HBVdb

Dataset for protein HBc of genotype D

[Download (right click)] [Edit] [Sequences] [Repertoires]

1900 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


X85278_HBc_P-D        MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREAL-SPEHCSP
GQ922000_HBc_P-D      MDIDPYKEFGASAPLLSFLPHDFFPSIRDLLDTATALYREALESPEHCSP
JN257183_HBc_P-D      MDIDPYKEFGATVQLLSFLPSDFFPSIRDLLDTAAALYGEALQSPEHCSP
KP857049_HBc_P-D      MDIDPYKEFGASVQLLSFLPSDFFPSIRDLLDTAAALFGEALESPEHCTP
FJ904410_HBc_P-D      MDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTATALFRDALESPEHCSP
AB674416_HBc_P-D      MDIDPYKEFGASVELLSFLPDDFFPSARDLLDTATALYREALESQEHCSP
AB048701_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCTP
AB674424_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALDSPEHCTP
JQ927384_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYRDALESPEHCSP
KP168419_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYRDALESPEHCSP
EU726929_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
MG491162_HBc_P-D      MDIDPYKEFGASVELLSFLPHDFFPSIRDLLDTASALYRDALESPEHCSP
JF754626_HBc_P-D      MDIDPYKEFGATVELLSFLPDDFFPSVRDLLDATSALYREALESPEHCSP
DQ329356_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSP
AB674417_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSP
AB674418_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSP
FJ904422_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSLRDLLDTASALFRDALESPEHCSP
EU726871_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB119253_HBc_P-D      MDIDPYKEFGATVELLSFLPQDFFPAVRDLLDTASALYREALESPEHCTY
GQ924652_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB210820_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB119252_HBc_P-D      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
AB119251_HBc_P-D      MDIDPYKEFGATVELLSFLPQDFFPSVRDLLDTASALYRQALESPEHCSA
AB110075_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
AB120308_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
JN642148_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPDHCTP
AB109477_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB109479_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754602_HBc_P-D      MDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCTP
AY371917_HBc_P-D      MDLDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSP
KM606675_HBc_P-D      MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
EU726945_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
EU726947_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
JN040799_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
GQ477456_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPTVRDLLDTASALYREALESPEHVSA
AF043594_HBc_P-D      MDIDPYKEFGATVQLLSFLPHDFFPSVRDLLDTASALFRDALESPEHCSP
KP856977_HBc_P-D      MDIDPYKEFGASVELLSFLPGDFFPSIRDLLDTASALYREALESPEHCTP
AB270537_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
EU726926_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB104710_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSP
GU456651_HBc_P-D      MDIDPYKEFGASIELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSP
AJ344116_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB119254_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSY
GU456640_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
AB674411_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594434_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040757_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
JF754621_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTP
DQ304548_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ304549_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ304547_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY236162_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB674429_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ304550_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ304551_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ349233_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040821_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU185779_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX470760_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC012652_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY796030_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ464182_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875298_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
KC875290_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
KX196209_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
KX196212_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
FJ349213_HBc_P-D      MDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSP
HQ236015_HBc_P-D      MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439695_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
EU155893_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF121239_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754606_HBc_P-D      MDIDPYKEFGATSELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439704_HBc_P-D      MDIDPYKEFGAIVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439705_HBc_P-D      MDIDPYKEFGAIVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700472_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU726849_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY090453_HBc_P-D      MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSA
EU155895_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726912_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754623_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754599_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ349235_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700474_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ111986_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF043593_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
AF121242_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726892_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
JN040780_HBc_P-D      MDIDPYKEFGASVQLLSFLPVDFFPSIRDLLDTASALYREALESPEHCSP
GU456643_HBc_P-D      MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRDALESPEHCSP
GU456635_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCTP
AF419538_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JN040768_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTATALYREALESPEHCSP
JF754612_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPAVRDLLDTATALYRDALESPEHCSP
JF754600_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU456682_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
DQ486023_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF419523_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALFLQALESPEHCSP
AB674410_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF018177_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYRDALESPEHCSP
JF754622_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESSEHCTP
GU456659_HBc_P-D      MDIDPYKEFGASVELLSFSPHDFFPSVRDLLDTASALYREALESPEHCSP
GU456650_HBc_P-D      MDLDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU726979_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCTP
AY741798_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPAVRDLLDTASALFREALESPEHCSP
GU456679_HBc_P-D      MDIDPYKEFGASVELLSFLPVDFYPSVRDLLDTASALYREALESPQHVSP
GU456666_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
GU456658_HBc_P-D      MDIDPYKEFGASIELLSFLPTDFFPSVRDLLDTASALFREPLESPEHCSP
GU456647_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRESLESPEHCSL
GU456637_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDAASALYREALESPEHCSP
FJ904415_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB674423_HBc_P-D      MDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTASALFREALESPEHCSP
AB119255_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
X85273_HBc_P-D        MDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTASALYREALESPEHCSP
MH725096_HBc_P-D      MDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSP
MH725110_HBc_P-D      MDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSP
MH725118_HBc_P-D      MDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSP
KP857041_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSP
GU456684_HBc_P-D      MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRDALESPEHCSP
GU456664_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSS
GU456654_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPAVRDLLDTASALYREALESPEHCSP
FJ904429_HBc_P-D      MDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYRDALESPEHCSP
EU787439_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726969_HBc_P-D      MDIDPYKEFGATTELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726941_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
EU726891_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESTEHCSP
JN040773_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESTEHCSP
EU726855_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB674419_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCTP
KP857037_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFRDALESPEHCSP
JN040771_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ904419_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF419529_HBc_P-D      MDLDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN040800_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLATASALYREALESPEHCSP
JN040801_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLATASALYREALESPEHCSP
EU726904_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040775_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606655_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESSEHCSP
JN040797_HBc_P-D      MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
JF754619_HBc_P-D      MDIDPYKEFGATVQLLSFLPPDFFPSVRDLLDTASALFREALESPEHCSS
GU456656_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESHDHCSP
GQ477458_HBc_P-D      MDIDPYKEFGASVELLSFLPGDYFPSVRDLLDTASALFREALESPEHCSP
EU726933_HBc_P-D      MDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTASALYREALESPEHVSP
DQ315778_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSFRDLLDTASALYREALESPEHCSP
AB674415_HBc_P-D      MDIDPYKEFGASVELLSFLPENFYPSIRDLLDTASALYRDALESPEHCSP
AB674403_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
AB555501_HBc_P-D      MDIDPYIRIGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
JN257153_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
JN257195_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
JN040830_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTP
JF754603_HBc_P-D      MDIDPYKEFGASVELLSFLPQDFFPSVRDLLDTASALYREALESPEHCSP
GU456683_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU456655_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
GU456646_HBc_P-D      MDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTASALYREALESPEHCSP
GU456636_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ904395_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALYRDALESPEHCSP
FJ349220_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ349208_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRDALESPEHCSP
EU726873_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
EU726848_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
EU594404_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSP
DQ336683_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCAP
AY603433_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY090452_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTAAALYREALESPEHCSP
AF419532_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB674413_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857018_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTP
JN040819_HBc_P-D      MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
JN040795_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALFREALESPEHCTP
JN040778_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSP
JN040765_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
JF754634_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFYPSVRDLLDTASALYREALESPEHCSA
JF754630_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GU456652_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ922004_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTATALYRDALESPHHCSP
FJ904399_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDVLDTASALYREALESPEHCSH
FJ899792_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726856_HBc_P-D      MDIHPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ486021_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALDAPEHCSP
DQ399006_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
DQ336690_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSP
DQ336686_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFRDALESSEHCSP
AY236164_HBc_P-D      MDIDPYKEFGASVELLSFLPSEFYPSVRDLLDTASALFREALESPEHCSP
DQ336689_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSP
DQ486022_HBc_P-D      MDIDPYKEFGASVELLSFLPSEFYPSVRDLLDTASALFREALESPEHCSP
AB674428_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB674427_HBc_P-D      MDXDPYKEFGAXVELLSFLPLDFYPSVRDLLDTASALYREALESPEHCSP
MG491174_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTARALYRDALESPEHCSP
AY236160_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALECPEHCSP
DQ329357_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSP
DQ336675_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSP
DQ336676_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSP
DQ336677_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFRDALESPEHCSP
DQ336678_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSP
DQ336679_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSP
DQ336685_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSP
DQ336687_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFRDALESPEHCSP
DQ336691_HBc_P-D      MDIDPYKEFGASVGLLSFLPSDFYPSVRDLLDTASALFRDALESPEHCSP
DQ336692_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFLPSVRDLLDTASALYREALESPEHCSP
DQ464174_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSP
DQ464176_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLHTASALFREALESPEHCSP
DQ464177_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSP
DQ464178_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSP
FJ349219_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESSEHCSP
MG491152_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESSEHCSA
JN688695_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRXALESPEHISP
JN257176_HBc_P-D      MDIDPYKEFGATVQLLSFLPXDFFPSVRDLLDTASALFREPLESTEHCSP
JN257177_HBc_P-D      MDIDPYKEFGATVQLLSFLPXDFFPSVRDLLDTASALFREPLESTEHCSP
HQ700463_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
EU939681_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726925_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
GU456676_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857038_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ904432_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
MH725050_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725109_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726879_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
HQ833469_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN664910_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN688710_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPAVRDLLDTASALFRDALESPEHCSP
MH725177_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857117_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESSEHCSP
KP857110_HBc_P-D      MDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYREALESPEHCTP
KP857043_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSA
KM606755_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESSEHCSP
KM606670_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALYRDALESPEHCSP
KC875330_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
KC875305_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
JQ687530_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN257165_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN257166_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN132132_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN132128_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN132127_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040814_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
JN040802_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040796_HBc_P-D      MDIDPYKELGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
JN040772_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754598_HBc_P-D      MDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTASALYRQALESPEHCSP
HQ700481_HBc_P-D      MDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700439_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSH
HQ641710_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HM042266_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU456671_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ904427_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTS
FJ349214_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
EU921419_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
EU726970_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
EU726965_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
EU726963_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726961_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040783_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725079_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726960_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726950_HBc_P-D      MDIDPYKEFGASVELLSFLPQDFFPSVRDLLDTASALYREALESPEHCSP
EU726938_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCTP
EU726847_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ464175_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPERCSP
AY796032_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSH
AY371906_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY371904_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF419540_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
AF419542_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
AB188242_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB109478_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSA
MG491148_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY371911_HBc_P-D      MDIDPYKEFGASVELLSFLPYDFFPSVRDLLDTASALYREALESPEHCSP
FJ868011_HBc_P-D      MDIDPYKEFGATVELLSFLPYDFFPSVRDLLDTASALYREALESPEHCSP
GQ477457_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ922001_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257148_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040770_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSA
EU726910_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725123_HBc_P-D      KGIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN642150_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTATALYREALESPEHCSP
EU726859_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSP
EU726954_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSA
FJ904402_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSP
JN257159_HBc_P-D      MDIDPYKEFGASVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSP
KC875292_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875333_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875326_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
JN688711_HBc_P-D      MDIDPYKEFGATLELLSFLPSDFXPSVRDLLDTASALXREALESPEHCSP
JN257170_HBc_P-D      MDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSP
JN040829_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040817_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040782_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040754_HBc_P-D      MDIDPYKEFGAGVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU456663_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ477455_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRHLLDTASALFRDALESPEHCSP
FJ349217_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726958_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726911_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
EU726860_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
EU726850_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
DQ336681_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSA
AB674430_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB270542_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHGSA
DQ336680_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCTP
DQ336682_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCTP
DQ336684_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCTP
DQ336674_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSP
EU726857_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857114_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALDSPEHCSP
KJ470885_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALYRDALESPEHCSP
JN132131_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040810_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN040750_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
JF754633_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754588_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HQ833466_HBc_P-D      MDIDPYKEFGAXVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
GU456645_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRESLESPEHCSP
GQ183463_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU726977_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF419524_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB674405_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB090269_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB222709_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867998_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867957_HBc_P-D      MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867963_HBc_P-D      MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867970_HBc_P-D      MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867979_HBc_P-D      MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867983_HBc_P-D      MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ868005_HBc_P-D      MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ868009_HBc_P-D      MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB270548_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB555497_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF151735_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY721607_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY721608_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU414055_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU414142_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FJ349216_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ236016_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700444_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725101_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU736927_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPXVRDLLDTASALFREALESPEHCSP
KP857045_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798301_HBc_P-D      MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF471656_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF471644_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875302_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875287_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875284_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC774477_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN642165_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN642143_HBc_P-D      MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN257169_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSH
JN132130_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN132126_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040824_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040822_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040820_HBc_P-D      MDIDPYKEFGAAVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040808_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040777_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040758_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSP
JF754635_HBc_P-D      MDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALFRQALESPEHCSP
JF754604_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHVSA
JF754597_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HM042277_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GU456670_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU456661_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCTP
GU456653_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ477454_HBc_P-D      MDIEPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
GQ477452_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
GQ205385_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ183475_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ904424_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
FJ904421_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ904420_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ349234_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ349231_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
EU726937_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726917_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726886_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESNEHCSP
EU726865_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594422_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALYREALESPEHCSP
EU594408_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB119256_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB109476_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725167_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X85304_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X85303_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH932714_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725152_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725112_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725081_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725080_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725065_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725064_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724994_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724993_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724988_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY629630_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX827291_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF192834_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF192832_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF192831_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF192830_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF061169_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF061167_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707508_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707507_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707505_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707503_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707502_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707500_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707499_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707496_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707494_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707493_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707490_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707489_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707488_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707487_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707485_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707484_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRKALESPEHCSP
JQ707482_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707481_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707480_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707479_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707478_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707476_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN642145_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN664909_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB674404_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700489_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X65258_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X65257_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KX357637_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857111_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF471649_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF471646_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN257179_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257163_HBc_P-D      MDIDPYKEFGATVZLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040816_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040815_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040752_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754610_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCSP
JF754608_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439718_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439703_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439699_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439696_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439692_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700483_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700470_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700468_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700467_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSA
GQ183474_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183473_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ349206_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU726943_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726905_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU594412_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594411_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB674426_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALQSPEHCSP
FJ867953_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867964_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867965_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867966_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867968_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867972_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867973_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867974_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867975_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867977_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867981_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867982_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867984_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867996_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ867999_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ868004_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ868010_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ868012_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ868013_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB270547_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324141_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF419516_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY161159_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY161160_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY371908_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
AY373431_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594398_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
EU726876_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726957_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ349215_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183448_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183449_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183450_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183451_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183452_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183453_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183454_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183455_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183456_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183457_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183458_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183459_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183460_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183461_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183462_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183464_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183465_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183466_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183467_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183468_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183469_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU456649_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM524338_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040753_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HQ700448_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700477_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ904412_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU414143_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU414138_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU414061_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU414057_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X85295_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725186_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725151_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725150_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725147_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725130_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725113_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725111_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724992_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
M32138_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196230_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196227_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196218_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196213_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196211_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196210_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196208_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366501_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857053_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSH
KP857047_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSA
KP857040_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606745_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM524356_HBc_P-D      MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779223_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF471657_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF471653_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSP
KF018192_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875340_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KC875335_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875313_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875303_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875299_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875295_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875291_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875288_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875286_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875283_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875281_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX096955_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707501_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN642155_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN642126_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257171_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257155_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257152_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257209_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257151_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257150_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040828_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040827_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040826_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040823_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040813_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040807_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040805_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040790_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040788_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040786_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040767_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040759_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040756_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040751_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754628_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754624_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754618_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754615_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754605_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754601_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754596_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754591_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439712_HBc_P-D      MDIDPYKEFGAIVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ833471_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ833470_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ833468_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ833467_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ833465_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700514_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700513_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700512_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700511_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700488_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700487_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700484_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700482_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700480_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700479_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700473_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700471_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700469_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700466_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700464_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700459_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700454_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700451_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700450_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700449_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700447_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700446_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700445_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700443_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700442_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700441_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ700440_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HQ236014_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HM750156_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HM750155_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HM750154_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HM750153_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HM750152_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HM750151_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM042283_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HM042276_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HM042273_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HM042272_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HM042267_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU456680_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU456662_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSH
GU456641_HBc_P-D      MDIDPYKEFGASVQLLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
GU357846_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ922002_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ477459_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ377589_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ205389_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ205388_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ205382_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ205380_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183484_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183483_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183482_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183481_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183480_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183479_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183478_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ183477_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183476_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183472_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183471_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183470_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ904443_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692507_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692506_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ562338_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FJ386590_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ349232_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ349229_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ349228_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ349218_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FJ349209_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ349205_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU919197_HBc_P-D      MDIDPCKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU787447_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU787446_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU787445_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU787443_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
EU787442_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU787441_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU787440_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU787437_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU787436_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726976_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726972_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726971_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726967_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726964_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726962_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726959_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726940_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726935_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726930_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726924_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726923_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726921_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSH
EU726919_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726918_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726914_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726909_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726907_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726902_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726900_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726898_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726895_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726894_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726888_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726887_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726878_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726874_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726869_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726862_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726854_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726845_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726844_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594433_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594432_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594431_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594430_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594428_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594427_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594426_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594425_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594424_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594423_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594421_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594416_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594415_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594410_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594409_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594407_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594405_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594403_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594402_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594401_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594400_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594399_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594397_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU594396_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU414140_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU414136_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU414135_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU414060_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU414058_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU414056_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASXLYRDALESPEHCSP
EU414141_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASXLYRDALESPEHCSP
EU594382_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KT749823_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLRDTASALYRDALESSEHCTP
EU726858_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCTP
X80924_HBc_P-D        MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTATALYRDALESPEHCTP
X80926_HBc_P-D        MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTATALYRDALESPEHCTP
MK052947_HBc_P-D      MDIDPYKEFGASVELLSFLPADSFPSVRDLLDTASALYREALESPEHCTP
MK052972_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPTVRDLLDTASALYREALESPEHCTP
MK052973_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
MK052975_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
GU456669_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTP
MH725068_HBc_P-D      MDIDPYKEFGATAELLLFLPYDFFPSVRDFIDTASALYREASESPEHCSP
DQ464172_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTALALFRDALESPEHCSP
GU456678_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GU456642_HBc_P-D      MDIDPYKEFGASVELLSFLPNDFFPSLRDLLDTAAALFREALESPEHCSP
X85276_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFLSVRHLLDTAKALFQDALESPEHCSP
JN642161_HBc_P-D      MDIDLYKEFGASVELLSFLPADFFPSVRDLLDTASALFRDALESPEHCTP
AF419527_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALEPPEHCSP
AF419521_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
AB555496_HBc_P-D      MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726901_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTP
JF754631_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFYPSVRDLLDTASALYREALESPEHCTP
EU726881_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALFREALESPEHCTP
GU456673_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFYPSVRDLLDTASALYRDALESPEHCTP
JN040761_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTP
JN257202_HBc_P-D      MDIDLYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTP
JN664919_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JN664921_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JN664948_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GU456668_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
GU456638_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
FJ904445_HBc_P-D      MDIDPYKEFGASVELLSFLXVDFFPSVRDLLDTASALYREALESPEHCTP
JN040792_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040791_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040793_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754617_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAGLYREALESPEHCSA
EU787438_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726893_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726861_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725054_HBc_P-D      MDIDPYKEFGASVELLSFLPHDFFPSARDLLDTASALYREALESPEHCSP
KF471655_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSH
MH725088_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JN040769_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALYREALESPEHCSS
EU726875_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALFRDALESPEHCTP
DQ178012_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSP
AY371916_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU456675_HBc_P-D      MDIDPYKEFGASIELLSFLPSDFFPSVRDLLDTAAALYRDALESQEHCSP
EU726853_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MG491177_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
AY161150_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY161151_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY161152_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY161153_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY161154_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY161155_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY161156_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287619_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725095_HBc_P-D      MDIDPYKEFGATVELLSFLHFDFFPSVRHLLDTASALYREALESPEHCSP
KP857034_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KM524340_HBc_P-D      MDIDSYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
JN040812_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040755_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
HQ700510_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSH
HQ700478_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSA
HQ700553_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSA
DQ486025_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHWSP
JN040794_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ178011_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSP
AY741797_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY603439_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB355452_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB270549_HBc_P-D      MDIDSYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB267090_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSLRDLLDTASALYREALESPEHCSP
AB078031_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSLRDLLDTASALYREALESPEHCSP
AB078032_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSLRDLLDTASALYREALESPEHCSP
AB078033_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSLRDLLDTASALYREALESPEHCSP
MH725102_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KX357639_HBc_P-D      MDIDPYKEFGATVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSH
KJ470893_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALFRDALESPEHCSP
JF754627_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU456667_HBc_P-D      MDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSP
EU726922_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EF103281_HBc_P-D      MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EF103279_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ336688_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFLPSVRDLLDTASALYREALESPEHCSP
AY945307_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY741796_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY741795_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY721611_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY371919_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY230114_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY161158_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY161157_HBc_P-D      MDTDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324113_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324110_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324109_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB270539_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF488704_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSP
KM606752_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
FJ692532_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
FJ692533_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
GQ205384_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
JN664932_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KC774436_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSP
KC774460_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSP
KJ470889_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KU668433_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KM606744_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KM606644_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KM524361_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSP
KJ470896_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALFRDALESPEHCSP
KM524345_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
JN040809_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALFREALESPEHCSP
EU939680_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AY371912_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB090270_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB104709_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB104711_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB104712_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB109475_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB116266_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB126581_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725134_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JN040806_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040785_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ464170_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ315776_HBc_P-D      IDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AM422939_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYREALESPEHCSP
AY233292_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYREALESPEHCSP
AY233294_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYREALESPEHCSP
AY233296_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYREALESPEHCSP
MH725203_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MH725183_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MH725119_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MH725069_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYREALESPEHCSP
MH725067_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSLRNLLDTASALYREALESPEHCSP
MH725066_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSLRNLLDTASALYREALESPEHCSP
MH725019_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MH725008_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASTLYREALESPEHCSP
MH724995_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MH724980_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MH724979_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MH724976_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLHTASALYREALESPEHCSP
MH724971_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MH724964_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KP671692_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRETLKSPEHCSP
JQ707511_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYREALESPEHCSP
JQ707510_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JN792903_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALKSPEHCSP
GU456648_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726946_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU726899_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU414054_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EF103280_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EF103277_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EF103276_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EF103275_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ464169_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ464168_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ178020_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSP
DQ178019_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSP
DQ178018_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSP
DQ178017_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ178016_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSP
DQ178015_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSP
AY741794_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY721612_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY721610_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY721609_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY721606_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY721605_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY661793_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY661792_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY603443_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY603440_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY603437_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY603434_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY603428_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY603427_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY371922_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY371921_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY371920_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY371918_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY371914_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY371907_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY371905_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY371902_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY371901_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY350614_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233291_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY230112_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AJ627223_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AJ627220_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AJ131956_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF419526_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF324138_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324132_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324116_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324115_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324114_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF324108_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF280817_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF121241_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF121240_HBc_C-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB674425_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB674407_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB674406_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB583680_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB493846_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB471857_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB471856_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB330370_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB330369_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB270543_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB246348_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB246347_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB222713_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB222712_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB222711_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB210822_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB210821_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB205127_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB205126_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725209_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYRDALESPEHCSP
MF925390_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALFREALESPEHCSP
KU668445_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALQSPEHCSP
HQ700455_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRXLLDTASALYREALESPEHCSP
JN664928_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALYREALESPEHCSP
JN664918_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALYREALESPEHCSP
EU414059_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALXSPEHCSP
EU414139_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALXSPEHCSP
AB188244_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257149_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRXLLDTASALYREALESPEHCSP
KF584161_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVXBLLBTASALYREALXSPEHCSP
KF584163_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVXBLLBTASALYREALXSPEHCSP
KF584165_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVXBLLBTASALYREALXSPEHCSP
AB555500_HBc_P-D      KDLDPYKEFGASVTLLSFLPAYFFPSVPDLLDTASALYREALESPEHVSA
GQ477453_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSP
JF754594_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTATALFRQDLESPEHVSA
AB330367_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESSEHCSP
GQ922005_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTAAALFRDALESPEHCSA
KP857031_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTVSALYREALESPEHCTP
GU456639_HBc_P-D      MDLDPYKEFGASVELLSFLPQDFYPSVRDLLDTATALYREALESPEHCSP
AF419528_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTAKALFREALESPEHCSP
MG491172_HBc_P-D      MDIDPYKEFGATVELISFLPADFFPSVRDLLDTASALYREALESSEHCTP
X80927_HBc_P-D        MDIDPYKEFGATVELLSFLPHDFFPSLRDLLDTASALYRDALESPEHXSP
X80928_HBc_P-D        MDIDPYKEFGATVELLSFLPHDFFPSLRDLLDTASALYRDALESPEHCSP
X97849_HBc_P-D        MDIDPYKEFGATVELLSFLPHDFFPSLRDLLDTASALYRDALESPEHCSP
JN688712_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRDALESPEHCSP
JF754632_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTATALYRDALESPEHCTP
AF419539_HBc_P-D      MDVDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JF754592_HBc_P-D      MDIDPYKEFGATVELLSFLPNDFFPSARDLLDTASALFRDALESPEHCSP
GU456674_HBc_P-D      MDIDPYKEFGATVQLLSFLPADFFPSVRDLLDTAAALYRDALESHDHCSP
AY371915_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESSEHCSP
KF018181_HBc_P-D      MDLDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRDALESPEHCSP
FJ904439_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCTP
FJ904435_HBc_P-D      MDIDPYKEFGATVELLSFLPFDFFPSVRDFLDSALALYRDSLEFPEPCSP
EU726897_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSA
EU726868_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFREALESPEHCTP
JN040779_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFREALESPEHCTP
MG491170_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFTSVRDLLDTASALYREALESPEHCTP
MG491158_HBc_P-D      MDIDPYKEFGATVQLLSFLPADFFPSVRDLLDTASALFRDALESSEHCSP
MG491156_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPDHCSP
JF754611_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GU456677_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
GQ922003_HBc_P-D      MDIDPYKEFGASVELLSFLPQDFFPSVRDLLDTAAALYRNALESPEHCSP
FJ904433_HBc_C-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AJ627215_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESSEHCSP
AJ627216_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESSEHCSP
AJ627218_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESSEHCSP
AF419537_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCTP
EU726952_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTP
JN040774_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTP
MG491126_HBc_P-D      MDIDPYKEFGASLELLSFLPTDFYPSVRDLLDTASALYREALESPEHCSP
X85268_HBc_P-D        MDISPYKEFGASVELLSFLPVDFFPSVRDLHDTATALYREALESPEHCSP
MH725199_HBc_P-D      MELDPYKEFGATVQLLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
KX357622_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTAAALYRDALESPEHCTP
KF018182_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JN642159_HBc_P-D      MDLDPYKEFGASVELLSFLPGDFFPSIRDLLDTASALFRDALESPEHCTP
JN040762_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRGALESSEHCSP
AF324111_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB270541_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSP
JN257160_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257161_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ904418_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257172_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257173_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X85270_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALFREALESPEHCTP
MH724960_HBc_P-D      MDIDPYKEFGATVELLSFLPHDFFPSIRDLLDTASALFREALESPEHCTP
MH724969_HBc_P-D      MDIDPYKEFGATVELLSFLPHDFFPSIRDLLDTASALFREALESPEHCTP
KP857032_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTP
KP856976_HBc_P-D      MDIDLYKEFGASVELLSFLPTDFYPSVRDLLDTAXALYRXALESPEHCTP
KC875328_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
JX036343_HBc_P-D      MDIDAYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHVSS
JN040818_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFREALESPEHCTP
JF754625_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTAKALYREALESPEHCSP
JF754593_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTATALYREALESPEHCTP
GU456672_HBc_P-D      MDIDPYKEFGATTELLSFLPMDFFPSVRDLLDTASALYREALESPEHCSH
GU456657_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSA
DQ464173_HBc_P-D      MDIDPYKEFGASVELLSFSPSDFYPSVQDLLDTALALFRDALDAPEHCSP
MG491155_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPAVRDLLDTASALYRDALESPEHCTP
MG491149_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCTP
L27106_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALFREALESPEHCSP
KX276856_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
KP857005_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCTP
KJ647355_HBc_P-D      MDIDPYKEFGASVQLLSFLPADFFPSVRDFLDTATALFRDALESPEHCSP
KJ470895_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTATALFRDALESPEHCSP
KF471640_HBc_P-D      MDIDPYKEFGASVNLLSFLPADYFPSVRDLLDTASALYREALESSEHCTP
JX036344_HBc_P-D      MDIDPYKEFGASAQLLSFLPADFFPSVRDLLDTASALYREALESPEHVSS
JN642164_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHVSP
JN642146_HBc_P-D      MDIDLYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN040766_HBc_P-D      MDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCTP
EU726975_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFRDALESPEHCSP
AJ627224_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPNVRDLLDTASALFREALESPEHCSP
GQ167301_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTP
GQ167302_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTP
GQ184322_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTP
MH725153_HBc_P-D      MDIDPYKEFGASVELLSFLPEDFFPSVRDLLDTASALYREALESPEHCTP
MH725125_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
MG491188_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALFRDALESPEHCSP
MG491159_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESSEHCSA
KP857029_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTAFALFRDALESPEHCTP
KP857006_HBc_P-D      MDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSP
KM577670_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSLRDLLDTASALYRQALEAPEHCSP
JN792908_HBc_P-D      MDIDPYKEFGASVELLSFLPIDFFPSIRDLLDTASALYRDALESPEHCSP
JN642136_HBc_P-D      MDIDPYKEFGATVQLLSFLPEDFFPSVRDLLDTASALYREALESPEHCSP
GU456644_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AY371909_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
AB674431_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSP
EU726884_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTAAALYREALESPEHCTP
JN642147_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSP
KP857015_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
JF754590_HBc_P-D      MDIDPYKEFGASVDLLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
KY629633_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464838_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVHDLLDTAKALYRDALESPEHCSP
KP857046_HBc_P-D      MDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTASALFRDALESPEHCTP
KP857019_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPTVRDLLDTASALFREALESPEHVSP
KP857000_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESHEHCSP
KP856996_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSP
KP856993_HBc_P-D      MDIDPYKEFGASVELLSFLPEDFFPSVRDLLDTASALYREALESPEHCTP
KP856975_HBc_P-D      MDIDPYKEFGASVELLSFLPQDFYPSVRDLLDTASALYRDALESPEHCTP
KM524358_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREPLESPEHCSP
KJ647352_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ470894_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCTH
JN792911_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN792912_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN687947_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN642149_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESHEHCSP
JN642140_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JN040781_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ904426_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
