT992454_HBSP_P-D      SGPQPVSPGSVY-
LT992438_HBSP_P-D      SGPQPVSPGSVY-
KX196225_HBSP_P-D      SGPQPVSPGSVY-
KX196224_HBSP_P-D      SGPQPVSPGSVY-
KT749821_HBSP_P-D      SGPQPVSPGSVY-
KT347090_HBSP_P-D      SGPQPVSPGSVY-
KP090181_HBSP_P-D      SGPQPVSPGSVY-
KM519455_HBSP_P-D      SGPQPVSPGSVY-
KF779214_HBSP_P-D      SGPQPVSPGSVY-
KF679996_HBSP_P-D      SGPQPVSPGSVY-
KF679994_HBSP_P-D      SGPQPVSPGSVY-
KF679989_HBSP_P-D      SGPQPVSPGSVY-
KC875331_HBSP_P-D      SGPQPVSPGSVY-
KC875330_HBSP_P-D      SGPQPVSPGSVY-
KC875329_HBSP_P-D      SGPQPVSPGSVY-
KC875328_HBSP_P-D      SGPQPVSPGSVY-
KC875326_HBSP_P-D      SGPQPVSPGSVY-
KC875325_HBSP_P-D      SGPQPVSPGSVY-
KC875323_HBSP_P-D      SGPQPVSPGSVY-
KC875322_HBSP_P-D      SGPQPVSPGSVY-
KC774460_HBSP_P-D      SGPQPVSPGSVY-
KC774437_HBSP_P-D      SGPQPVSPGSVY-
KC774436_HBSP_P-D      SGPQPVSPGSVY-
JX898694_HBSP_P-D      SGPQPVSPGSVY-
JN688708_HBSP_P-D      SGPQPVSPGSVY-
JN688685_HBSP_P-D      SGPQPVSPGSVY-
JN688679_HBSP_P-D      SGPQPVSPGSVY-
JN642126_HBSP_P-D      SGPQPVSPGSVY-
GQ922002_HBSP_P-D      SGPQPVSPGSVY-
GQ922000_HBSP_P-D      SGPQPVSPGSVY-
GQ183478_HBSP_P-D      SGPQPVSPGSVY-
GQ183473_HBSP_P-D      SGPQPVSPGSVY-
FJ692507_HBSP_P-D      SGPQPVSPGSVY-
FJ692506_HBSP_P-D      SGPQPVSPGSVY-
FJ562338_HBSP_P-D      SGPQPVSPGSVY-
FJ349232_HBSP_P-D      SGPQPVSPGSVY-
EU594434_HBSP_P-D      SGPQPVSPGSVY-
EU414143_HBSP_P-D      SGPQPVSPGSVY-
EU594382_HBSP_P-D      SGPQPVSPGSVY-
DQ336682_HBSP_P-D      SGPQPVSHGSVY-
DQ336680_HBSP_P-D      SGPQPVSLGSVY-
DQ336684_HBSP_P-D      SGPQPVSLGSVY-
DQ336681_HBSP_P-D      SGPQPVSLGSVY-
GU456674_HBSP_P-D      SGPQPVSPGSVY-
AY090452_HBSP_P-D      SGPQPVSPGSVY-
JN642133_HBSP_P-D      SGPQPVSPGSVY-
JN688713_HBSP_P-D      SGPQPVSPGSVY-
JN040784_HBSP_P-D      IGPQPVSHGSVY-
GU456639_HBSP_P-D      SGPQPVSPGSVY-
AY090453_HBSP_P-D      SGPQPVSSGSIY-
AB330367_HBSP_P-D      SGPQPVSLGSVY-
JN040772_HBSP_P-D      SGPQPVSPGSVY-
JN040767_HBSP_P-D      SGPQPVSLGSVY-
JF754629_HBSP_P-D      SGPQPVSPGSVY-
GU456654_HBSP_P-D      SGPQPVSPGSVY-
GU456652_HBSP_P-D      SGPQPVSPGSVY-
AB119254_HBSP_P-D      SGPQPVSLGSVY-
GU456675_HBSP_P-D      SGPQPVSLGSVY-
JF754624_HBSP_P-D      SGPQPVSLGSVY-
JN040768_HBSP_P-D      SGPQPVSLGSVY-
JN257182_HBSP_P-D      SGPQPVSLGSVY-
JN257200_HBSP_P-D      SGPQPVSPGSVH-
JN040782_HBSP_P-D      SGPQPVSPGSVY-
GU456672_HBSP_P-D      SGPQPVSPGSVY-
GQ167301_HBSP_P-D      SGPQPVSPGSVY-
GQ167302_HBSP_P-D      SGPQPVSPGSVY-
GQ184322_HBSP_P-D      SGPQPVSPGSVY-
AY741794_HBSP_P-D      SGPQPVSPGSVY-
AY741795_HBSP_P-D      SGPQPVSPGSVY-
AY741796_HBSP_P-D      SGPQPVSPGSVY-
KF922432_HBSP_P-D      SGPQPVSPGSVY-
JN642157_HBSP_P-D      SGPQPVSPGSVY-
JN642153_HBSP_P-D      SGPQPVSPGSVY-
JN040773_HBSP_P-D      SGPQPVSLGSVY-
JN040766_HBSP_P-D      SGPQPVPPGSVY-
JN040760_HBSP_P-D      SGPQPVSPGSVY-
JN040758_HBSP_P-D      SGPQPVSPGSVY-
JF754626_HBSP_P-D      SGPQPVSPGSVY-
JF754617_HBSP_P-D      SGPQPVSPGSVY-
JF754598_HBSP_P-D      SGPQPVSPGSVY-
GU456681_HBSP_P-D      SGPQPVSPGSVY-
GQ183448_HBSP_P-D      SGPQPVSPGSVY-
FJ904427_HBSP_P-D      SGPQPVSPGSVY-
FJ349235_HBSP_P-D      SGPQPVSPGSVY-
AB270541_HBSP_P-D      SGPQPVSPGSVY-
AB674405_HBSP_P-D      SGPQPVSPGSVY-
KP168419_HBSP_P-D      SGPQPVSPGSVY-
KF471654_HBSP_P-D      SGPQPVSPGSVY-
JQ927384_HBSP_P-D      SGPQPVSPGSVY-
JN040774_HBSP_P-D      SGPQPVSPGSVY-
JN040750_HBSP_P-D      SGPQPVSPGSVY-
JF754604_HBSP_P-D      SGPQPVSPGSVY-
HQ700439_HBSP_P-D      SGPQPVSPGSVY-
GU456671_HBSP_P-D      SGPQPVSPGSVY-
GU456670_HBSP_P-D      SGPQPVSPGSVY-
FJ904438_HBSP_P-D      SGPQPVSPGSVY-
FJ349220_HBSP_P-D      SGPQPVSPGSVY-
EU787443_HBSP_P-D      SGPQPVSPGSVY-
AF121242_HBSP_P-D      SGPQPVSPGSVY-
AF121241_HBSP_P-D      SGPQPVSPGSVY-
AF121240_HBSP_C-D      SGPQPVSPGSVY-
AB674415_HBSP_P-D      SGPQPVSPGSVY-
AF121239_HBSP_P-D      SGPQPVSPGSVY-
JF754611_HBSP_P-D      SGPQPVSLGSVY-
GU456678_HBSP_P-D      SGPQPVSPGSVY-
JN792907_HBSP_P-D      SGPQPVSPGSVY-
JN792908_HBSP_P-D      SGPQPVSPGSVY-
JN257165_HBSP_P-D      SGPQPVSPGSVY-
JN257166_HBSP_P-D      SGPQPVSPGSVY-
KM606754_HBSP_P-D      SGPQPVSLGSVY-
JN040820_HBSP_P-D      TGPQPVSHGSVY-
JN040814_HBSP_P-D      GGPQPVSHGSVY-
JN040822_HBSP_P-D      SGPQPVSHGSVF-
JN040810_HBSP_P-D      SGPQPVSPGSVY-
GQ922005_HBSP_P-D      SGPQPVSLGSVY-
GQ205380_HBSP_P-D      SGPQPVSLGSVY-
EF103277_HBSP_P-D      SGPQPVSPGSVY-
AB674420_HBSP_P-D      SGPQSVSLGSVY-
AB674417_HBSP_P-D      SGPQPVSHGSVY-
AB674418_HBSP_P-D      SGPQPVSHGSVY-
AB104712_HBSP_P-D      SGPQPVSPGSVY-
AY721612_HBSP_P-D      SGPQPVSPGSVY-
FJ349233_HBSP_P-D      SGPQPVSLGSVY-
GU456638_HBSP_P-D      NGPQPVSLGSVY-
JN040826_HBSP_P-D      SGPQPVSLGSVY-