EU921418_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
EU726944_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040776_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ464181_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSP
AF419530_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSP
MG491187_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSP
MG491184_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KM577671_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFRDALESPEHCSP
FJ349230_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
AY371910_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFRQALESPEHCSP
AJ627222_HBc_P-D      MDIDPYKEFGASVQLLSFLPADFFPSVRDLLDTASALYREALESPEHCSH
AY371913_HBc_P-D      MDIDPYKEFGATVELVSFLPADFFPSVRDLLDTASALYREALESPEHCSP
FJ904446_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRQALESPEHCSP
X85264_HBc_P-D        MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCTP
X85261_HBc_P-D        MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
X59795_HBc_P-D        MDIDPYKEFGASMELLSFLPSDFYPSVRDLLDTASALYREALESPEHCTP
MH725172_HBc_P-D      MDLDPYKEFGGIVELLFFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725171_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCTP
MH725135_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSP
MH724962_HBc_P-D      MDIDPYKEFGASVQLLSFLPSDFFPSARDLLDTASALYREALESPEHCSP
KP857050_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857039_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KP857030_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALFREALESPQHCSP
KP857028_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFRDALESPEHCSA
KP857025_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KP856997_HBc_P-D      MDIDPYKEFGATVELVSFLPTDFYPSVRDLLDTASALYREALESPEHCTP
KP856990_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRDALESPEHCSP
JX036342_HBc_P-D      MDIDPYKEFGASAQLLSFLPADFFPSVRDLLDTASALYREALESPEHVSS
JN688678_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JN642163_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JN642162_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPPVRALLDTAQALYRDALESPEHCSP
JF754614_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
JF754607_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ904438_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU726932_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSA
AF419522_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVSALYREALESPEHCSP
AF419512_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MG491186_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MG491173_HBc_P-D      MDIDPYKEFGASVQLLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
MG491144_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESSEHCSP
X85263_HBc_P-D        MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAKALLRDALESPEHCSP
MH725126_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALFREALESPEHCSP
KT749845_HBc_P-D      MDIDPYKEFGASVELISFLPSDFFPSVRDLLATAQALYRDALESPEHCSP
KP857115_HBc_P-D      MDIDPYKEFGASVELLSFLPTDYFPSVRDLLDTARALYRDALESPEHCSP
KP671700_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSA
KM577669_HBc_P-D      MDIDPYKEFGASVELLSFLPGDYFPSVRDLLDTASALYRDALESPEHCSP
KJ647350_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
KC875342_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KX196229_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KC875301_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707682_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707683_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707684_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707685_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707686_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707687_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707688_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707689_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707690_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707691_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707692_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707693_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707694_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707695_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707696_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707697_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707698_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707699_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707700_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707701_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707702_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707703_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707704_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707705_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JQ707706_HBc_P-D      MDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
JN792905_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHVSP
JN688683_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALFRDALESPEHCSP
JN642158_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
JF754629_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESHEHCSP
HQ700458_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSA
GU456665_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTP
FJ040872_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726973_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTGSALFRDALESPEHCSP
EU726951_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU726872_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
EU726864_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSP
AJ627219_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTATALYRNALESPEHCSX
AB674420_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB270550_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MG491147_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALYREALESPEHCSP
MG491127_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSP
MG491134_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSP
MG491138_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSP
MG491168_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSP
MG491169_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSP
MG491182_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSP
MG491137_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALCREALESPEHCSP
MF925366_HBc_P-D      MDIDPYKEFGATVEILSFLPSDFFPSVRDLLDTAAALFRDALESPEHCSP
KU668444_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857017_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFYPSVRDLLDTASALYREALESPEHCTP
KM606664_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KF679990_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KF584078_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLGTASALYREALESPEHCSP
KF471659_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF471658_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875329_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFLSVRDLLDTATALYREALESPEHCSP
KX196235_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFLSVRDLLDTATALYREALESPEHCSP
KC875312_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN792904_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHVSA
JN688708_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
JN664941_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLATASALYREALESPEHCSP
JN664922_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN642157_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN642144_HBc_P-D      MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSA
JF754595_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
GU456681_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAPALYRDALESPEHCSP
GU456660_HBc_P-D      MDIDPYKEFGASVELLSFLPADFYPSVRDLLDTASALYREALESPEHCSP
FJ349211_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726906_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726880_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
AB674408_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRQALESPEHCSP
AB355456_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB270546_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB222710_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MG491183_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MG491167_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFTSVRDLLDTASALYREALESPEHCSP
X97848_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
X85277_HBc_P-D        MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X85254_HBc_P-D        MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
MH725202_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
MH725189_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
MH725045_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724978_HBc_P-D      MDIDPYKEFGASVELLSFLPQDFFPAVRDLLDTASALYREALESPEHCSP
MH724959_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY629634_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSP
KU668448_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT749828_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSP
KP857116_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALFREALESPEHCTP
KP857048_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857035_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSA
KP857021_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHVSP
KP856981_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
KM606645_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTATALYRDALESPEHCSP
KF471654_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFREPLESPEHCSP
KC875308_HBc_P-D      MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
JQ687531_HBc_P-D      MDIDPYAEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN792906_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHVSP
JN688679_HBc_P-D      MDIDPYKEFGATVELLSFLPVDFFPSVRDLLDTASALYRDALESPEHCTP
JN664947_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
JN664926_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCTP
JN664920_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN642156_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALYRDALESPEHCTP
JN642154_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN642153_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
JN642135_HBc_P-D      MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTY
JN642132_HBc_P-D      MDIDPYKEFGASVELLSFLPQDFFPSVRDLLDTARALFREALESPEHCSP
JN642130_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257211_HBc_P-D      MDIDSYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040804_HBc_P-D      MDIDPYKEFGATVELISFLPSDFFPSVRDLLDTASALYREALESPEHCTP
JN040784_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSP
AY796031_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDNASALYRDALESPEHCSP
AB270540_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB188241_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSX
MG491191_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MG491143_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040811_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725086_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X85301_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X85280_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X85269_HBc_P-D        MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTP
MH725144_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSP
MH725139_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725094_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725033_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725031_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724968_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESREHCSP
LT992444_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196233_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196221_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU668434_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
KT749827_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KP857042_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857033_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSH
KP857022_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
KP857016_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857013_HBc_P-D      MDXDPYKEFGASVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857004_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP856986_HBc_P-D      MDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTASALYREALESPEHCSP
KM606698_HBc_P-D      MDLDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KM606690_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDAIKSPEHCSP
KM606682_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KM606654_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALYRDALESPQHCSP
KM577668_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KF779382_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCTP
KF779224_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF471641_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KF170739_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF018185_HBc_P-D      MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875334_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875289_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
JQ707509_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707497_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDRLDTTSALYREALESPEHCSP
JN792907_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN688685_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JN642151_HBc_P-D      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSP
JN642128_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257190_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JF439700_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439701_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU726931_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP090181_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724989_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB716760_HBc_P-D      LVMGHHKEFGATVELLSFLPSDFFPSVRXLLDTASAIYREALESPEHCSP
HE805987_HBc_P-D      LVMGHHKEFGATVELLSFLPSDFFPSVRXLLDTASAIYREALESPEHCSP
X85299_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X85260_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
MH725090_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF925379_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
KX276857_HBc_P-D      MDIDPYKEFGAXVELLSFLPSDFFPSVRDLLDTAXALYREALESPEHCXP
KX260231_HBc_P-D      MDIDPYKEFGASVELLSFLPTDFFPAVRDLLDTASALYREALESPEHCSP
KP857024_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN688722_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSH
JN688713_HBc_P-D      MDIDPYKEFGATVELLSFLPXDFFPXVRDLLDTASALYREALESPEHCTP
EU726885_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
AY603445_HBc_P-D      MDIDPYKEFGATVELLSFSPSDFFPSVRDLLDTASALYREALESPEHCSP
AB205128_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB090268_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
MG491175_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X85318_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPRHCSP
X85298_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X85279_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAKALFREALESPEHCSP
X85259_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X02496_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDNASALYREALESPEHCSP
MH725210_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725204_HBc_P-D      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
MH725201_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725197_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
MH725196_HBc_P-D      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
MH725173_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725169_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725161_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725142_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYWEALESPEHCSP
MH725136_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYWEALESPEHCSP
MH725124_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725108_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725103_HBc_P-D      MDIDPYKEFGATVELLSFLPSDSFPSVRDLLDTASALYREALESPEHCSP
MH725100_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREPLESPEHCSP
MH725099_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREPLESPEHCSP
MH725098_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREPLESPEHCSP
MH725097_HBc_P-D      MDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSP
MH725092_HBc_P-D      MDIDPYKEFGATVELLSFLPFDFFPSVRDLLDTASALYREALESPEHCSP
MH725091_HBc_P-D      MDIDPYKEFGATVELLSFLPFDFFPSVRDLLDTASALYREALESPEHCSP
MH725071_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725047_HBc_P-D      MDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725022_HBc_P-D      MDIDSYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725014_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH725005_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFSSVRDLLDTASALYREALESPEHCSP
MH725001_HBc_P-D      MDIDPYKEFGATVELLSFSPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724999_HBc_P-D      MDIDPYKEFGATVELLSFVPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724984_HBc_P-D      MDIDPYREFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724970_HBc_P-D      MDIDSYKEFGATVELISFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX827292_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX357638_HBc_P-D      MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196232_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196228_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
KX196226_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196225_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196224_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196220_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196217_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU668447_HBc_P-D      MDIDPYKEFGVTVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU668442_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU668439_HBc_P-D      MDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYREALESPEHCSP
KP857109_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPAHCSP
KP857026_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
KP856978_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
KP671698_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP090178_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM524348_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM524347_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798281_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779289_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779225_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYREALESPEHCSP
KF779218_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF018195_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875341_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KC875337_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875324_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875323_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875322_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875320_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875318_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875315_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875314_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPPVRDLLDTASALYREALESPEHCSP
KC875307_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875304_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875300_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875296_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSP
KC774459_HBc_P-D      MDIDTYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC774445_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707530_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707529_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707528_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707527_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707526_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707525_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707524_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707523_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707522_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707521_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707520_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707519_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707518_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707517_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707516_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707515_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707514_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707513_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707512_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707506_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707498_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707491_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707486_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ707483_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN697591_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN664924_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN642167_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESCEHCSP
JN642134_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN642133_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN558564_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN558563_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN558562_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN558561_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257205_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257186_HBc_P-D      MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MG491146_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X85302_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREAFECSEHCSP
X85255_HBc_P-D        MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTSSALFRDALESPEHCTP
MH725194_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724996_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724977_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724967_HBc_P-D      MDIDPYKEFGATVELLSFLPSDLFPSVRDLLDTASALYREALESPEHCSP
MH724966_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724965_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724961_HBc_P-D      MDIDPYKEFGATVELLSFLPSDLFPSVRDLLDTASALYREALESPEHCSP
MF925383_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX827300_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196234_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196222_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU736926_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESXEHCSP
KT749855_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSP
KT749821_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KT366491_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KR905423_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857007_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP856984_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
KP090179_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606697_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KM606686_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KJ843187_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ647353_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
KF779220_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF679995_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF471660_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF471642_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSA
KC875331_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875317_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX310735_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN664939_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
JN257162_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
MG491192_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MG491190_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MG491181_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MG491165_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MG491161_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MG491157_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MG491136_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725148_HBc_P-D      VDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725115_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725076_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725034_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725028_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU668437_HBc_P-D      RDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT963508_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
KP995100_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSP
KP857036_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857023_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSP
KP857020_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779229_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF061170_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464847_HBc_P-D      ----PYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
Z35716_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
Y07587_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X85308_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X85297_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X85294_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X72702_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
V01460_HBc_P-D        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725211_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725208_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725207_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725206_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725205_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725198_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725195_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725193_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725191_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725190_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725188_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725187_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725185_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725184_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725182_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725181_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725180_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725179_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725178_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725176_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725175_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725174_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASPLYREALESPEHCSP
MH725170_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725168_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725166_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725165_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725164_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725163_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725162_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725160_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725159_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725158_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725157_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725156_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725155_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725154_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725149_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725146_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725145_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725143_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725140_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSH
MH725138_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725137_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725133_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725132_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725131_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725129_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725128_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725127_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725122_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725121_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725120_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725117_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725116_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725107_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725106_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725105_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725104_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725093_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725089_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725087_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725085_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725084_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725083_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725082_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725078_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725077_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725075_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725074_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725073_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725072_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725070_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725063_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725062_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725061_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725060_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725059_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725058_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725057_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725056_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725055_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725053_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725052_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725051_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725049_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725048_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725046_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725044_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725041_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725040_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725039_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725037_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725036_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725035_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725032_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725030_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725029_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725027_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725026_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725025_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725023_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725018_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725017_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725016_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725015_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725013_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725012_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725011_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725009_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725007_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725006_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725004_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725003_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH725002_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724998_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724997_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724991_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724990_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724987_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724986_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724985_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724983_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724982_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724981_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724975_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724974_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724973_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724972_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724963_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724958_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724956_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724955_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724954_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464844_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH464843_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MG686619_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASPLYREALESPDHCSP
MF925393_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF925391_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF925364_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF925363_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF925358_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF618349_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
MF618348_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF618343_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF618342_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF618341_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF618340_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF618339_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LT992454_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LT992439_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LT992438_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LK995395_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LK995394_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LK995390_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LC365689_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY382414_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY382412_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY353921_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY353920_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY353914_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KY353911_HBc_P-D      MDIDPYKEFGATVKLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX827301_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX827290_HBc_P-D      MDIDPYKEFGATVELLSFLPSGFFPSVRDLLDTASALYREALESPEHCSP
KX196236_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196231_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196219_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196216_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196215_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KX196214_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU736925_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU736924_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU668449_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU668446_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU668441_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU668438_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU668436_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU668435_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KT366511_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366510_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366509_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366508_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366507_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KT366506_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366502_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366500_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366498_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366497_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KT366496_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366495_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366494_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366493_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366465_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT347090_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT151620_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KR905424_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857107_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857106_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857105_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857104_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857100_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857099_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857097_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857094_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857051_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857027_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857008_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP857003_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP671699_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP671697_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP671696_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP671695_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSS
KP671694_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP671693_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP671691_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP671690_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP671689_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP671688_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP671687_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP671686_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP671685_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP671684_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP322601_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP322600_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP322599_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP090180_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP090177_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM606753_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM524355_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM524354_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM524353_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM524352_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM524351_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM524350_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM524349_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM524346_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM524341_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM524339_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM519455_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF922432_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF896606_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798307_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798306_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF798299_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798283_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798282_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF798273_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798260_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779377_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779376_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779341_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779340_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779318_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779303_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779302_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779301_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779296_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779292_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779288_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779285_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779230_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779228_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779222_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779217_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779216_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779214_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF779212_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779209_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF679998_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF679997_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF679996_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF679994_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF679993_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF679992_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF679989_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF584166_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF584164_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF584162_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF471652_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF471651_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF471650_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF471647_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF471645_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF061168_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREXLESPEHCSP
KF018194_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF018191_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF018190_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF018189_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF018187_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF018184_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF018180_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875336_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875332_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875325_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875321_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875319_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875316_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875311_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875310_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875309_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875306_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875297_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875294_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875293_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875285_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875282_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875280_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875279_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875278_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875277_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875276_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC875275_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC774462_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC774444_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC774440_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC774437_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JX898697_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX898694_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX898692_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX898691_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX898689_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX310734_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX310733_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX096958_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX096957_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX096956_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX096954_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707504_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSS
JQ707495_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707492_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707477_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287621_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287620_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287618_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287617_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287616_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287615_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287614_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287613_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287612_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287611_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287610_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287609_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287608_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287607_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287606_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287605_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287604_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287603_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287602_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ287601_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN792910_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN792909_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN664938_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN664937_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN664936_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN664931_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
JN664930_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN664927_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN664917_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN664914_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN664913_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN664912_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN664911_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN642166_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCSP
JN642142_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSH
JN642138_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSY
JN642131_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257203_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257201_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257200_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257199_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257196_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257194_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257193_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257188_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257187_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257185_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257182_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257181_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464840_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464845_HBc_P-D      --IDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464831_HBc_P-D      --IDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366499_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP856989_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRNALESPEHCSA
JN642129_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSA
MH464836_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464854_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464834_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHSSP
JN257178_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH464832_HBc_P-D      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP995092_HBc_P-D      -DIDPYKEFGASVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSP
MH464848_HBc_P-D      ---DPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSH
MH464833_HBc_P-D      ---DPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464842_HBc_P-D      ---SPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464849_HBc_P-D      ---DPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF754609_HBc_P-D      MDIDPYKEFGASVQLLSFLPEDFFPSVRDLLDTASALYREALESPEHCTP
MK052950_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTP
MK052949_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
MK052961_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
MK052959_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESSEHCTP
MK052958_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTP
MK052955_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTP
MK052953_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
MK052951_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
MK052956_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTP
MK052960_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
MK052963_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
MK052966_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
MK052971_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
MK052974_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
MK052948_HBc_P-D      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
MK052954_HBc_P-D      MDIDPYKGFGAPVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
                               *    :: *                  :             

X85278_HBc_P-D        HHTALRQAIICWAELMTLATWVGGNLEDPTSRDLVVGYVNSNMGLKFRQL
GQ922000_HBc_P-D      HHTAIRQAILCWGELMTLATWVGVNLEDPTFRERVVSYVNDNMGLKFRQL
JN257183_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLIVGYVNTTVGLKFRQL
KP857049_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVGYVNTTVGLKFRQL
FJ904410_HBc_P-D      HHTALRQAILCWGDVMNIATWVGVNLQDQASRDQVVNYVNSNMGLKFRQL
AB674416_HBc_P-D      HHTALRQAILCWGDLMSLATWVGGNLEDQRSRDLVVTYVNANMGIKFRQL
AB048701_HBc_P-D      HHTALRHVCLCWGDLMNLATWVGTNLEDQASRDLVVSYVNTNMGLKFRQL
AB674424_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVTYVNTNMGLKFRQL
JQ927384_HBc_P-D      HHTTLRQAILCWGELMNLATWVGANLQDQASRDLVVNYVNTNMGLKFRQL
KP168419_HBc_P-D      HHTTLRQAILCWGELMNLATWVGANLQDQASRDLVVNYVNTNMGLKFRQL
EU726929_HBc_P-D      HHTAIRQAILCWGELMSLATWVGGNLEDPTSRDLVVSYVNTNMGIKFRQL
MG491162_HBc_P-D      HHTAIRQACLCWGELMNLATWVGGNLEDPMSRDLVVSYVNTNMGLKFRQL
JF754626_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDQTSRDLVVSYVNTHMGLKFRQL
DQ329356_HBc_P-D      HHTALRQAILCWRDLMTLATSVGANLEDPASRDLVVSYVNTNIALKFRQL
AB674417_HBc_P-D      HHTALRQACLCWGELMTLATWVGGNLEDPRSRDLVVSYVNTNMGLKFRQL
AB674418_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPRSRDLVVSYVNTNMGLKFRQL
FJ904422_HBc_P-D      HHTALRQAILCWGDLMNLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
EU726871_HBc_P-D      HHTALRQACLCWGELMTLATWVGTNLEDQASRDLVVQYVNTNMGLKFRQL
AB119253_HBc_P-D      HHTALRQAILCWGELMSLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
GQ924652_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
AB210820_HBc_P-D      HHTAIRQAILCWGELMTLATWVGVNLEDQPSRDLVVSYVNTNMGLKFRQL
AB119252_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
AB119251_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDQASRDLVVSYVNTNMGLKFRQL
AB110075_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
AB120308_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
JN642148_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDQASRDLVVSYVNTNMGLKFRQI
AB109477_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
AB109479_HBc_P-D      HHTAIRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JF754602_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AY371917_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
KM606675_HBc_P-D      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
EU726945_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726947_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040799_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
GQ477456_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLDDPQSRDLVVSYVNTNVGLKFRQL
AF043594_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLQDPASRELVVTYVNINMGLKFRQL
KP856977_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
AB270537_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLQDPASRDQVVSYVNTNMGLKFRQL
EU726926_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
AB104710_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVTYVNTHMGLKFRQL
GU456651_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
AJ344116_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
AB119254_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTHMGLKFRQL
GU456640_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
AB674411_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
EU594434_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
JN040757_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
JF754621_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLQDPASRDQVVSYVNTNMGLKFRQL
DQ304548_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
DQ304549_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
DQ304547_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
AY236162_HBc_P-D      HHTALKQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
AB674429_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLQDPVSRDLVVRYVNTNMGLKFRQL
DQ304550_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
DQ304551_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
FJ349233_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
JN040821_HBc_P-D      HHTALRQAVLCWGELMTLATWVGGNLQDPVSRDLVVSYVNTNMGLKFRQL
EU185779_HBc_P-D      HHTALRQAVLCWGELMTLATWVGGNLEDPASRDLVVGYVNTNMGLKFRQL
JX470760_HBc_P-D      HHTALRQAVLCWGELMTLATWVGGNLEDPASRDLVVGYVNTNMGLKFRQL
KC012652_HBc_P-D      HHTALRQAVLCWGELMTLATWVGGNLEDPASRDLVVGYVNTNMGLKFRQL
AY796030_HBc_P-D      HHTALRQAVLCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
DQ464182_HBc_P-D      HHTALRQAVLCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KC875298_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875290_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KX196209_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KX196212_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
FJ349213_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVGYVNTNMGLKFRQL
HQ236015_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
JF439695_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU155893_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF121239_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JF754606_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JF439704_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF439705_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700472_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726849_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY090453_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU155895_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU726912_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JF754623_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JF754599_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
FJ349235_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
HQ700474_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
DQ111986_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPXSRDLVVSYVNTHMGLKFRQL
AF043593_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
AF121242_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726892_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTHMGLKFRQL
JN040780_HBc_P-D      HHTAIRQAIICWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
GU456643_HBc_P-D      HHTALRQAILCWGDLINLSTWVGGNLEDPTSRDLVVSYVNTTIGLKFRQL
GU456635_HBc_P-D      HHTALRQAFLCWGELMNLATWVGVNLEDPASRELVVSYVNTNMGLKFRQL
AF419538_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTHMGLKIRQL
JN040768_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JF754612_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNMGIKFRQL
JF754600_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPTSRDLVVSYVNSNMGLKFRQL
GU456682_HBc_P-D      HHTALRQAFLCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
DQ486023_HBc_P-D      HHTALRQAILCWGDLLNLSTWVGGNLQDQTSRDLVVTYVNTNMGLKFRQL
AF419523_HBc_P-D      HHTAIRQAVLCWGELMTLATWVGVNLEDPSSRDLVVSYVNTNMGLKFRQL
AB674410_HBc_P-D      HHTALRHVFLCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KF018177_HBc_P-D      HHTAIRHVFLCWGDLMNLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
JF754622_HBc_P-D      HHTALRQAILCWGDLMNLGTWVGANLQDQHSRDQVVSYVNTNMGLKFRQL
GU456659_HBc_P-D      HHTALRQAILCWGDLINLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456650_HBc_P-D      HHTALRQAFLCWGELMNLATWVGGNLEDPTSRDLIVSYVNTNMGLKFRQL
EU726979_HBc_P-D      HHTALRQAILCWGELMTLATWVGSNLDDPTSRDLVVSYVNTHMGLKFRQL
AY741798_HBc_P-D      HHTALRQAILCWGELMSLATWVGGNLEDQQSRDLVVSYVNTNMGLKFRQL
GU456679_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
GU456666_HBc_P-D      HHTALRHACLCWGDLMNLATWVGGNLEDPTSRDLVVSYVNSNMGLKFRQL
GU456658_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
GU456647_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
GU456637_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ904415_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
AB674423_HBc_P-D      HHTALRQAILCWGKLMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AB119255_HBc_P-D      HHTAIRQAILCWGDLMSLATWVGGNLEDPASRDLVVSYVNTNMGLKFRQL
X85273_HBc_P-D        HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MH725096_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVNTNMGLKFRQL
MH725110_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVNTNMGLKFRQL
MH725118_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVNTNMGLKFRQL
KP857041_HBc_P-D      HHTALRQAILCWGDLMNLATWVGVNLEDQPSRDLVVSYVNTNVGLKFRQL
GU456684_HBc_P-D      HHTALRQAILCWGELMSLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456664_HBc_P-D      HHTALRQAILCWGDLMNLATWVGSNLEDPVSRDLVVSYVNTNVGLKFRQL
GU456654_HBc_P-D      HHTALRQAILCWGELMSLATWVGGNLEDQQSRDLVVSYVNTNMGLKFRQL
FJ904429_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPTSRDLVVSYVNSHMGLKFRQL
EU787439_HBc_P-D      HHTALRQAILCWGELMTLATWGGGNLEDPISRDLIVSYVNTNMGLKFKQL
EU726969_HBc_P-D      HHTALRQAILCWGDLINLSTWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
EU726941_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVGYVNTTMGLKFRQL
EU726891_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
JN040773_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
EU726855_HBc_P-D      HHTALRQAILCWGDLINLSTWVGGNLEDQTSRDLIVNYVNSNMGLKFRQL
AB674419_HBc_P-D      HHTALRQAILCWGELMSLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
KP857037_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN040771_HBc_P-D      HHTAIRQAVLCWGELMSLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ904419_HBc_P-D      HHTALRQAILCWGELLSLSTWVGVNLDNQASRDLVVGYVNTNMGLKFRQL
AF419529_HBc_P-D      HHTALRQAVLCWGDLMTLATWVGANLEDPTSRDLVVSYVNTTVGLKFRQL
JN040800_HBc_P-D      HHTALRQEILCWGELMNLATWVGGNLEDQTSRDLVVNYVNTNMGLKLRQL
JN040801_HBc_P-D      HHTALRQEILCWGELMNLATWVGGNLEDPTSRDLVVNYVNTNMGLKLRQL
EU726904_HBc_P-D      HHTALRHVSLCWGDLMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040775_HBc_P-D      HHTALRHVSLCWGDLMNLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KM606655_HBc_P-D      HHTALRQAVLCWGDLMTLATWVGTNLEDPTSRDLVVSYVNTNAGLKFRQL
JN040797_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JF754619_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
GU456656_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
GQ477458_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVGYVNTNMGLKFRQL
EU726933_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPPSRDLVVSYVNTNMGLKFRQL
DQ315778_HBc_P-D      HHTALRQAILCWGDLINLSTWVGSNLEDPASRDLVVSYVNTNMGLKLRQL
AB674415_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
AB674403_HBc_P-D      HHTALRQAILCWGDLTTLATWVGGNLEDPTSRDLVVSYVNTNVGLKFRQL
AB555501_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPSSRDLVVSYVNTNMGLKFRQL
JN257153_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLQDPVSRDLVVSYVNTNMGLKFRQL
JN257195_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLQDPVSRDLVVSYVNTNMGLKFRQL
JN040830_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNVGLKFRQL
JF754603_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTHMGIKFRQL
GU456683_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456655_HBc_P-D      HHTALRQAFLCWGELMNLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456646_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456636_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
FJ904395_HBc_P-D      HHTALRQATLCWGELMQLATWVGANLEDQTSRDLVVSYVNTNMGLKFRQL
FJ349220_HBc_P-D      HHTAIRQAILCWGELMNLATWVGGNLDDPTSRDLVVSYVNNNMGLKFRQL
FJ349208_HBc_P-D      HHTALRQACLCWGELMTLATWVGANLEDQASRDLVVSYVNTNMGLKFRQL
EU726873_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726848_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTHMGLKFRQL
EU594404_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
DQ336683_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRHL
AY603433_HBc_P-D      HHIALRQAILWWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
AY090452_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDQASRDLVVSYVNTNMGLKFRQM
AF419532_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLDDPASRDLVVSYVNNNMGLKFRQL
AB674413_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLQDPVSRDQVVGYVNTTVGLKFRQL
KP857018_HBc_P-D      HHTALRQAIICWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
JN040819_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQI
JN040795_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN040778_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDQTSRDLVVSYVNTNMGLKFRQL
JN040765_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JF754634_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
JF754630_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456652_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDQTSRDLVVSYVNTHMGLKFRQL
GQ922004_HBc_P-D      HHTALRQAILCWGDLMNLATWVGTNLEDPASRDQVVSYVNTNVGLKFRQL
FJ904399_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
FJ899792_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNMEDPVSRDLVVSYVNTNVGLKFRQL
EU726856_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNIALKFRQL
DQ486021_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ399006_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
DQ336690_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ336686_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
AY236164_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ336689_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ486022_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
AB674428_HBc_P-D      HHTAIRQAVLCWGELITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AB674427_HBc_P-D      HHTALRQAILCWGDLMNLATWVGSNLEDPVSRDLVVSYVNTNVGLKFRQL
MG491174_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AY236160_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ329357_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ336675_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ336676_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ336677_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ336678_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ336679_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ336685_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ336687_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ336691_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ336692_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ464174_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ464176_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ464177_HBc_P-D      HHTALRQAILCWGNLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
DQ464178_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
FJ349219_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MG491152_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN688695_HBc_P-D      HHTAIRQAILCWGELMTLAPWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN257176_HBc_P-D      HHTALRQAILCWGELMXLATWVGGNLZDPTSRDLVVTYVNTNMGLKFRQL
JN257177_HBc_P-D      HHTALRQAILCWGELMXLATWVGGNLZDPTSRDLVVTYVNTNMGLKFRQL
HQ700463_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
EU939681_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
EU726925_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456676_HBc_P-D      HHTALRQAILCWGDLINLSTWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
KP857038_HBc_P-D      HHTALRQAILCWGDLINLSTWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
FJ904432_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
MH725050_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVSYVNSQVGLKFRQL
MH725109_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVSYVNSQVGLKFRQL
EU726879_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
HQ833469_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
JN664910_HBc_P-D      HHTALRQAILCWGELMNLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
JN688710_HBc_P-D      HHTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
MH725177_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
KP857117_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTTAGLKFRQL
KP857110_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
KP857043_HBc_P-D      HHTALRQAILCWGDLMNLATWVGANLEDPASRDLVVSYVNTNVGLKFRQL
KM606755_HBc_P-D      HHTALRQAILCWGDLMTLATWVGTNLEDPTSRDLVVSYVNTNAGLKFRQL
KM606670_HBc_P-D      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVNYVNTNAGLKFRQL
KC875330_HBc_P-D      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875305_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ687530_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JN257165_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNVGLKFRQL
JN257166_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNVGLKFRQL
JN132132_HBc_P-D      HHTALRQATLCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN132128_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN132127_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040814_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
JN040802_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPASRDLVVSYVNTNMGLKFRQL
JN040796_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTHMGLKFRQL
JN040772_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPASRDLVVSYVNTNMGLKFRQL
JF754598_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
HQ700481_HBc_P-D      HHTALRHVILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700439_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTTAGLKFRQL
HQ641710_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HM042266_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GU456671_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVNYVNTNVGLKFRQL
FJ904427_HBc_P-D      HHTALRQAILCWGELMTLATWVGSNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ349214_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQSSRDLVVSYVNTNMGLKFRQL
EU921419_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726970_HBc_P-D      HHTALRQAILCWGDLMNLATWVGSNLEDPTSRDLVVSYVNTHMGLKFRQL
EU726965_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
EU726963_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNIALKFRQL
EU726961_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
JN040783_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
MH725079_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNVGLKFRQL
EU726960_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
EU726950_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726938_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
EU726847_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
DQ464175_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFKQL
AY796032_HBc_P-D      HHTALRQAILCWGELMNLATWVGSNLDDPTSRDQVVSYVNTNMGLKFRQL
AY371906_HBc_P-D      HHTALRQAILCWGELITLATWVGGNLEDPTSRDLMVSYVNTNMGLKFRQL
AY371904_HBc_P-D      HHTALTQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNVGLKFRQL
AF419540_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF419542_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB188242_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDQPSRDLVVSYVNTNVGLKFRQL
AB109478_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDQVVSYVNTNIALKFRQL
MG491148_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
AY371911_HBc_P-D      HHTALRQAILCWGDLMTLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ868011_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ477457_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
GQ922001_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JN257148_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNVGLKFRQL
JN040770_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726910_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MH725123_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN642150_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726859_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726954_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ904402_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN257159_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KC875292_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KC875333_HBc_P-D      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875326_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN688711_HBc_P-D      HHTALRQAIFCWGEXMTLATWVGXNLEDPASRDLVVSYVNTNMGLKFRQL