JN642142_HBSP_P-D      SGPQPVSLGSVY-
KC774444_HBSP_P-D      SGPQPVSLGSVY-
AB048701_HBSP_P-D      SGPQPVSLGSVY-
AJ627219_HBSP_P-D      SGPQPVSLGSVY-
FJ692533_HBSP_P-D      SGPQPVSLGSVY-
GQ922003_HBSP_P-D      SGPQPVSLGSVY-
GQ922004_HBSP_P-D      SGPQPVSLGSVY-
HQ700458_HBSP_P-D      SGPQPVSLGSVY-
KM606744_HBSP_P-D      SGPQPVSLGSVY-
FJ692532_HBSP_P-D      SGPQPVSLGSVY-
KM606752_HBSP_P-D      SGPQPVSLGSVY-
KU736924_HBSP_P-D      SGPQPVSLGSVY-
KU736925_HBSP_P-D      SGPQPVSLGSVY-
KY629633_HBSP_P-D      SGPQPVSLGSVY-
KM524342_HBSP_P-D      SGPQPVSLGSVY-
KF170739_HBSP_P-D      SGPQPVSPGSVY-
EU594407_HBSP_P-D      SGPQPVSPGSVY-
EU594427_HBSP_P-D      SGPQPVSPGSVY-
FJ904426_HBSP_P-D      SGPQPVSPGSVY-
AJ627220_HBSP_P-D      SGPQPVSPGSVY-
AB674424_HBSP_P-D      SGPQPVSHGSIY-
AB674411_HBSP_P-D      SGPQPVSHGSVY-
AB119255_HBSP_P-D      SGPQPVSPGSVY-
AJ344116_HBSP_P-D      SGPQPVSPGSVY-
EU594396_HBSP_P-D      SGPQPVSPGSVY-
JN257150_HBSP_P-D      SGPQPVSPGSVY-
JN257170_HBSP_P-D      SGPQPVSPGSVY-
JN257171_HBSP_P-D      SGPQPVSPGSVY-
AB109479_HBSP_P-D      SGPQPVSPGSVY-
AJ627222_HBSP_P-D      SGPQPVSPGSVY-
EU594398_HBSP_P-D      SGPQPVSPGSVY-
KT366494_HBSP_P-D      SGPQPVSPGSVY-
JQ707497_HBSP_P-D      SGPQPFSPGSVY-
JN642147_HBSP_P-D      SGPQPVSPGSVY-
DQ336683_HBSP_P-D      SGPQPVSLGSVY-
AB188244_HBSP_P-D      SGPQPVSXGSVY-
X80926_HBSP_P-D        SGPQPVSPGSVY-
X80924_HBSP_P-D        SGPQPVSPGSVY-
MF618349_HBSP_P-D      SGPQPVSPGSVY-
KT366499_HBSP_P-D      SGPQPVSPGSVY-
KM577671_HBSP_P-D      SGPQPVSPGSVY-
KJ470895_HBSP_P-D      SGPQPVSLGSVY-
KF471645_HBSP_P-D      SGPQPVSLDSDY-
KF471641_HBSP_P-D      SGPQPVSPGSVY-
KC875279_HBSP_P-D      SGPQPVSPGSVY-
JN642162_HBSP_P-D      SGPQPVSPGSVY-
JN642159_HBSP_P-D      SGPQPVSPGSVY-
FJ349218_HBSP_P-D      IGPQPVSHGSVY-
JQ707689_HBSP_P-D      SGPQPVSHGSVY-
JN257186_HBSP_P-D      SGPQPVSHGSVY-
KJ470896_HBSP_P-D      SGPQPVSLGSVY-
KF471646_HBSP_P-D      SGPQPVSPGSVY-
KC875292_HBSP_P-D      SGPQPVSPGSVY-
JQ707487_HBSP_P-D      SGPQPVSPGSVY-
JN257167_HBSP_P-D      SGPQPVSPGSVY-
X72702_HBSP_P-D        SGPQPVSPGSVY-
MH932714_HBSP_P-D      SGPQPVSPGSVY-
MF925393_HBSP_P-D      SGPQPVSPGSVY-
MF925379_HBSP_P-D      SGPQPVSPGSVY-
MF925364_HBSP_P-D      SGPQPVSPGSVY-
MF925363_HBSP_P-D      SGPQPVSPGSVY-
MF925358_HBSP_P-D      SGPQPVSPGSVY-
M32138_HBSP_P-D&