JN257170_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN040829_HBc_P-D      HHTALRQAILCWGDLMNLATWVGSNLEDPTSRDLVVSYVNTHMGLKFRQL
JN040817_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
JN040782_HBc_P-D      HHTALRQAILCWGELMTLATWVGSNLEDPVSRDLVVSYVNTNAGLKFRQL
JN040754_HBc_P-D      HHTALRQAILCWGDLMSLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
GU456663_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ477455_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ349217_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726958_HBc_P-D      HHTALRQAVLCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726911_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726860_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726850_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
DQ336681_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AB674430_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTTAGLKFRQL
AB270542_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNVGLKFRQL
DQ336680_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
DQ336682_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
DQ336684_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
DQ336674_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
EU726857_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNIALKFRQL
KP857114_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNVGLKFRQL
KJ470885_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNVGLKFRQL
JN132131_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040810_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN040750_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
JF754633_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JF754588_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
HQ833466_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNVGLKFRQL
GU456645_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183463_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726977_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AF419524_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
AB674405_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AB090269_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB222709_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867998_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867957_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867963_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867970_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867979_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867983_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ868005_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ868009_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AB270548_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
AB555497_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
AF151735_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
AY721607_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNVGLKFRQL
AY721608_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNVGLKFRQL
EU414055_HBc_P-D      HHTALRQAILCWGDLMTLATWXGGNLEDPVSRDLVVSYVNTNVGLKFRQL
EU414142_HBc_P-D      HHTALRQAILCWGDLMTLATWXGGNLEDPVSRDLVVSYVNTNVGLKFRQL
FJ349216_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
HQ236016_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
HQ700444_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
MH725101_HBc_P-D      HHTALRQAILCWGELMILATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KU736927_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNVGLKFRQL
KP857045_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
KF798301_HBc_P-D      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF471656_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFREL
KF471644_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KC875302_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875287_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875284_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC774477_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN642165_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
JN642143_HBc_P-D      HHTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQI
JN257169_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN132130_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN132126_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040824_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN040822_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPISRDLVVSYVNTNMGLKFRQL
JN040820_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVNTNMGLKFRQL
JN040808_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040777_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVNTNMGLKFRQL
JN040758_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JF754635_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JF754604_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
JF754597_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
HM042277_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GU456670_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
GU456661_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456653_HBc_P-D      HHTALRQAILCWGDLMSLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
GQ477454_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ477452_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNVGLKFRQL
GQ205385_HBc_P-D      HHTAFRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
GQ183475_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVHTNMGLKFRQL
FJ904424_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ904421_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
FJ904420_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
FJ349234_HBc_P-D      HHTALRQAIICWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
FJ349231_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726937_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726917_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726886_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726865_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTHMGLKFRQL
EU594422_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594408_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB119256_HBc_P-D      HHTALRQAILCWGDLMTLATWGGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB109476_HBc_P-D      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH725167_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
X85304_HBc_P-D        HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
X85303_HBc_P-D        HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
MH932714_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
MH725152_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNVGLKFRQL
MH725112_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
MH725081_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
MH725080_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
MH725065_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
MH725064_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
MH724994_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
MH724993_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
MH724988_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
KY629630_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNVGLKFRQL
KX827291_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
KF192834_HBc_P-D      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
KF192832_HBc_P-D      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
KF192831_HBc_P-D      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
KF192830_HBc_P-D      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
KF061169_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNVGLKFRQL
KF061167_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNVGLKFRQL
JQ707508_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707507_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707505_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707503_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707502_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707500_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707499_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707496_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707494_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707493_HBc_P-D      HHTALRQAILCWGKLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707490_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707489_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707488_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707487_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707485_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707484_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707482_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707481_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707480_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707479_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707478_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707476_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JN642145_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
JN664909_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
AB674404_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
HQ700489_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
X65258_HBc_P-D        HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
X65257_HBc_P-D        HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX357637_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
KP857111_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
KF471649_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNIALKFRQL
KF471646_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNIALKFRQL
JN257179_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNVGLKFRQL
JN257163_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040816_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
JN040815_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
JN040752_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JF754610_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JF754608_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
JF439718_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVSTNRGLKFRQL
JF439703_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNRGLKFRQL
JF439699_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNRGLKFRQL
JF439696_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNRGLKFRQL
JF439692_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNRGLKFRQL
HQ700483_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNVGLKFRQL
HQ700470_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNIALKFRQL
HQ700468_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
HQ700467_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
GQ183474_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ183473_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ349206_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726943_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726905_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU594412_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594411_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB674426_HBc_P-D      HHTALRQAILCWGDLMXLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
FJ867953_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867964_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867965_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867966_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867968_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867972_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867973_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867974_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867975_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867977_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867981_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867982_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867984_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867996_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ867999_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ868004_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ868010_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ868012_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ868013_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AB270547_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AF324141_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AF419516_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AY161159_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AY161160_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AY371908_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AY373431_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU594398_HBc_P-D      HHTALRQAILCWGDLITLSTWVGANLEDPASRDLVVSYVNTNMGLKFRQL
EU726876_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726957_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ349215_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183448_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183449_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183450_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183451_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183452_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183453_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183454_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183455_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183456_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183457_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183458_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183459_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183460_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183461_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183462_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183464_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183465_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183466_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183467_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183468_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ183469_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456649_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KM524338_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTTAGLKFRQL
JN040753_HBc_P-D      HHTALRQAILCWGDLMTLATWVGSNLEDPVSRDLVVSYVNTNAGLKFRQL
HQ700448_HBc_P-D      HHTALRQAILCWGXLMTLATWVGGNLEDPXSRDLVVSYVNTNXGLKFRQL
HQ700477_HBc_P-D      HHTALRQAILCWGXLMTLATWVGGNLEDPISRDLVVSYVNTNXGLKFRQL
FJ904412_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
EU414143_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU414138_HBc_P-D      HHTALRQAILCWGELMTLATWXGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU414061_HBc_P-D      HHTALRQAILCWGELMTLATWXGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU414057_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
X85295_HBc_P-D        HHTALRQAILCWGDLMSLATWVGVNLEDPISRDLVVSYVNTNMGLKFRQL
MH725186_HBc_P-D      HHTALRQAILCWGDLMSLATWGGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725151_HBc_P-D      HHTALRQAILCWGDLMSLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725150_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725147_HBc_P-D      HHTALRQAILCWGDLMSLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725130_HBc_P-D      HHTALRQAILCWGDLMSLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725113_HBc_P-D      HHTALRQAILCWGDLMSLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725111_HBc_P-D      HHTALRQAILCWGDLMSLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724992_HBc_P-D      HHTALRQAILCWGDLMTLSTWVGSNLEDPASRDLVVSYVNTNMGLKFRQL
M32138_HBc_P-D        HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KX196230_HBc_P-D      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX196227_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KX196218_HBc_P-D      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX196213_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KX196211_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KX196210_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KX196208_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KT366501_HBc_P-D      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KP857053_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP857047_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
KP857040_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KM606745_HBc_P-D      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM524356_HBc_P-D      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779223_HBc_P-D      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF471657_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KF471653_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KF018192_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KC875340_HBc_P-D      HHTALRQAILCWGELMNLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KC875335_HBc_P-D      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875313_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875303_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875299_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875295_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875291_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875288_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875286_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875283_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875281_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JX096955_HBc_P-D      HHTALRQAILCWGELMALATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707501_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN642155_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN642126_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN257171_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN257155_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN257152_HBc_P-D      HHTALRQAILCWGXLXTLXTWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN257209_HBc_P-D      HHTALRQAILCWGXLXXLXTWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN257151_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN257150_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040828_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLENPISRDLVVSYVNTNMGLKFRQL
JN040827_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040826_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040823_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040813_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040807_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040805_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040790_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
JN040788_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN040786_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040767_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN040759_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040756_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN040751_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JF754628_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JF754624_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JF754618_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JF754615_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JF754605_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JF754601_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JF754596_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JF754591_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JF439712_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HQ833471_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ833470_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ833468_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPXSRDLVVSYVNTNMGLKFRQL
HQ833467_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ833465_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700514_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700513_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700512_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700511_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700488_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700487_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700484_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700482_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700480_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700479_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700473_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700471_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700469_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700466_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700464_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700459_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700454_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700451_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700450_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700449_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700447_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700446_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700445_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700443_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700442_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700441_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ700440_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HQ236014_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
HM750156_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HM750155_HBc_P-D      HHTALRQAILCLGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HM750154_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HM750153_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HM750152_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
HM750151_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM042283_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HM042276_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HM042273_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HM042272_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
HM042267_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GU456680_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456662_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456641_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU357846_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
GQ922002_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ477459_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
GQ377589_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
GQ205389_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
GQ205388_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ205382_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
GQ205380_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
GQ183484_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ183483_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ183482_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ183481_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ183480_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
GQ183479_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ183478_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ183477_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ183476_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ183472_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ183471_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ183470_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ904443_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
FJ692507_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ692506_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ562338_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ386590_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
FJ349232_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ349229_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
FJ349228_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
FJ349218_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ349209_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ349205_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU919197_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU787447_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU787446_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU787445_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU787443_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU787442_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU787441_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU787440_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU787437_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU787436_HBc_P-D      HHTALRQAILCWGELMTLATWVGSNLEDPISRDLVVSYVNTNMGLKFRQL
EU726976_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726972_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726971_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726967_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726964_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726962_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726959_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPASRDLVVSYVNTNMGLKFRQL
EU726940_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726935_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726930_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726924_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726923_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726921_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726919_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726918_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726914_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726909_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726907_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726902_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726900_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726898_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726895_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726894_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726888_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726887_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726878_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726874_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726869_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726862_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726854_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726845_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLENPISRDLVVSYVNTNMGLKFRQL
EU726844_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU594433_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594432_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594431_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594430_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594428_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594427_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594426_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594425_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594424_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594423_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594421_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594416_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594415_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594410_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594409_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594407_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594405_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594403_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594402_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594401_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594400_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594399_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594397_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU594396_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU414140_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU414136_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU414135_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU414060_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU414058_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU414056_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU414141_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594382_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT749823_HBc_P-D      HHTALRQAILCWVELMSLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726858_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPVSRDLVVSYVNTNMGLKFRQL
X80924_HBc_P-D        HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
X80926_HBc_P-D        HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
MK052947_HBc_P-D      HHTALRQAILCWGELMSLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
MK052972_HBc_P-D      HHTALRQAILCWGELMSLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
MK052973_HBc_P-D      HHTAIRQAILCWGELMTLATWVGTNLEDPASRDLIVSYVNTNMGLKFRQL
MK052975_HBc_P-D      HHTAIRQAILCWGELMTLATWVGTNLEDPASRDLIVSYVNTNMGLKFRQL
GU456669_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVGYVNTNMGLKFRQL
MH725068_HBc_P-D      HHTAIRQAIFSLGELMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
DQ464172_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
GU456678_HBc_P-D      HHTAIRQAYLCWGELLGLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456642_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLIVTYVNTNMGLKFRQL
X85276_HBc_P-D        HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
JN642161_HBc_P-D      HHTALRQAIQCWGELMSLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AF419527_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVGSYVNTHMGLKFRQL
AF419521_HBc_P-D      HHTALRQAIICWGELMTLATWVGANLEDPASRDLVVTYVNTNMGLKFRQL
AB555496_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTHMGLKFRQL
EU726901_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTHMGLKFRQL
JF754631_HBc_P-D      HHTALRQAIICWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726881_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456673_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN040761_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
JN257202_HBc_P-D      HHTALRQAIQCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN664919_HBc_P-D      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVIMGLKIRQL
JN664921_HBc_P-D      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
JN664948_HBc_P-D      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
GU456668_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456638_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDQTSRDLVVSYVNTNMGLKFRQL
FJ904445_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN040792_HBc_P-D      HHTALRQAILCWGELMTLATWVGGKLEDPISRDLVVSYVNSNMGLKFRQL
JN040791_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNSNMGLKFRQL
JN040793_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNSNMGLKFRQL
JF754617_HBc_P-D      HHTALRQAILCWGDLINLSTWVGSNLEDPTSRDLVVSYVNTNMGLKFRQL
EU787438_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVTYVNTNMGLKFRQL
EU726893_HBc_P-D      HHTALRQAFLCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726861_HBc_P-D      HHTALRQAILWWGELMTLATWVGDNLEDPISRDLVVSYVNTHMGLKFRQL
MH725054_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNINMGLKFRQL
KF471655_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKIRQL
MH725088_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKIRQL
JN040769_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVTYVNTNMGLKFRQL
EU726875_HBc_P-D      HHTALRQAILCWGELMSLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
DQ178012_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVISYVNTNMGLKFRPL
AY371916_HBc_P-D      HHTALRQAFLCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456675_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTHMGLKFRQL
EU726853_HBc_P-D      HHTALRQAFLCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MG491177_HBc_P-D      HHTALRQAFLCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AY161150_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AY161151_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AY161152_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AY161153_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AY161154_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AY161155_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AY161156_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JQ287619_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MH725095_HBc_P-D      HHTALRQAILCWGELMTLTTWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP857034_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KM524340_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
JN040812_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLIVSYVNTNMGLKFRQI
JN040755_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
HQ700510_HBc_P-D      HHTAXRQAILCWGELMTLATWVGVNLEDPASRELVVSYVNXNMGLKFRQL
HQ700478_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
HQ700553_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
DQ486025_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
JN040794_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
DQ178011_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVFSYVNTNMGLKFRQL
AY741797_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY603439_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB355452_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB270549_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AB267090_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB078031_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB078032_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB078033_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH725102_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVNINMGLKFRQL
KX357639_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KJ470893_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVTYVNTNMGLKFRQL
JF754627_HBc_P-D      HHTALRQAVLCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456667_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726922_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EF103281_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EF103279_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
DQ336688_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY945307_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY741796_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
AY741795_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
AY721611_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLIVSYVNTNMGLKFRQL
AY371919_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY230114_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY161158_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY161157_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AF324113_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRTLVVSYVNTNMGLKFRQL
AF324110_HBc_P-D      HHTALRQAILWWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AF324109_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKLRQL
AB270539_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
MF488704_HBc_P-D      HHSALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM606752_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
FJ692532_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
FJ692533_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
GQ205384_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
JN664932_HBc_P-D      HHTALRQAILCWGELMTLATWVGSNLEDPASRDLVVSYVNTNMGLKFRQL
KC774436_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KC774460_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KJ470889_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KU668433_HBc_P-D      HHTALRQAILCWGELMTFATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KM606744_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KM606644_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KM524361_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KJ470896_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
KM524345_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
JN040809_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU939680_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY371912_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AB090270_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB104709_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AB104711_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AB104712_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AB109475_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB116266_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB126581_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MH725134_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040806_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN040785_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
DQ464170_HBc_P-D      HHTALRQAILCRGGLKTLATWVGVNLEAPASRDLVVSYVNTNMGLKFRQL
DQ315776_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM422939_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY233292_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY233294_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY233296_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH725203_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725183_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725119_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725069_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725067_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725066_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725019_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725008_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724995_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724980_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724979_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724976_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724971_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724964_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP671692_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ707511_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707510_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN792903_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GU456648_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726946_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726899_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTHMGLKFRQL
EU414054_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EF103280_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EF103277_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EF103276_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EF103275_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
DQ464169_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
DQ464168_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
DQ178020_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVTTNMGLKFRQL
DQ178019_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
DQ178018_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
DQ178017_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQI
DQ178016_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
DQ178015_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY741794_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
AY721612_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY721610_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY721609_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY721606_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY721605_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSHVNTNMGLKFRQL
AY661793_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY661792_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY603443_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY603440_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY603437_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY603434_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY603428_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY603427_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY371922_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY371921_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY371920_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY371918_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AY371914_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY371907_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY371905_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY371902_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY371901_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY350614_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY233291_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY230112_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AJ627223_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AJ627220_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AJ131956_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF419526_HBc_P-D      HHTRLRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF324138_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF324132_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AF324116_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AF324115_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AF324114_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AF324108_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AF280817_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AF121241_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AF121240_HBc_C-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AB674425_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AB674407_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AB674406_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
AB583680_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AB493846_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB471857_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB471856_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB330370_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB330369_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB270543_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AB246348_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AB246347_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AB222713_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AB222712_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AB222711_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AB210822_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB210821_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB205127_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB205126_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH725209_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MF925390_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU668445_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700455_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN664928_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN664918_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU414059_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU414139_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB188244_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN257149_HBc_P-D      HHTALRQAILCWGXLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF584161_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF584163_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF584165_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AB555500_HBc_P-D      HHTALRQAILCWGDLMNLATWVGTNLDDPASRDLVVSYVNTNMGLKFRQL
GQ477453_HBc_P-D      HHTALRQAILCWGELMNLATWVGTNLEDQGSRDLVVSYVNTHMGLKFRQL
JF754594_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLDDPTSRDQVVSYVNTNMGLKFRQL
AB330367_HBc_P-D      HHTALRQAILCWGDTLDLATWVGGNLEDQASRDLVVNYVNTKMGLKFRQL
GQ922005_HBc_P-D      HHTAIRQAVLCWGELIGLATWVGTNLEDQASRDLVVSYVNNNMGLKFRQL
KP857031_HBc_P-D      HHTAIRQAVLCWMELMKLATWVGGNLQDPVSRDLVVSYVNDNMGLKFRQL
GU456639_HBc_P-D      HHTALRQAILCWGELMSLATWVGGNLEDQTSRDLVVTYVNTNMGLKFRQL
AF419528_HBc_P-D      HHTAVRQAILCWGELMNLATWVGVNLEDQSSRDLVVSYVNTNMGLKFRQL
MG491172_HBc_P-D      HHTALRQAILCWAELMSLATWVGSNLEDQPSRDLVVSYVNTHMGLKFRQL
X80927_HBc_P-D        HHTALRQAILCWGDLMNLATWVGVNLQDPASRELVVNYVNTNMGLKFRQL
X80928_HBc_P-D        HHTALRQAILCWGDLMNLATWVGVNLQDPASRELVVNYVNTNMGLKFRQL
X97849_HBc_P-D        HHTALRQAILCWGDLMNLATWVGVNLQDPASRELVVNYVNTNMGLKFRQL
JN688712_HBc_P-D      HHTAIRQAILCWGELMNLATWVGVNLDDPTSREAITSYVNTNMGLKFRQL
JF754632_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDSTSRDLVVSYVNTNMGLKFRQL
AF419539_HBc_P-D      HHTALRQAILCWGDLMNLATWVGVNLQDQASRELVVNYVNTNMGLKFRQL
JF754592_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLDDQHSRDLVVSYVNSNMGLKFRQL
GU456674_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY371915_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KF018181_HBc_P-D      HHTALRHVILCWGDLMNLATWVGGNLEDPISRDLVVNYVNSNMGLKFRQL
FJ904439_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNNNMGLKFRQL
FJ904435_HBc_P-D      PHXALRPTLFCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU726897_HBc_P-D      HHTALRQAILCWGELMQLATWVGGNLDDPTSRDLVVGYVNTHMGLKFRQL
EU726868_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDQTSRDLVVTYVNTNMGLKFRQL
JN040779_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDQTSRDLVVTYVNTNMGLKFRQL
MG491170_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
MG491158_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPTSRDLVVHYVNENMGLKFRQL
MG491156_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
JF754611_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVGYVNTTVGLKFRQL
GU456677_HBc_P-D      HHTALRQAILCWGELMALATWVGGNLEDQTSRDLVVRYVNTNMGLKFRQL
GQ922003_HBc_P-D      HHTAIRQAILCWGELMXLATWVGANLEDQASRDLVVSYVNTNMGLKFRQL
FJ904433_HBc_C-D      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVNYVNSNMGLKFRQL
AJ627215_HBc_P-D      HHTALRQAILCWGDLMSLGTWVGGNLEDQASRDLVVNYVNSNMGLKFRQL
AJ627216_HBc_P-D      HHTALRQAILCWGDLMSLGTWVGGNLEDQASRDLVVNYVNSNMGLKFRQL
AJ627218_HBc_P-D      HHTALRQAILCWGDLMSLGTWVGGNLEDQASRDLVVNYVNSNMGLKFRQL
AF419537_HBc_P-D      HHTALRQAILCWGELMNLATWVGANLEDPASRDLVVSYVNTHMGLKFRQL
EU726952_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
JN040774_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTHMGLKFRQL
MG491126_HBc_P-D      HHTALRQAYLCWGELMSLATWVGGNLQDPVSRDQVVSYVNTNMGLKFRQL
X85268_HBc_P-D        HHTALRQAILCWGELMTLATWVGGNLEDSTSRDLVVSYVNTNMGLKFRQL
MH725199_HBc_P-D      HHTALRHVILCWGDLMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KX357622_HBc_P-D      HHTALRQAILCWGELMNLATWVGVNLEDQTSRDQVVSYVNTNMGLKFRQL
KF018182_HBc_P-D      HHTALRQAWLCWGELMNLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
JN642159_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDQASRDLVVSYVNTNMGLKFRQL
JN040762_HBc_P-D      HHTALRQAVLCWGDLINLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AF324111_HBc_P-D      HHTALRQATLCWGELMTLATWVGANLEDQASRDLVVSYVNNNMGLKFRQL
AB270541_HBc_P-D      HHTALRQAILCWGDLINLSTWVGGNLEDQTSRDLVVSYVNTNMGLKFRQL
JN257160_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVGYVNTTVGLKFRQL
JN257161_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVGYVNTTVGLKFRQL
FJ904418_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPTSRDLVVGYVNTTVGLKFRQL
JN257172_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVGYVNTTVGLKFRQL
JN257173_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVGYVNTTVGLKFRQL
X85270_HBc_P-D        HHTALRQAILCWGELMSLATWVGVNLEDQASRDLVVRYVNDHMGIKFRQL
MH724960_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVNTNMGLKFRQL
MH724969_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVNTNMGLKFRQL
KP857032_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNSSMGIKFRQL
KP856976_HBc_P-D      HHTALRQAIQCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KC875328_HBc_P-D      HHTALRQAMLCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX036343_HBc_P-D      HHTALRQAILCWGDLMSLATWVGSNLDDPTSRDLVVSYVNTNMGLKFRQL
JN040818_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
JF754625_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLDDQGSREQVVSYVNTNMGLKFRQI
JF754593_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNDNMGLKFRQL
GU456672_HBc_P-D      HHTALRQAILCWGELMSLATWVGGNLEDQTSRDLVVSYVNTNMGLKFRQI
GU456657_HBc_P-D      HHTALRQAILCWGDLTNLATWVGGNLDDPTSRDLVVSYVNTNMGLKIRQL
DQ464173_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
MG491155_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDQTSRDLVVSYVNTNMGLKFRQL
MG491149_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
L27106_HBc_P-D        HHTALRQAILCWGDVMNLATWVGGNLEDPTSRDLIVNYVNTNMGLRFRQL
KX276856_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDQPSRDLVVGYVNTNMGVKFRQL
KP857005_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNSTMGLKFRQL
KJ647355_HBc_P-D      HHTALRQATLCWGELMTLATWVGGNLEDPASRDLVVSYVNTHMGLKFRQL
KJ470895_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDQSSRDLVVSYVNTHMGLKFRQL
KF471640_HBc_P-D      HHTALRQAILCWGDLINLSTWVGSNLEDPTSRDLVVSYVNTNMGLKFRQL
JX036344_HBc_P-D      HHTALRQAILCWGDLMSLATWVGSNLDVPTSRDLVVSYVNTNMGLKFRQL
JN642164_HBc_P-D      HHTALRQAYLCWGDLMNLATWVGGNLEDPVSRDLVVGYVNNTVGLKFRQL
JN642146_HBc_P-D      HHTALRQAIQCWGELMSLATWVGSNLEDPTSRDLVVGYVNSNMGIKFRQL
JN040766_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVNTNMGIKFRQL
EU726975_HBc_P-D      HHTALRQAILCWGDLMSLATWVGGNLEDPTSRDLVVGYVNSNMGLKFRQL
AJ627224_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLDDQTSRDLVVSYVNTNMGLKFRQL
GQ167301_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVNTNMGIKFRQL
GQ167302_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVNTNMGIKFRQL
GQ184322_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVNTNMGIKFRQL
MH725153_HBc_P-D      HHTAIRQAILCWGELMSLATWVGGNLEDPISRDLVVGYVNTHKGLKFRQL
MH725125_HBc_P-D      HHTAIRQASFCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MG491188_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTHMGLKFRQL
MG491159_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
KP857029_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLADPTSRDQVVSYVNTNMGLKFRQI
KP857006_HBc_P-D      HHTALRQAILCWGELMSLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KM577670_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
JN792908_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDQGSRDLVVSYVNTNMGLKFRQL
JN642136_HBc_P-D      HHTALRQAVLCWGELMTLATWVGGNLEDQTSRDLVVTYVNTHMGLKFRQL
GU456644_HBc_P-D      HHTALRQAISCWGDLLNLSTWVGSNLEDQTSRDLVVSYVNTTSGLKFRQL
AY371909_HBc_P-D      HHTAVRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTHMGLKFRQI
AB674431_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTHMGLKFRQL
EU726884_HBc_P-D      HHTALRQAIICWGELMTLATWVGGNLEDPTSRDLVVGYVNSNMGLKFRQL
JN642147_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVGYVNSNMGLKFRQL
KP857015_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVGYVNSNMGLKFRQL
JF754590_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDSTSRDLVVGYVNSNMGLKFRQL
KY629633_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVGYVNSNMGLKFRQL
MH464838_HBc_P-D      HHTALRQAILCWGDLIXLSTWVGVNLDDQGSRDRVVSYVNTNMGLKFRQL
KP857046_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KP857019_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPTSRDLVVGYVNTTVGLKFRQL
KP857000_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDQTSRDLVVSYVNTHMGLKFRQL
KP856996_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVNTHMGLKFRQL
KP856993_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVGYVNSHMGIKFRQL
KP856975_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KM524358_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
KJ647352_HBc_P-D      HHTAIRQAILCWGELMXLATWVGVNLEDQASRDLVVSYVNNNMGLKFRQL
KJ470894_HBc_P-D      HHTAIRQAILCWGELMTLATWVGTNLEDPASRDLIVSYVNTNMGLKFRQL
JN792911_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDQVVSYVNTNMGLKFRQL
JN792912_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDQVVSYVNTNMGLKFRQL
JN687947_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVGYVNTTVGLKFRQL
JN642149_HBc_P-D      HHTALRQAILCWGDLMSLATWVGGNLEDPVSRDLVVGYVNSNMGLKFRQL
JN642140_HBc_P-D      HHTALRQAILCWGELMSLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
JN040781_HBc_P-D      HHTALRQACLCWGELMNLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ904426_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDPTSRDLVVSYVNNNMGVKFRQL
EU921418_HBc_P-D      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNVGLKFRQL
EU726944_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLQDPVSRDLVVSYVNTNMGLKFRQL
JN040776_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLQDPVSRDLVVSYVNTNMGLKFRQL
DQ464181_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGVKFRQL
AF419530_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MG491187_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MG491184_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KM577671_HBc_P-D      HHTALRQAILCWRELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ349230_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AY371910_HBc_P-D      HHTALRQAILCWGDLMSLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AJ627222_HBc_P-D      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY371913_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ904446_HBc_P-D      HHTALRQAILCWGDLMSLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
X85264_HBc_P-D        HHTALRQAILCWAELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
X85261_HBc_P-D        HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
X59795_HBc_P-D        HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
MH725172_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725171_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTHMGLKFRQL
MH725135_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVGYVNSNMGLKFRQL
MH724962_HBc_P-D      HHTAIRQAILCWGELMTLATWVGGNLEDQPSRDLVVSYVNTNMGLKFRQL
KP857050_HBc_P-D      HHTALRQAILCWGDLMTLATWVGSNLEDPVSRDLVVNYVNTTAGIKFRQL
KP857039_HBc_P-D      HHTALRQAILCWGDLINLSTWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
KP857030_HBc_P-D      HHTALRQAYLCWGELMNLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
KP857028_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNVGLKFRQL
KP857025_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
KP856997_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
KP856990_HBc_P-D      HHTALRQACICWGELMTLATWVGANLDDQASRDLVVSYVNTNMGLKFRQL
JX036342_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDPVVSYVNTNMGLKFRQL
JN688678_HBc_P-D      HHTAIRQAILCWGELMTLATWVGVNLEDPGSRDQVVSYVNTNMGLKFRQL
JN642163_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTHMGLKFRQL
JN642162_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRELVVSYVNTNMGLKFRQI
JF754614_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JF754607_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ904438_HBc_P-D      HHTALRQAVLCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726932_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
AF419522_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTHMGLKFRQL
AF419512_HBc_P-D      HHTALRQATLCWGELMTLATWVGANLEDQASRDLVVSYVNTHMGLKFRQL
MG491186_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVGYVNTTVGLKFRQL
MG491173_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVGYVNTTVGLKFRQL
MG491144_HBc_P-D      HHTALRQATLCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
X85263_HBc_P-D        HHTALRQEILCWGELMTLATWVGVNLQDQASRDLVVNYVNTNMGLKFRQL
MH725126_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVGYVNTTVGLKFRQL
KT749845_HBc_P-D      HHTALRQAILCWGDLMSLATWVGVNLEDPASREQVVSYVNTNMGLKFRQL
KP857115_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KP671700_HBc_P-D      HHTALRQAILCWGDLMSLATWVGSNLQDPTSRDLVVSYVNTNMGLKFRQL
KM577669_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASREQVVSYVNTNMGLKFRQL
KJ647350_HBc_P-D      HHTALRQAIFCWGELMHLATWEGVNLEDXASRDQVVSYVNTNMGLKFRQL
KC875342_HBc_P-D      HHTALRQAILCWGELMNLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KX196229_HBc_P-D      HHTALRQAILCWGELMNLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KC875301_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ707682_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707683_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707684_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707685_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707686_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707687_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707688_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707689_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707690_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707691_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707692_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707693_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707694_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707695_HBc_P-D      HHTALRQAILCWGELVTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707696_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707697_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707698_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707699_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707700_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707701_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707702_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707703_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707704_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707705_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707706_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN792905_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDQVVSYVNTNMGLKFRQL
JN688683_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQPSRDLVVSYVNTNMGLKFRQL
JN642158_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JF754629_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVNYVNSNMGLKFRQL
HQ700458_HBc_P-D      HHTALRQAILCWGDLMNLATWVGTNLEDQPSRDLVVGYVNTTVGLKFRQL
GU456665_HBc_P-D      HHTALRQAILCWGELITLSTWVGGNLEDPTSRELVVSYVNTNMGLKFRQL
FJ040872_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU726973_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
EU726951_HBc_P-D      HHTALRQAVLCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726872_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTHMGLKFRQL
EU726864_HBc_P-D      HHTALRQAVLCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
AJ627219_HBc_P-D      HHTALRQAILCWGDLINLSTWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
AB674420_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDQTSRDLVVSYVNTNMGLKFRQL
AB270550_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVGYVNTTVGLKFRQL
MG491147_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTHMGLKFRQL
MG491127_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MG491134_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MG491138_HBc_P-D      HHTALGQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MG491168_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MG491169_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MG491182_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MG491137_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MF925366_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTHMGLKFRQL
KU668444_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLLVSYVNSNMGLKFRPL
KP857017_HBc_P-D      HHTALRQAIICWGELMTLATWVGGNLDDPTSRDLVVTYVNTNMGLKFRQL
KM606664_HBc_P-D      HHTALRQAILCWGDLMTLATWVGTNLEDQPSRDLVVGYVNTTVGLKFRQL
KF679990_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASREQVVSYVNTNMGLKFRQL
KF584078_HBc_P-D      HHTALRQAILCWGDLMNLGTWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF471659_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVGYVNTTVGLKFRQL
KF471658_HBc_P-D      HHTALRQAILCWGDLINLSTWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875329_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX196235_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875312_HBc_P-D      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN792904_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLDDPASRDLVVSYVNTNMGLKFRQL
JN688708_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDPTSRDLVVSYVNTHMGLKFRQL
JN664941_HBc_P-D      HHTALRQAILCWGELMDLATWVGVNLEDPASRDQVVSYVNTNMGLKFRQL
JN664922_HBc_P-D      HHTALRQAILCWGEVTNLATWVGSNLEDQASRELVVSYVNTNMGLKIRQL
JN642157_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLIVSYVNTNMGLKFRQL
JN642144_HBc_P-D      HHTALRQAILCWGELINLITWVGVNLDNPASRDLVVSYVNDHMGLKFRQL
JF754595_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU456681_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVGYVNSNMGLKFRQL
GU456660_HBc_P-D      HHTALRQAVLCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
FJ349211_HBc_P-D      HHTALRQATLCWGELMTLATWVGANLEDQASRDLVVSYVNTHMGLKFRQL
EU726906_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
EU726880_HBc_P-D      HHTALRQAILCWGDLMTLATWVGSNLEDPVSRDLVVSYVNTNAGLKFRQL
AB674408_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AB355456_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
AB270546_HBc_P-D      HHTALRQATICWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AB222710_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MG491183_HBc_P-D      HHTALRQAILCWGDLLNLSTWVGGNLEDQTSRDLVVSYVNTNMGLKFRQL
MG491167_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
X97848_HBc_P-D        HHTALRQAILCWGELMTLATWVGVNLQDPASRDLVVSYVNTNMGLKFRQL
X85277_HBc_P-D        HHTALRQAILCWGELMNLATWVVVNLEDQTSRDLVVSYVNTNMGLKFRQL
X85254_HBc_P-D        HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH725202_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
MH725189_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNDNVGLKFRQL
MH725045_HBc_P-D      HHTALRQAILCWGDLMNLATWVGGNLQDPVSRDLVVSYVNSHMGLKFRQL
MH724978_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLEDQQSRDLVVSYVNTNMGLKFRQL
MH724959_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
KY629634_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KU668448_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPATRDLLLNYVNTNMGLPVLPR
KT749828_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
KP857116_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KP857048_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQGSRDLVVSYVNNNMGLKFRQL
KP857035_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTHMGLKFRQL
KP857021_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
KP856981_HBc_P-D      HHTALRQAVLCWGELMTLATWVGANLEDPSSRDLVVSYVNTHMGLKFRQL
KM606645_HBc_P-D      HHTALRQATLCWGELMTLATWVGTNLEDQASRDLVVSYVNTHMGLKFRQL
KF471654_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
KC875308_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ687531_HBc_P-D      HLSVLKQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN792906_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDQVVSYVNTNMGLKFRQL
JN688679_HBc_P-D      HHTALRQAIICWGELMTLATWVGVNLEDPGSRDLVVSYVNTNMGLKFRQL
JN664947_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN664926_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
JN664920_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPASRELVVSYVNANMGLKLRQL
JN642156_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN642154_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLIVSYVNTNMGLKFRQL
JN642153_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN642135_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNNNMGLKFRQL
JN642132_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN642130_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN257211_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN040804_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN040784_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY796031_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTHMGLKFRQL
AB270540_HBc_P-D      HHTALRQAILCWGDLMSLATWVGGNLEDPVSRDLVVGYVNTTVGLKFRQL
AB188241_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDPTSRDAVVSYVNTNMGLKFRQL
MG491191_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNIALKFRQL
MG491143_HBc_P-D      HHTALRQAILCWGELMNLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
JN040811_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVGYVNTTVGLKFRQL
MH725086_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVGYVNTTVGLKFRQL
X85301_HBc_P-D        HHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVGYVNTTVGLKFRQL
X85280_HBc_P-D        HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVNYVNTTAGLKFRQL
X85269_HBc_P-D        HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
MH725144_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLNDPTSRDLVVSYVNNNMGLKFRQL
MH725139_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MH725094_HBc_P-D      HHTALRQAILCWGDLMSLATWVGGNLEDPVSRDLVVGYVNTTVGLKFRQL
MH725033_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVTYVNTNMGLKFRQL
MH725031_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVTYVNTNMGLKFRQL
MH724968_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
LT992444_HBc_P-D      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
KX196233_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX196221_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU668434_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT749827_HBc_P-D      HHTALRQAFLCWGELMTLATWVGTNLEDQASRDLVVSYVNTNMGLKFRQL
KP857042_HBc_P-D      HHTALRQAILCWGDLMSLGTWVGGNLEDQASRDLVVSYVNTNMGLKFRQL
KP857033_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPSSRDLVVGYVNTHMGLKFRQI
KP857022_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
KP857016_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVGYVNSNMGLKFRQL
KP857013_HBc_P-D      HHTALRQAILCWGDLMXLATWVGGNLEDPVSRXLVVGYVNTXVGLKFRQL
KP857004_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
KP856986_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
KM606698_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDQASRDLVVSYVNTNMGLKFKQL
KM606690_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTHMGLKFRQL
KM606682_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KM606654_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLDDPASRDLVVSYVNTHMGLKFRQL
KM577668_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDQVVSYVNNNMGLKFRQL
KF779382_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDQASRDLVVSYVNTNMGLKFRQL
KF779224_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF471641_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTHMGLKFRQL
KF170739_HBc_P-D      HHTALRQAILCWGDLMTLTTWVGGNLEDPVSRDLVVTYVNTNMGLKFRQL
KF018185_HBc_P-D      HHTALRQAILCWGDLMSLATWVGGNLEDPTSRDLIVSYVNTNMGLKFRQL
KC875334_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875289_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ707509_HBc_P-D      HHTALRQAILCWGDLTTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707497_HBc_P-D      HHTALRQAILCWGELRTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JN792907_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN688685_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVTYVNTNMGLKFRQL
JN642151_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN642128_HBc_P-D      HHTAIRQECLCWGELMTLATWVGSNLEDQRSRDQVVSYVNTNMGLKFRQL
JN257190_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF439700_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNRGLKFRQL
JF439701_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNRGLKFRQL
EU726931_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP090181_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH724989_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AB716760_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTBMGLKFRQL
HE805987_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTBMGLKFRQL
X85299_HBc_P-D        HHTALRHVFLCWGDLMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
X85260_HBc_P-D        HHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVSYVNTNMGLKFRQL
MH725090_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MF925379_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX276857_HBc_P-D      HHTALRQAILCWGXLMTLATWVGVNLEDPASRDLVVSYVNTHMGLKFRQL
KX260231_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRELVVSYVNTNMGLKFRQL
KP857024_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
JN688722_HBc_P-D      HHTALRQAILCWGDLMNLGTWVGVNLEDQASRDRVVSYVNTNMGLKFRQL
JN688713_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQSSRDLVVSYVNNNMGXKFRQL
EU726885_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AY603445_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB205128_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRGLVVSYVNTNMGLKFRQL
AB090268_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MG491175_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
X85318_HBc_P-D        HHTALRQAILCWGELMTSASWVGVNLEDPASRDLVVSYVNTNMGLKPRQL
X85298_HBc_P-D        HHTALRHAILCWGDLRTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
X85279_HBc_P-D        HHTALRQAILCWGELMTLATWVGVNLEDQASRDVVVSYVNTNMGLKFRQL
X85259_HBc_P-D        QHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
X02496_HBc_P-D        HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725210_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKIRQL
MH725204_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725201_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKIRQL
MH725197_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725196_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725173_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725169_HBc_P-D      YHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725161_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MH725142_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725136_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725124_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MH725108_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
MH725103_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725100_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725099_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725098_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725097_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRELVVSYVNTNMGLKFRQL
MH725092_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725091_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725071_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNANMGLKFRQL
MH725047_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725022_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725014_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MH725005_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725001_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724999_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
MH724984_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724970_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
KX827292_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX357638_HBc_P-D      HHTALRHVILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX196232_HBc_P-D      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX196228_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KX196226_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KX196225_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX196224_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX196220_HBc_P-D      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX196217_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU668447_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU668442_HBc_P-D      HHAPLRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU668439_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KP857109_HBc_P-D      HHTALRQATICWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KP857026_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KP856978_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
KP671698_HBc_P-D      HHTALRQAILCWGKLMTLATWVGGNLEDPISRDLVVSYVNSNMGLKFRQL
KP090178_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM524348_HBc_P-D      HHTALRQAILCWGELMTLATWGGGNLEDPISRDLVVSYVNTHMGLKFRQL
KM524347_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF798281_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779289_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779225_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779218_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF018195_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
KC875341_HBc_P-D      HHTALRQAILCWGELMNLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KC875337_HBc_P-D      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875324_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875323_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875322_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875320_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875318_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875315_HBc_P-D      HHTALRHAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875314_HBc_P-D      HHTALRQANLCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875307_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875304_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875300_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875296_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC774459_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KC774445_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ707530_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707529_HBc_P-D      HHTALRQAILCWGELMTLATWVGINLEDQASRDLVVSYVNTHMGLKFRQL
JQ707528_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707527_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707526_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707525_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707524_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707523_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707522_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707521_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVSTHMGLKFRQL
JQ707520_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707519_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707518_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707517_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707516_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707515_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707514_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707513_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707512_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707506_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707498_HBc_P-D      HHTALRQAILCWGDLTTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707491_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JQ707486_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JQ707483_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTHMGLKFRQL
JN697591_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN664924_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDQASRDLVVSYVNTHMGLKFRQL
JN642167_HBc_P-D      HHTALRQAIFCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
JN642134_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
JN642133_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN558564_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN558563_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN558562_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN558561_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN257205_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
JN257186_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MG491146_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
X85302_HBc_P-D        HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
X85255_HBc_P-D        HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MH725194_HBc_P-D      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MH724996_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MH724977_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
MH724967_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724966_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
MH724965_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
MH724961_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MF925383_HBc_P-D      HHTALRQAILCWGDLMTLGTWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX827300_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KX196234_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX196222_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736926_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRXL
KT749855_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQI
KT749821_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KT366491_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KR905423_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KP857007_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPXSRDLVVSYVNTNMGLKFRQL
KP856984_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTHMGLKFRQL
KP090179_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM606697_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTHMGLKFRQL
KM606686_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTHMGLKFRQL
KJ843187_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDQASRDLVVGYVNTNMGLKFRQL
KJ647353_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779220_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF679995_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF471660_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KF471642_HBc_P-D      HHTALRQAILCWGDLMSLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
KC875331_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875317_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX310735_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN664939_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN257162_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLZDXTSRDLVVXYVNXNMGLKFRQL
MG491192_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MG491190_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MG491181_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MG491165_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MG491161_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MG491157_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MG491136_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725148_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725115_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVGYVNTNMGLKFRQL
MH725076_HBc_P-D      HHTALRQAILCWGELMTLATWVGGKLEDPISRDLVVSYVNTNMGLKFRQL
MH725034_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725028_HBc_P-D      HHTALRQAILCWGELMTLATWVGGKLEDPISRDLVVSYVNTNMGLKFRQL
KU668437_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT963508_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KP995100_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDQTSRDLVVSYVNTNMGLKFRQL
KP857036_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KP857023_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
KP857020_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
KF779229_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF061170_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH464847_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
Z35716_HBc_P-D        HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
Y07587_HBc_P-D        HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
X85308_HBc_P-D        HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
X85297_HBc_P-D        HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
X85294_HBc_P-D        HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
X72702_HBc_P-D        HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
V01460_HBc_P-D        HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH725211_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725208_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725207_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725206_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725205_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725198_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725195_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725193_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725191_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725190_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725188_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725187_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725185_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725184_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725182_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725181_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725180_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725179_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725178_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725176_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725175_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725174_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725170_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725168_HBc_P-D      HHTALRQAIPCWGDLMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MH725166_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725165_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725164_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725163_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725162_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725160_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725159_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MH725158_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725157_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725156_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725155_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725154_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725149_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725146_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725145_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725143_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725140_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MH725138_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725137_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725133_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725132_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725131_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725129_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725128_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725127_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725122_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725121_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725120_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725117_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725116_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725107_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MH725106_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MH725105_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725104_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725093_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725089_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MH725087_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVSYVNTNMGLKFRQL
MH725085_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725084_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MH725083_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725082_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MH725078_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725077_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MH725075_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MH725074_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725073_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725072_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725070_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725063_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725062_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725061_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MH725060_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725059_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725058_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725057_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725056_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725055_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725053_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725052_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725051_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725049_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725048_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725046_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725044_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725041_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725040_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725039_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725037_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725036_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MH725035_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MH725032_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MH725030_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MH725029_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MH725027_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725026_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725025_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MH725023_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725018_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MH725017_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725016_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725015_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725013_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725012_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRELVVSYVNTNMGLKFRQL
MH725011_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725009_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725007_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725006_HBc_P-D      HHTALRQAILCWGKLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725004_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MH725003_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH725002_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724998_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724997_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724991_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724990_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
MH724987_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724986_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724985_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
MH724983_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724982_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724981_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724975_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724974_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MH724973_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRGLVVSYVNTNMGLKFRQL
MH724972_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724963_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724958_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724956_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724955_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH724954_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH464844_HBc_P-D      HHTALRQAVLCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
MH464843_HBc_P-D      HHTALRQAVLCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
MG686619_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MF925393_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MF925391_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MF925364_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MF925363_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MF925358_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MF618349_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
MF618348_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MF618343_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MF618342_HBc_P-D      HHTALRQAILCWGELMTFATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
MF618341_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MF618340_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MF618339_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
LT992454_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
LT992439_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
LT992438_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
LK995395_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
LK995394_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
LK995390_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPIFRDLVVSYVNTNMGLKFRQL
LC365689_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KY382414_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KY382412_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KY353921_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KY353920_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KY353914_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KY353911_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KX827301_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX827290_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX196236_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KX196231_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX196219_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX196216_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX196215_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KX196214_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KU736925_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736924_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU668449_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU668446_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU668441_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU668438_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU668436_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU668435_HBc_P-D      HHTALRQAILCWGELMTFATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KT366511_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT366510_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT366509_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT366508_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KT366507_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT366506_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT366502_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KT366500_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KT366498_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KT366497_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT366496_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT366495_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT366494_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT366493_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT366465_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT347090_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT151620_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KR905424_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KP857107_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KP857106_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP857105_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP857104_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP857100_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP857099_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP857097_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KP857094_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
KP857051_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KP857027_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KP857008_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KP857003_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQI
KP671699_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP671697_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP671696_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP671695_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP671694_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP671693_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP671691_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP671690_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP671689_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP671688_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP671687_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP671686_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP671685_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP671684_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP322601_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KP322600_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KP322599_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP090180_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KP090177_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM606753_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KM524355_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM524354_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM524353_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM524352_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM524351_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM524350_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM524349_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM524346_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM524341_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM524339_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KM519455_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF922432_HBc_P-D      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KF896606_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF798307_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF798306_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF798299_HBc_P-D      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF798283_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF798282_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF798273_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF798260_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF779377_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779376_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779341_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779340_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779318_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779303_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779302_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779301_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779296_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779292_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779288_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779285_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779230_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779228_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779222_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779217_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779216_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779214_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779212_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF779209_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF679998_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF679997_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF679996_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF679994_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF679993_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF679992_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF679989_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF584166_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF584164_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF584162_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF471652_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF471651_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF471650_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KF471647_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF471645_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KF061168_HBc_P-D      HHTALRQAILCWGXLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF018194_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTHMGLKFRQL
KF018191_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF018190_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF018189_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
KF018187_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF018184_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KF018180_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875336_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875332_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875325_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875321_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875319_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875316_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875311_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875310_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875309_HBc_P-D      HHTALSQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875306_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875297_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875294_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875293_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875285_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875282_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875280_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875279_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875278_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQP
KC875277_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875276_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC875275_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC774462_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC774444_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC774440_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KC774437_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX898697_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX898694_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX898692_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX898691_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX898689_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX310734_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JX310733_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JX096958_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX096957_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX096956_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX096954_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707504_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEAPASRDLVVSYVNTDMGLKFRQL
JQ707495_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707492_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ707477_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ287621_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287620_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287618_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287617_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287616_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287615_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287614_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287613_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287612_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287611_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287610_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287609_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287608_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287607_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287606_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287605_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287604_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287603_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287602_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JQ287601_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN792910_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN792909_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN664938_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN664937_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN664936_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN664931_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN664930_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN664927_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN664917_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN664914_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDPSSRDLVVSYVNTNMGLKFRQL
JN664913_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN664912_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN664911_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN642166_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN642142_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTHMGLKFRQI
JN642138_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN642131_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN257203_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN257201_HBc_P-D      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
JN257200_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN257199_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN257196_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN257194_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN257193_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN257188_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN257187_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN257185_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN257182_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN257181_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH464840_HBc_P-D      HHTALRQAILCWGXXMTLATWXGVNLEDPASRDLVVGYVNTNMGLKFRQL
MH464845_HBc_P-D      HHTALRQAILCWGKLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH464831_HBc_P-D      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
KT366499_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
KP856989_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
JN642129_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MH464836_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLGVSYVNTNMGLKFRQL
MH464854_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH464834_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN257178_HBc_P-D      HHTALRQAILCWGXLMTLATWVGVNLZDPASRXLVVSXVNTNMGLKFRQL
MH464832_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KP995092_HBc_P-D      HHTALRQAILCWGELMTLATWVGGNLEDQTSRDLVVSYVNTNMGLKFRQL
MH464848_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH464833_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH464842_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLXXXYXXLNMGLKFRQL
MH464849_HBc_P-D      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRXL
JF754609_HBc_P-D      HHTALRQAILCWGDLMNLATWVGSNL-EPTARDLVVSYVNTNVGLKFRQL
MK052950_HBc_P-D      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNTNMGLKFRQL
MK052949_HBc_P-D      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNNNMGLKFRQL
MK052961_HBc_P-D      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNNNMGLKFRQL
MK052959_HBc_P-D      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNTNMGLKFRQL
MK052958_HBc_P-D      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNTNMGLKFRQL
MK052955_HBc_P-D      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNTNMGLKFRQL
MK052953_HBc_P-D      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNTNMGLKFRQL
MK052951_HBc_P-D      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNTNMGLKFRQL
MK052956_HBc_P-D      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNTNMGLKFRQL
MK052960_HBc_P-D      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNTNMGLKFRQL
MK052963_HBc_P-D      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNTNMGLKFRQL
MK052966_HBc_P-D      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNTNMGLKFRQL
MK052971_HBc_P-D      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNTNMGLKFRQL
MK052974_HBc_P-D      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNTNMGLKFRQL
MK052948_HBc_P-D      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNNNMGLKFRQL
MK052954_HBc_P-D      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNNNMGLKFRQL
                                         .    ::     *           .      

X85278_HBc_P-D        LWFHISC-TFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
GQ922000_HBc_P-D      LWFHISCLTFGRDVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
JN257183_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP857049_HBc_P-D      LWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVR
FJ904410_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB674416_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPESTVIR
AB048701_HBc_P-D      LWFHISCLTFGRDLVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVR
AB674424_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPANAPILSTLPETSVIR
JQ927384_HBc_P-D      LWFHTSCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVXR
KP168419_HBc_P-D      LWFHTSCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVIR
EU726929_HBc_P-D      LWFHISCLMFGRDTVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVR
MG491162_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
JF754626_HBc_P-D      LWFHFSCIMFGRETVVEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
DQ329356_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVCLRTPPAYRPPNAPILSTLPETTVAR
AB674417_HBc_P-D      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB674418_HBc_P-D      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ904422_HBc_P-D      VWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726871_HBc_P-D      LWFHISCLTFGRDIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB119253_HBc_P-D      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GQ924652_HBc_P-D      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB210820_HBc_P-D      LWFHISCITFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB119252_HBc_P-D      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB119251_HBc_P-D      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB110075_HBc_P-D      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB120308_HBc_P-D      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN642148_HBc_P-D      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB109477_HBc_P-D      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB109479_HBc_P-D      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JF754602_HBc_P-D      LWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETAVVR
AY371917_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVR
KM606675_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
EU726945_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIR
EU726947_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIR
JN040799_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIR
GQ477456_HBc_P-D      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
AF043594_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
KP856977_HBc_P-D      LWFHVSCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB270537_HBc_P-D      LWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
EU726926_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
AB104710_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GU456651_HBc_P-D      LWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AJ344116_HBc_P-D      LWFHISCLTFGRGTVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
AB119254_HBc_P-D      LWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GU456640_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB674411_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU594434_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040757_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JF754621_HBc_P-D      LWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ304548_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
DQ304549_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
DQ304547_HBc_P-D      LWFHISCLAFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY236162_HBc_P-D      LWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB674429_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ304550_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ304551_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ349233_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040821_HBc_P-D      LWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU185779_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JX470760_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC012652_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY796030_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ464182_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC875298_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETCVVR
KC875290_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVR
KX196209_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVR
KX196212_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVR
FJ349213_HBc_P-D      LWFHISCLTFGREIVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETCVVR
HQ236015_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVR
JF439695_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVR
EU155893_HBc_P-D      LWFHISCLTFGRNTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPEVAVVR
AF121239_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETCVIR
JF754606_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
JF439704_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPTLSTLPETCVVR
JF439705_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPTLSTLPETCVVR
HQ700472_HBc_P-D      LWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVIR
EU726849_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETCVVR
AY090453_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
EU155895_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
EU726912_HBc_P-D      LWFHISCLTFGRETVSEYLVSFGVWIRTPPAYRPPNAPILSTLPEVAVVR
JF754623_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVR
JF754599_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVR
FJ349235_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVR
HQ700474_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSSLPETCVIR
DQ111986_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPIAYRPPNAPILSTLPETCVVR
AF043593_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVR
AF121242_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
EU726892_HBc_P-D      LWFHISCLTFGRETVTEYLVSFGVWIRTPPAYRPPNAPILSMLPETCVVR
JN040780_HBc_P-D      LWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GU456643_HBc_P-D      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPPYRPQNAPILSTLPETTVVR
GU456635_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
AF419538_HBc_P-D      LWFHISCLTFGRQTVIEYFVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
JN040768_HBc_P-D      LWFHISCLMFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETSVVR
JF754612_HBc_P-D      LWFHISCLMFGRDTVVEFLVSFGVWIRTPPAYRPPNAPILSTLPETCVIR
JF754600_HBc_P-D      LWFHTSCLTFGRETVLEYLVSFGVWIRTPPPYRPANAPILSTLPETAVIR
GU456682_HBc_P-D      LWFHISCLMFGRDTVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVIR
DQ486023_HBc_P-D      LWFHISCLMFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVR
AF419523_HBc_P-D      LWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNSPILSTLPETTVVR
AB674410_HBc_P-D      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVR
KF018177_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JF754622_HBc_P-D      LWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
GU456659_HBc_P-D      LWFHLSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVIR
GU456650_HBc_P-D      LWFHISCLNFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726979_HBc_P-D      LWFHLSCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
AY741798_HBc_P-D      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GU456679_HBc_P-D      LWFHISCLTFGRETVVEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
GU456666_HBc_P-D      LWFHISCLTFGRQTVVEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
GU456658_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
GU456647_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
GU456637_HBc_P-D      LWFHTSCLTFGRDTVLEFLVSFGVWIRTPPAYRPTNAPILSTLPETCVVR
FJ904415_HBc_P-D      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPEHSVVR
AB674423_HBc_P-D      LWFHTSCLTFGRQTVIEYLVSFGVWIRTPPAYRPTNAPILSTLPECTVVR
AB119255_HBc_P-D      LWFHISCLTFGRSTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
X85273_HBc_P-D        LWFHTSCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
MH725096_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
MH725110_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
MH725118_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
KP857041_HBc_P-D      LWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GU456684_HBc_P-D      LWFHTSCLTFGRDTVLEYLVSFGVWIRTPPAYRPVNAPILSTLPETCVVR
GU456664_HBc_P-D      LWFHLSCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
GU456654_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
FJ904429_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPNAYRPPNAPILSTLPETTVIR
EU787439_HBc_P-D      LGFHISCLTFGRKTVIEYLVSFGVWIPTPPAYKPPNAPILSTLPETTVVR
EU726969_HBc_P-D      LWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
EU726941_HBc_P-D      LWFHISCLTFGRQTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVR
EU726891_HBc_P-D      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPEITVVR
JN040773_HBc_P-D      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPEITVVR
EU726855_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQPYRPPNAPILSTLPETTVVR
AB674419_HBc_P-D      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP857037_HBc_P-D      LWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040771_HBc_P-D      LWFHISCLTFGRQTVLEYLISFGVWMRTPPAYRPPNAPILSTLPETSVIR
FJ904419_HBc_P-D      LWFHISCLTFGRXTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
AF419529_HBc_P-D      LWFHISCLTFGREAVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JN040800_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JN040801_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
EU726904_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040775_HBc_P-D      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KM606655_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIQSTLPETTVVR
JN040797_HBc_P-D      LWFHTSCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
JF754619_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
GU456656_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVR
GQ477458_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVIR
EU726933_HBc_P-D      LWFHISCLTFGRSTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETSVIR
DQ315778_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB674415_HBc_P-D      LWFHXSCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVIR
AB674403_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
AB555501_HBc_P-D      LWFHISCLTFGRETVLEYMVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN257153_HBc_P-D      LWFHVSCLMFGRETVVEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVIR
JN257195_HBc_P-D      LWFHVSCLMFGRETVVEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVIR
JN040830_HBc_P-D      LWFHISCLIFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JF754603_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
GU456683_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVIR
GU456655_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
GU456646_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVIR
GU456636_HBc_P-D      LWFHTSCLTFGRDTVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVR
FJ904395_HBc_P-D      LWFHISCLTFGRPTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ349220_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ349208_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726873_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVR
EU726848_HBc_P-D      LWFHISCLTFGRQTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
EU594404_HBc_P-D      LWFHTSCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
DQ336683_HBc_P-D      LWFHISCLTFGRDTVKEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY603433_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY090452_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVIR
AF419532_HBc_P-D      LWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
AB674413_HBc_P-D      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP857018_HBc_P-D      LWFHISCLCFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETXVIR
JN040819_HBc_P-D      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040795_HBc_P-D      LWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040778_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
JN040765_HBc_P-D      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPGYRPPNAPILSILPETTVIR
JF754634_HBc_P-D      LWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JF754630_HBc_P-D      LWFHISCLCFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
GU456652_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSMLPETSVVR
GQ922004_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
FJ904399_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETSVVR
FJ899792_HBc_P-D      LWFHISCLTFGRDTVLEYLVSFGVWIRAPPAFRPQNAPILSTLPETTVVR
EU726856_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ486021_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ399006_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPVYRPQNAPILSTLPETTVVR
DQ336690_HBc_P-D      LWFHISCPTFGREVVVEYLVSFGVWIRTPPAYKPPNAPILSTLPETTVVR
DQ336686_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY236164_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ336689_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ486022_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB674428_HBc_P-D      LWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
AB674427_HBc_P-D      LWFHISCLTFGKETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
MG491174_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY236160_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ329357_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ336675_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ336676_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ336677_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ336678_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ336679_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ336685_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ336687_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ336691_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ336692_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ464174_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ464176_HBc_P-D      LWFHISCLTFGREIVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ464177_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ464178_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ349219_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MG491152_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN688695_HBc_P-D      LWFHISCLTFGRQTVIEYLVSFGVWIXTPPAYRPPNAPILSTLPETTVVR
JN257176_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN257177_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HQ700463_HBc_P-D      LWFHISCLTFGRXTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
EU939681_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAFRPQNAPILSTLPETTVVR
EU726925_HBc_P-D      LWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GU456676_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVR
KP857038_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ904432_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MH725050_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MH725109_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726879_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HQ833469_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JN664910_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN688710_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MH725177_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP857117_HBc_P-D      LWFHISCLTFGRDTVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
KP857110_HBc_P-D      LWFHISCLTFGRATVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP857043_HBc_P-D      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KM606755_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KM606670_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC875330_HBc_P-D      LWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC875305_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
JQ687530_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN257165_HBc_P-D      LWFHISCLTFGRDIVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVLR
JN257166_HBc_P-D      LWFHISCLTFGRDIVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVLR
JN132132_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN132128_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPGTTVVR
JN132127_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPGTTVVR
JN040814_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040802_HBc_P-D      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040796_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVR
JN040772_HBc_P-D      LWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JF754598_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
HQ700481_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HQ700439_HBc_P-D      LWFHISCLTFGRETVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
HQ641710_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPGTTVVR
HM042266_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIHTPPAYRPPNAPILSTLPETTVVR
GU456671_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ904427_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
FJ349214_HBc_P-D      LWFHISCLTFGREVVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
EU921419_HBc_P-D      LWFHVSCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726970_HBc_P-D      LWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
EU726965_HBc_P-D      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
EU726963_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726961_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JN040783_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
MH725079_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
EU726960_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726950_HBc_P-D      LWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
EU726938_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVVR
EU726847_HBc_P-D      LWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ464175_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY796032_HBc_P-D      LWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY371906_HBc_P-D      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY371904_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVLIRTPPAYRPPNAPILSTLPETTVVR
AF419540_HBc_P-D      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AF419542_HBc_P-D      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB188242_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
AB109478_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIR
MG491148_HBc_P-D      LWFHISCLTFGRDTVVEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
AY371911_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ868011_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GQ477457_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
GQ922001_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JN257148_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JN040770_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726910_HBc_P-D      LWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MH725123_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN642150_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726859_HBc_P-D      LWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726954_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ904402_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN257159_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC875292_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC875333_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
KC875326_HBc_P-D      LWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN688711_HBc_P-D      LWFHISCLTFGRETVVEYLVFFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN257170_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040829_HBc_P-D      LWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
JN040817_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JN040782_HBc_P-D      LWFHISCLTFGRETVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETSVIR
JN040754_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GU456663_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
GQ477455_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ349217_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
EU726958_HBc_P-D      LWFHISCLAFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726911_HBc_P-D      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726860_HBc_P-D      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
EU726850_HBc_P-D      LWFHISCLTFGRDTVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
DQ336681_HBc_P-D      LWFHISCLTFGRDTVTEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB674430_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
AB270542_HBc_P-D      LWFHISCLTFGRDTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
DQ336680_HBc_P-D      LWFHISCLTFGRDTVTEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
DQ336682_HBc_P-D      LWFHISCLTFGRDTVTEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
DQ336684_HBc_P-D      LWFHISCLTFGRDTVTEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
DQ336674_HBc_P-D      LWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726857_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP857114_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KJ470885_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN132131_HBc_P-D      LWFHISCLTFGGETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040810_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
JN040750_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
JF754633_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPQNAPILSTLPETTVVR
JF754588_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVR
HQ833466_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
GU456645_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
GQ183463_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726977_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
AF419524_HBc_P-D      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB674405_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
AB090269_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB222709_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ867998_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVR
FJ867957_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ867963_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ867970_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ867979_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ867983_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ868005_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ868009_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB270548_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB555497_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRSPQAYRPPNAPILSTLLETTVVR
AF151735_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY721607_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY721608_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU414055_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
EU414142_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
FJ349216_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HQ236016_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HQ700444_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MH725101_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYKPPNAPILSTLPETTVVR
KU736927_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP857045_HBc_P-D      LWFHISCLTFGRDTVIEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
KF798301_HBc_P-D      WWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KF471656_HBc_P-D      LWFHISCLTFGRETGIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KF471644_HBc_P-D      LWFHVSCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC875302_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
KC875287_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
KC875284_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
KC774477_HBc_P-D      LWFHISCLTFGKKTVIEYLVSFGVWIPTPPAYRPPNAPILSTLPETTVVR
JN642165_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JN642143_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN257169_HBc_P-D      LWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN132130_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN132126_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040824_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040822_HBc_P-D      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040820_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
JN040808_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVR
JN040777_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040758_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JF754635_HBc_P-D      LWFHISCLTFGRETVTEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JF754604_HBc_P-D      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JF754597_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
HM042277_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GU456670_HBc_P-D      LWFHISCLTFGRDVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GU456661_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GU456653_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GQ477454_HBc_P-D      LWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVR
GQ477452_HBc_P-D      LWFHISCLTFGRDTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
GQ205385_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GQ183475_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ904424_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVVR
FJ904421_HBc_P-D      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ904420_HBc_P-D      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ349234_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ349231_HBc_P-D      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726937_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726917_HBc_P-D      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726886_HBc_P-D      LWFHISCLTFGKETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726865_HBc_P-D      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
EU594422_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU594408_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
AB119256_HBc_P-D      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSSLPEITVVR
AB109476_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MH725167_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
X85304_HBc_P-D        LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
X85303_HBc_P-D        LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MH932714_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
MH725152_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
MH725112_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MH725081_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
MH725080_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
MH725065_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
MH725064_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
MH724994_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
MH724993_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MH724988_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KY629630_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KX827291_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KF192834_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
KF192832_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
KF192831_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
KF192830_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
KF061169_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
KF061167_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707508_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707507_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707505_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707503_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707502_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707500_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707499_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707496_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707494_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707493_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JQ707490_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707489_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707488_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707487_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707485_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707484_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JQ707482_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707481_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707480_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707479_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707478_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JQ707476_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JN642145_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN664909_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
AB674404_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
HQ700489_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
X65258_HBc_P-D        LWFHISCLTFGRETVIEYLVAFGVWIRTPPAYRPPNAPILSTLPETTVVR
X65257_HBc_P-D        LWFHISCLIFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KX357637_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP857111_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KF471649_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KF471646_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN257179_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN257163_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040816_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040815_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JN040752_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSILPETTVVR
JF754610_HBc_P-D      LWFHISCLTFGKQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JF754608_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
JF439718_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVR
JF439703_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVR
JF439699_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVR
JF439696_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVR
JF439692_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVR
HQ700483_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HQ700470_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HQ700468_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
HQ700467_HBc_P-D      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GQ183474_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GQ183473_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ349206_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726943_HBc_P-D      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU726905_HBc_P-D      LWFHISCLSFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU594412_HBc_P-D      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVV