HBVdb

Dataset for protein MHBs of genotype D

[Download (right click)] [Edit] [Sequences] [Repertoires]

1403 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


GQ477455_MHBs_P-D      -QWKSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX310734_MHBs_P-D      MQWN-TTFRQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AB222710_MHBs_P-D      -QWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
EU787438_MHBs_P-D      -QWNSTTFHQTLQDPRVRGLTFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KM524340_MHBs_P-D      -RWTSKTFHQALQDPRVRGLYLPAGGSTSGTVNPVPTTASPILSIFSKIG
KT201234_MHBs_P-D      ---NSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTVSHISSIFSRIG
KC875298_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLY-PAGGSSSGTVNPVPTTVSPISSIFSRIG
KT201292_MHBs_P-D      ---NSTTFHQTLQDPRVRGLSFPAGGSSSGTVNPVPTTVSHXSSIFSRIG
KT201240_MHBs_P-D      ---NSTTFHQTLQDPRVRGLYFPAGGSSSGTVDPVPTTVSPISSIFSRIG
JN688685_MHBs_P-D      -QWTSSTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRTG
JN257153_MHBs_P-D      -QWXXXXFHQTLQDPRVXGLYXPAGGSSSGTVNPVPTTXSHIXSIFSXXG
JN257195_MHBs_P-D      -QWXXXXFHQTLQDPRVXGLYXPAGGSSSGTVNPVPTTXSHIXSIFSXXG
KT201241_MHBs_P-D      ---NSXTFHQTLQDPRVXGLYFPAGGSSSGTVNPVPTTVSXISSIFSRIG
DQ399006_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
EU155895_MHBs_P-D      MQWNSTTFHHTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
EU155893_MHBs_P-D      MQWNSKTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JX310727_MHBs_P-D      IQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASPTSSIFSRIG
AY090452_MHBs_P-D      MQWNSTTFQQTLQDPRVKGLFLPAGGSSSGTVNPVPTTASPISSIFSRIG
DQ464168_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSEQVNPVLTTASPLSSIFSRIG
MF979165_MHBs_P-D      LQWNYANFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
AB674420_MHBs_P-D      MQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB048701_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPTLSTSSRIG
JN642154_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSNSSTTG
DQ991752_MHBs_P-D      VQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
AB270550_MHBs_P-D      MQWNSTTFQQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
AB674424_MHBs_P-D      MQWNSTTFHQTLQNPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AB674406_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB205128_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090615_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVQTTASPSSSTFLRIG
AY796031_MHBs_P-D      MQWNTTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB674428_MHBs_P-D      TQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIG
AB674425_MHBs_P-D      VQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTANPVPTTVSPISSIFSRIG
AB674416_MHBs_P-D      IQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIG
AY161153_MHBs_P-D      MQWNSTTFHQTLQDPRVRGPNFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AY161155_MHBs_P-D      MQWNSTTFHQTLQDPRVRGPNFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AY741798_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AY090453_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JF439699_MHBs_P-D      MQWNSTTLHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF439700_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF439701_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF439704_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF439705_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF439706_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF439709_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF439710_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF439711_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF439718_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF439708_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF439692_MHBs_P-D      VQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF439703_MHBs_P-D      VQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTAASPLSSIFSRIG
DQ329356_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
DQ329357_MHBs_P-D      MQWNSSTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
DQ336690_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTASPLSSIFSRMG
AY236160_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
DQ336678_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
DQ336679_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
DQ336675_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
DQ336676_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
DQ336677_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
DQ336674_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
DQ464176_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTASPLSSIFSRIG
DQ336691_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTASPLSSIFSRIG
DQ464175_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTASPLSSIFSRIG
DQ464178_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTASPLSSIFSRIG
AY236164_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
DQ486021_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTASPLSSIFSRIG
DQ486022_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
DQ336685_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTASPLSSIFSRIG
DQ336689_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYSPAGGSSSETANPVPTTASPLSSIFSRIG
DQ464172_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
DQ464173_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
DQ464174_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
DQ464177_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTASPLSSIFSRIG
DQ336686_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
DQ336687_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
DQ336688_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
DQ336692_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
GQ167301_MHBs_P-D      AQWNSTTFQQTLQDPRVRGLNLPAGGSSSGTVNPVPTTVSPISSIFSRIG
GQ167302_MHBs_P-D      VQWNSTTFQQTLQDPRVRGLNLPAGGSSSGTVNPVPTTVSPTSSIFSRIG
AB674431_MHBs_P-D      MQWNSTTFHQTLQDPKVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB126581_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
DQ304548_MHBs_P-D      TKWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISTIFSRIG
DQ304550_MHBs_P-D      TKWNSTTFHQTLQDPRVRGLYLPAGGSSSRTVNPVPTTVSHISSIFSRIG
EF103281_MHBs_P-D      MQWNSTTFHQTLQDPRGEGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AY236162_MHBs_P-D      TKWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIG
DQ304547_MHBs_P-D      TKWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIG
DQ304551_MHBs_P-D      TKWNSTTFHQTLQDPRVRGLYLPAGGSSSRTVNPVPTTVSHISSIFSRIG
AB674411_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSISSRIG
AB330367_MHBs_P-D      MQWNSTTFHQTLQDSRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB270546_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AF151735_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISLIFSKIG
AB674429_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AB674427_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AB270547_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AY161159_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AY161160_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AY741794_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AY741795_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AY741796_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
DQ111986_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB104709_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AB222712_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AB222713_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AB674422_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AF214660_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AY661792_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AY661793_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AY721605_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AY721606_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AY721608_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AY721612_MHBs_P-D      MQWNSTTYHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AY796030_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AY796032_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AB786644_MHBs_P-D      --WNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AY161150_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AJ344116_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB583680_MHBs_P-D      MKWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB104712_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
EU414136_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
EU414135_MHBs_P-D      MQWNSTTFHQTLQBPXVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
DQ991754_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AY741797_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AY721607_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AJ627224_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AF121241_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AF121240_MHBs_C-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB270548_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB270543_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB270542_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB246347_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB222709_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB222711_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
MF979155_MHBs_P-D      MQWNFATFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JX310735_MHBs_P-D      MQWNSTTFRKTLQDPRVRGLYFPAGGFSSGTVNPVPTTVSPISSIFSRIG
JN040769_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JF754617_MHBs_P-D      MQWNTINFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHASSILSRIG
GQ184322_MHBs_P-D      VQWNSTTFQQTLQDSRVRGLNLPAGGSSSGTVNPVPTTVPPISSIFSRIG
EF103276_MHBs_P-D      MQWNPTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB555500_MHBs_P-D      MQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
AB119255_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB090270_MHBs_P-D      MQWNSTTFHQTLQDPRGRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AB119256_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLCFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB090268_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB120308_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB078031_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB078032_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB078033_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB109475_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB109476_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB109477_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB109479_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB110075_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB119251_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB119252_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB119253_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB119254_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB205126_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB210821_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB210822_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB267090_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB471856_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB471857_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB090269_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
DQ464182_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGFSSGTVNPVPTTASPISSIFSRIG
DQ486025_MHBs_P-D      VQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
DQ464170_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
AY230116_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
AB330369_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB493846_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIYSRIG
AF214659_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AM422939_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
AY233291_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
AY233296_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
DQ131122_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
DQ315776_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
AB330370_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GU456665_MHBs_P-D      MQWTSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSISSRTG
GQ183467_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AY233292_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
AY233294_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
AB674419_MHBs_P-D      IQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB555496_MHBs_P-D      MQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KM108608_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHILSIFSRIG
JF439696_MHBs_P-D      VQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
AB674408_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AB188244_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB104711_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AB786650_MHBs_P-D      --WNSTTFQQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
MK052954_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK052953_MHBs_P-D      MQWNSTTFHQTLQEPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX096955_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090609_MHBs_P-D      MQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN604139_MHBs_P-D      VQWNSTTFHQTLQNPRVKGLHPPAGGSSSGTVNPVPTTASPISSIFSRIG
JF754588_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIYSRIG
GU456636_MHBs_P-D      MQWNTTTFHQTLQDPRVRDLYLPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ904429_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSKIG
AB555497_MHBs_P-D      MQWKSTNFQQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSKIG
AB188242_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MK052949_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MF979166_MHBs_P-D      MQWNSATFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KX276998_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KM108595_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIG
KC012652_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JX470760_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JX090690_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSHFERTG
JN604250_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN040782_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLNFPAGGSSSGTVNPVPTTVSRISSIFSRIG
JN040775_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTVSPISSIFSRIG
GU456684_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GU456678_MHBs_P-D      MQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIG
GU456657_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPTSSLFSRIG
GU456642_MHBs_P-D      MQWNSTTFHQTLQDPRVTSLYLPAGGSSSGIVNPVPTTVSPISSIFSRIG
DQ464169_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
AY945307_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
AJ627219_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
AF280817_MHBs_P-D      MQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB674423_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTVSPISSILSRIG
AB674403_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLNFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB555501_MHBs_P-D      MQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
AB270539_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MF979168_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KJ647350_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KF471659_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLFFPAGGSSSGTVNPVPTTVSHTSSIFSRIG
KF471655_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090680_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHTSSIFSRIG
JX090634_MHBs_P-D      MQWNSTTFQQTLQDPRVRGLYFPAGGSSTGTVNPVPTTVSHISSIFSRIA
JX090611_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN642164_MHBs_P-D      MQWNSTTFHQPLQDPKVSDQYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN642158_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN642126_MHBs_P-D      MQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040822_MHBs_P-D      MQWNSTTFHQTLQDPRVRDLYFPVGGSSSGTVNPVPTTVSPISSIFSRIG
GU456639_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GQ183448_MHBs_P-D      MQWNSTIFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ904419_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ349215_MHBs_P-D      MKWNSTTFHQTLQDPRVKGLNLPAGGSSSGTGNPVPTTVSHISSIFSRIG
AJ627223_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVTPVPTTVSPISSIFSRIG
AJ131956_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
AF214661_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTASHILSIFSRIG
AF043594_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB674407_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTVSHISSIFSRIG
AB116266_MHBs_P-D      MQWNSTTFHQTLQDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB109478_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB104710_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
X65258_MHBs_P-D        VQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MK052952_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK052950_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MF925391_MHBs_P-D      MQWNSTTFHQTLQDPRVSGLNFPAGGSSSGTVNPVPTTVSHISSILSRIG
KP090179_MHBs_P-D      MGRNSTTFHQTLQDPRVRGLYFRVGGSSSGTVNPVPTTASPLSSIFSRIG
KJ843187_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
KF471640_MHBs_P-D      MQWNSTTFHQTLQDPKVKDLYFPAGGSSSGTVNPVPTTVSPISSILSRIG
KF170768_MHBs_P-D      IQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSHISSAFSRIG
KF170756_MHBs_P-D      MQWNSTTFHQTLQDHRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JX090610_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN688711_MHBs_P-D      MQWNSTTFHQTLQDPRLIGLDVSAGGSSSGTVNPVPTTASPLSSIVSRIV
JN642157_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN642140_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040817_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040790_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040787_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTVSPISSIFSRIG
JN040784_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754631_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPILSIFSRIG
HQ700444_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456649_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
FJ899792_MHBs_P-D      MQWNSTTFHQTLQDPRVRDLYLPAGGSSSGTVNPVPTTVSPISSIFSRIG
AB246348_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB210820_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGKVNPVPTTASPISSIFSRIG
AB205127_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MK052959_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK052951_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLHFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MF979173_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KM108596_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF679990_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRTG
KF061169_MHBs_P-D      MQWXXTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTVSHISSIFSRIG
JX090712_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090616_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
JQ707689_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JN642163_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN642150_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPAPTTVSPISSIFSRIG
JN642149_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN642138_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN642131_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDPVPTTVSHISSIFSRSG
JN604275_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JN040786_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040771_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTVSHISSIFSRIG
JF754629_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456682_MHBs_P-D      MQWNSTTFHRTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456654_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTVSHISSIFSRIG
GU456645_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GU456643_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
FJ349219_MHBs_P-D      MQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIG
FJ349213_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
EU159677_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EF103275_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
DQ315778_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AY221115_MHBs_P-D      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
AY161158_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AY161157_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AJ627222_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTSARIG
AJ627215_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AF121242_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AF121239_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB674405_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
U87737_MHBs_P-D        MQWNSTTFHQTLTDPRVRGLYLPAGGSSSGPVNPVPTTASPLSSIFSRIG
MK052947_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MF979174_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
M32138_MHBs_P-D        MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIG
L27106_MHBs_P-D        MHWNYTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KP165597_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KP143743_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KP143742_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KM108621_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASHILSIFSRIG
KF476030_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTASPLSSIFSRIG
KF471644_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KF053178_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRIG
JX310733_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090677_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ927384_MHBs_P-D      IXWNSTTFQQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707690_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGFSSGTVNPVPTTASPILSIFSRIG
JN664919_MHBs_P-D      MQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN642133_MHBs_P-D      VQWNSTAFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040812_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040788_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040753_MHBs_P-D      MQWNSTTFHQTLQNPRVKGLYIPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456653_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTVSHISSIFSRIG
GQ183468_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183466_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183465_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183464_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183463_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183462_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183458_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183457_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183455_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183454_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183453_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183452_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183451_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183450_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183449_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ349235_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JQ707682_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707684_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707685_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707686_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707687_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707688_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707691_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707692_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707693_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707694_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707695_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707696_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707698_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707700_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707701_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707703_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707704_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707705_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
MK052975_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK052973_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK052972_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK052961_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK052960_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK052958_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK052956_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK052955_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MK052948_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MF925390_MHBs_P-D      MQWNSTTFHQTLQNPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MF925366_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX827291_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KX196233_MHBs_P-D      MQWNSTTFHQTLRDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KT151620_MHBs_P-D      MQWXXTTFHQTLQDPRVRGLSFPAGGSSSGAVNPVPTTASPLSSIFSRIG
KP168419_MHBs_P-D      IQWNSTTFQQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
KM108599_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLSFPAGGSSSGTVNPVPTTASPISSILSRIG
KJ647353_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KF779222_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLLSSIFSRIG
KF170761_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASSISSIFSRIG
JX090723_MHBs_P-D      MQWNSTTFHQTLQDPRVRDLYFPAGGSSSGIVNPVPTTVSPISSIFSRIG
JX090641_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTVSHISSIFSRIG
JX090637_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSTGTVNPVPTTVSHISSIFSRIG
JX090629_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090622_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JX036334_MHBs_P-D      MQWNSTTFHQTLHDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JQ707529_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707517_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707513_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN664928_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRIG
JN642166_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN642165_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN642161_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN642151_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIG
JN604301_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JN604259_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN604196_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHILSIFSRIG
JN257201_MHBs_P-D      MQWGSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN257200_MHBs_P-D      MQWNSTTFQQTLQDPRVRGLYSPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040830_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIG
JN040809_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLHFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040800_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040779_MHBs_P-D      MQWNSTTFHQTLQDPRVTGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040770_MHBs_P-D      MQWNFTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JF754623_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLNLPAGGSSSGTVNPVPTTVSHISSIFSKIG
HQ700474_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700472_MHBs_P-D      MQWNSTTFRQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456675_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GU456669_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456666_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456661_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLFFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456650_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GQ183479_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ183456_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ904418_MHBs_P-D      MQWNSTPFHQTLQDPKVSDLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
EU939681_MHBs_P-D      MQWNSTTFHQTLQDPRVRDLYLPAGGSSSGTVNPVPTTVSPISSIFSRIG
AB188241_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
U87851_MHBs_P-D        MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSIFRRIG
MK052974_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK052971_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK052966_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK052963_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MH464838_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH464836_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MF979175_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MF979171_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MF979163_MHBs_P-D      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MF979161_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MF979157_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MF979156_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MF618349_MHBs_P-D      MQWNSTAFHQVLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KT366465_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
KR139748_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KM606755_MHBs_P-D      MQWNSTTFPQTLQDPRVRGLYVPAGGSSSGTVNPVPTTASHISSIFSRTG
KM524341_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVHPVPTTASPISSIFSRIG
KM108609_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTIASHISSIFSRIG
KF779376_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
KF779341_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
KF061170_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSVFSRIG
JX090700_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVHPVPTTASPISSIFSRIG
JX090689_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090644_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090635_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSTGTVNPVPTTVSHISSIFSRIG
JX090624_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX036331_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRIG
JQ707525_MHBs_P-D      MEWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707524_MHBs_P-D      MEWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN688712_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN664932_MHBs_P-D      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSKIG
JN664931_MHBs_P-D      IQWNSTTFQQSLQDPKVRGLYFPAGGSSSGTVNPVPTTVSHTSSILSRIG
JN664926_MHBs_P-D      MQWTSTTFHQALQDPRVRGLYLPAGGSTSGTVNPVPTTASPILSIFSKIG
JN642144_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN604318_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN604170_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JN257183_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYXPAGGSSSGTVNPVPTTVSHISSILSRIG
JN257148_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040814_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSKIG
JN040791_MHBs_P-D      MQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040773_MHBs_P-D      MQWNSATFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSTFSRIG
JN040766_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSRISSIFSRIG
JN040762_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTVSHISSIFSRIG
JF815679_MHBs_P-D      MQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JF815678_MHBs_P-D      MQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JF815674_MHBs_P-D      MQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JF815673_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JF815670_MHBs_P-D      MQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JF815666_MHBs_P-D      MQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JF754635_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754633_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JF754611_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GU456683_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456679_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIG
GU456652_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GQ477458_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ904438_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ904410_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTASPISSIFSRIG
FJ562338_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIG
EU787443_MHBs_P-D      MQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
EU414139_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU414138_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EF103277_MHBs_P-D      MQWNSPNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
AJ627220_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AJ627218_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB270541_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257176_MHBs_P-D      MQWNXTTFHQTLQDPRVRGLXFPAGGSSSGTVNPVPTTVSHXSSIFSRIG
JN257177_MHBs_P-D      MQWNXTTFHQTLQDPRVRGLXFPAGGSSSGTVNPVPTTVSHXSSIFSRIG
KJ470895_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLXFPAGGSSSGTVNPVPTTVSHLSSIFSRIG
X80926_MHBs_P-D        MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASTISSIFSRIG
X80924_MHBs_P-D        MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASTISSIFSRIG
KX276857_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRIG
KX276856_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KX196227_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIW
KX196222_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KX196219_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVHPVPTTVSPLSSIFSRIG
KX196215_MHBs_P-D      MQLNSTTFHQTLQEPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KX196212_MHBs_P-D      MQWNSTTLHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIW
KX196209_MHBs_P-D      MQWNSTTLHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIW
KX196208_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSLFSRIG
KT366494_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KP090178_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPITASPLSSIFSRIG
KP090177_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPITASPLSSIFSRIG
KM524338_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KM212957_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KM108592_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KJ647355_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYQPAGGSSSGTVNPVPTTASHLSSIFSRIG
KF779289_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
KF779225_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
KF471654_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF471647_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KF471641_MHBs_P-D      MQWNSTTFHQNLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF061168_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDRVPTTVSHISSIFSRIG
KF061167_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDRVPTTVSHISSIFSRIG
KC875301_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875290_MHBs_P-D      MQWNSTTLHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIW
JX310729_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSLGTVNPVPTTASPISSIFSRIG
JX090697_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
JX090688_MHBs_P-D      AQWNFTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090647_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JX090640_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTVSHISSIFSRIG
JX090623_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JQ707706_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707702_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707699_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707697_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JQ707683_MHBs_P-D      IQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JN792912_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN792906_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN792905_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN688710_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JN642134_MHBs_P-D      VQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIG
JN604239_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSXTVNPVPTTVSHISSIFSRIG
JN257165_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVQTTVSHISSIFSRIG
JN257160_MHBs_P-D      MQWNSTTFHQTLQBPXVRGLYFPAGGSSSGTVNPVPTTVSXISSIFXRIG
JN257159_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTVSHISSIFSRXG
JN040808_MHBs_P-D      MQWNSATFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040806_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040799_MHBs_P-D      MQWNSKTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040768_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040755_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JF754634_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754632_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFLRIG
JF754614_MHBs_P-D      MQWNSTTFHQTLQDPRVXGLYSPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754610_MHBs_P-D      MQWNSTTFHQTLQDPGVRGLHHTAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754603_MHBs_P-D      LQWNSTTFHNTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JF754602_MHBs_P-D      IQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GU456635_MHBs_P-D      MQWNSTTFHQTLQDPRVKSLYLPAGGSSSGTVTPVPTTASPISSIFSRIG
GU357846_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183473_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ183459_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
MH932714_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
MF979176_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSVTVNPVPTTASPLSSIFSRIG
MF925379_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KX357639_MHBs_P-D      MQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KX276975_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIG
KX196232_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KX196225_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KX196224_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KX196221_MHBs_P-D      MQWNSTTFHQTLRDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KX196220_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSRTVNPVPTTVSPLSSIFSRIG
KX196217_MHBs_P-D      MQWNSTTFHQTLQDRRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KT963508_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KT962022_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KT749821_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFARIG
KT366510_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP202944_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP202942_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP202941_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP184498_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP184497_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP184496_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP184495_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP165604_MHBs_P-D      MQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KM524351_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KM524346_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KM108601_MHBs_P-D      MQWNSTTFQQTLQDPRVRGLYFPAGGSSSGTVKPVPTTVSHISSIFSRIG
KJ470894_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KF471656_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGPVNPVPTTVSHISSIFSRIG
KF471642_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPILSIFSRIG
KF170776_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTVSHISSIFSKIG
KF170774_MHBs_P-D      IQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHTSSIFSRIG
KF170772_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLNFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF170771_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYSLAGGSSSGTVNPVPTTVSHISSIFSRIG
KF170757_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF170755_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KC875337_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875334_MHBs_P-D      MQWNSTTFHQTLRDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875328_MHBs_P-D      MQWNSTTFHQTLQDSRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875323_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875322_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875320_MHBs_P-D      MQWNSTTFHQTLQDRRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875316_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875315_MHBs_P-D      MQWNSRTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875314_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875289_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875287_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSTSGTVNPVPTTVSPISSIFSRIG
KC875284_MHBs_P-D      MQWNSTTFHQTLQDRRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875281_MHBs_P-D      MQWNSTTLHQTLQDPRVRALYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875279_MHBs_P-D      MQWNSTTFRQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875275_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAAGSSSGTVNPVPTTVSPISSIFSRIG
KC774477_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KC774445_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KC774440_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JX310726_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPITASPISSIFSRIG
JX096958_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090724_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTVSPISSIFSRIG
JX090720_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090719_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090708_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090707_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090703_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090658_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JX090646_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090621_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JX036333_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JQ707530_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707528_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707527_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707526_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707523_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707522_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707521_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707520_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707519_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707518_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707516_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707515_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707514_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707512_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707493_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707486_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707483_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ687531_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN664941_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTPNPVPTTASPISSIFSRIG
JN664922_MHBs_P-D      MQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPISSIFSRIG
JN664917_MHBs_P-D      MQWNSTTFHQAPADPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
JN642146_MHBs_P-D      MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN642143_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN642142_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN642132_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIG
JN642129_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN604278_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN604263_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDPVPTTVSHISSIFSRIG
JN604120_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN257205_MHBs_P-D      MQWNSTTFQQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN257203_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN257172_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257169_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTVSHISSIFSRIG
JN257163_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040824_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040823_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040821_MHBs_P-D      MQWNTTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040820_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040819_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPTLSIFSRIG
JN040815_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040813_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040810_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040801_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTVSPISSIFSRIG
JN040797_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040796_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040795_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPTSSIFSRIG
JN040793_MHBs_P-D      MQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040783_MHBs_P-D      MQWNTTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040774_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040767_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040758_MHBs_P-D      MQWNSTTFHQTLQDPRVGGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040751_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHTSSIFSRIG
JN040750_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYLHAGGSSSETVNPVPTTVSHISSIFSRIG
JF815668_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JF815665_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JF754626_MHBs_P-D      IQWNSRNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIG
JF754619_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JF754615_MHBs_P-D      MQWNSTTFHQTLQDPRVGGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754612_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754609_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754599_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSKIG
JF754594_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTVSPISSIFSRIG
HQ833469_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIG
HQ833465_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
HQ700473_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700463_MHBs_P-D      MQWNATTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIG
HM750155_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GU456680_MHBs_P-D      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIG
GU456674_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456673_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSTFSRIG
GU456668_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456667_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIG
GU456664_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456659_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456658_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456656_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456655_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTVSHISSIFSRIG
GU456637_MHBs_P-D      MQWNSTTFHQTLQDPRVGGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ477456_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ477453_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ205384_MHBs_P-D      MQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTPASPILSIFSKIG
GQ183476_MHBs_P-D      MQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ183474_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ183471_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ183469_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183461_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183460_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ904445_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ904432_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
FJ904402_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSXTANPVPTTVSPISSIFSRIG
FJ904395_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTINPVPTTASPISSIFSRIG
FJ349234_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
FJ349231_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ349206_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFARIG
EU939680_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
EU787441_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
EU594432_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594431_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594429_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594417_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594416_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594409_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
EU594402_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSRTVNPVPTTASPISSIFSRIG
EU594401_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU414142_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
U87738_MHBs_P-D        MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIG
MH464849_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH464833_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNHVPTTASPLSSIFSRIG
MF979170_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MF979167_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPSSSIFSRIG
MF979162_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MF618343_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPISSIFSRIG
MF618342_MHBs_P-D      MQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
LT992439_MHBs_P-D      MQWTSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KX827290_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX357622_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASHISSIFSRIG
KX196231_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KX196229_MHBs_P-D      MQWTSTTFHQGLQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSKIG
KX196228_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVTPISSIFSRIG
KX196214_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KX196211_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KU668449_MHBs_P-D      MQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KU668448_MHBs_P-D      MQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
KU668447_MHBs_P-D      MQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
KU668436_MHBs_P-D      MQWNSTTFHQTLQDLRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
KP995100_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHTSSIFSRIG
KP202936_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTASHLSSIFSRIG
KM524361_MHBs_P-D      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
KM524358_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KM524345_MHBs_P-D      MQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
KM108604_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLFFPAGGSSSGTVNPVPTTASPISSILSRIG
KM108598_MHBs_P-D      MQWNSTTIHQTLQDPRVRGLFFPAGGSSSGTVNPVPTTASHISSILSRIG
KM108597_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLFFPAGGSSSGTVNPVPTTASPISSILSRIG
KM108594_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIG
KJ647352_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KJ470893_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KF779382_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KF779377_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KF779340_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KF779302_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSTGAVNPVPTTASPLSSIFSRIG
KF779301_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSTGAVNPVPTTASPLSSIFSRIG
KF779230_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLLSSIFSRIG
KF779229_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
KF779228_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
KF779224_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
KF779218_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
KF779217_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
KF779209_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLLSSIFSRIG
KF679997_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KF679994_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KF192834_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KF192832_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KF192831_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KF192830_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KF170775_MHBs_P-D      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KF170770_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIG
KC875342_MHBs_P-D      MQWTSTTFHQGLQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSKIG
KC875340_MHBs_P-D      MQWTSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSKIG
KC875336_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875331_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSICSRTG
KC875329_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875313_MHBs_P-D      MLWNSTTFHRTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875305_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIW
KC875303_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSTSGTVNPVPTTVSPISSIFSRIG
KC875299_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIW
KC875296_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875288_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875286_MHBs_P-D      MQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875277_MHBs_P-D      MQLNSTTFHQTLQEPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875276_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC774462_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
JX898697_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JX898694_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JX898692_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JX898691_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JX898689_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JX310728_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090721_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
JX090698_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX090693_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTGSPISSIFSRNG
JX090672_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX090667_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX090665_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JX090663_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090619_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090605_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN688713_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JN688678_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JN664938_MHBs_P-D      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
JN664937_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
JN664924_MHBs_P-D      MQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
JN664921_MHBs_P-D      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JN664912_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN642136_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN604313_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JN604272_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JN604175_MHBs_P-D      MQWNSTTFHQTLQDPRVRXLYXPAGGSSSGTVNPVPTTASPISSIFSRIG
JN604152_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTXNPVPTTASPILSIFSKIG
JN040777_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040761_MHBs_P-D      MQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040759_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF815676_MHBs_P-D      MQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JF754627_MHBs_P-D      MYWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700478_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700458_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GU456641_MHBs_P-D      MQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GQ922004_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAVXXXXXXXNPVPTTASHTSLIFSRIG
GQ922000_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
GQ205389_MHBs_P-D      MQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
GQ205388_MHBs_P-D      MQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
GQ205385_MHBs_P-D      MQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
FJ904431_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ904427_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
EU787437_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
AJ627216_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MH464834_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KX357637_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KU736927_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KU736926_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KT749828_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KT749827_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTANPVPTTASPISSIFSRIG
KM577670_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVTPVPTTASPISSIFSRIG
KM577669_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KM524356_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KM524339_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KM108619_MHBs_P-D      MQWNSKTSNKTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHISSIFSRIG
KJ470896_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KF679998_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KF170764_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF170760_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
KC875324_MHBs_P-D      MQWNSTTFHHTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875308_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIW
KC875306_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIW
KC875302_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875295_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIW
KC875294_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIW
KC875293_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIW
JX090701_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090686_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090682_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX090671_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
JX090657_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRNG
JX090636_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSTGTVNPVPTTVSHISSIFSRIG
JX090633_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSTGTVNPVPTTVSHISSIFSRIG
JX090617_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090613_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
JX090612_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPNTASHLSSIFSRIG
JX090608_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPNTASHLSSIFSRIG
JX090607_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPNTASHLSSIFSRIG
JX090606_MHBs_P-D      MKWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRIG
JN642159_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN257214_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN257209_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257190_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN257162_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN257152_MHBs_P-D      MQWSSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040818_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
HQ833467_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
HQ700553_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700483_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700481_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700480_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ236015_MHBs_P-D      MQWNSTTIHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
HM750151_MHBs_P-D      MQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
GQ477457_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ205382_MHBs_P-D      MQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
FJ349233_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
FJ349218_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU921419_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
EU921418_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
EU787447_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
EU594434_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYYPAGGSSSGTVNPVPTTASHLSSIFSRIG
EU594404_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594382_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRTG
Z35716_MHBs_P-D        MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
Y07587_MHBs_P-D        MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
X02496_MHBs_P-D        MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MH464854_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH464844_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYPPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH464842_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MH464841_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPXSSIFSRIG
MH464840_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MF925393_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MF925383_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MF925364_MHBs_P-D      MQWNSATFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MF925363_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MF925358_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
LT992438_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
LC365689_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KY629634_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KY629633_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KY382414_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KY382412_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KX827301_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KX827300_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KX276999_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KX196236_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KX196234_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KX196230_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KX196226_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KX196218_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KX196216_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KX196213_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KX196210_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KU668444_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KU668441_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KT962024_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KT962023_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KT962021_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KT366511_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KT366509_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KT366508_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KT366506_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KT366502_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KT366501_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KT366500_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KT366499_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KT366498_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KT366496_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KT366495_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KT366491_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KR905424_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP322600_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KP322599_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KP202943_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP202940_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP202939_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP202938_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP202937_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP184499_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP165605_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KM606753_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KM606752_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KM577671_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KM524355_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KM524354_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KM524353_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KM524352_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KM524350_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
KM524347_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRIG
KM524342_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KM108607_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KM108606_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KM108603_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTVSHISSIFSKIG
KM108602_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISTIFSKIG
KM108600_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVKPVPTTVSHISSIFSRIG
KM108591_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF779220_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KF779219_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KF679996_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KF584166_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF584165_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF584164_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF584163_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF584161_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF584160_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF471660_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF471658_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF471657_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF471652_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KF471651_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KF471650_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF471649_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KF471646_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF170778_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHILSIFSRIG
KF170766_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF170765_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF170759_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF170758_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KF170747_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KC875335_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875333_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGRSSSGTVNPVPTTVSPLSSIFSRIG
KC875332_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875330_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875326_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSTSGTVNPVPTTVSPLSSIFSRIG
KC875325_MHBs_P-D      MQWNSTTLHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875321_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875319_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875318_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSTSGTVNPVPTTVSPLSSIFSRIG
KC875317_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
KC875312_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC875311_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSTSGTVNPVPTTASPISSIFSRIG
KC875310_MHBs_P-D      MQWNSTTFHQTLQEPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC875309_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875304_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSTSGTVNPVPTTVSPISSIFSRIG
KC875300_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875297_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875292_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KC875291_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875285_MHBs_P-D      MQWNSTTLHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875283_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875282_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875280_MHBs_P-D      MQWNSTTCHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC875278_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC774459_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
KC774444_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JX090715_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090706_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090705_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090704_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090695_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090687_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090684_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JX090681_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JX090678_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIG
JX090668_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090660_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JX090655_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090654_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JX090653_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JX090652_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JX090651_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JX090650_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JX090649_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JX090645_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090643_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090642_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090638_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090632_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090631_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090630_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX090627_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHLSSIFSRIG
JX090626_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JQ707508_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707507_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707505_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707503_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707502_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707500_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707499_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707497_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707496_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707494_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707490_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707489_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707488_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707487_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707485_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707484_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707482_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707481_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707480_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707479_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707478_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ707476_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN688679_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN664930_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN664927_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN664918_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN642167_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN642156_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN642153_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN642148_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN642147_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN642145_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN642135_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN642130_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIG
JN604312_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
JN604265_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN604206_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSILSRIG
JN604161_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN370954_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN257211_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN257202_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN257199_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTIVSPISSIFSRIG
JN257196_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257193_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257185_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257182_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257179_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257171_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257170_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257155_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257151_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040829_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040828_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040827_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTLNPVPTTVSHISSIFSRIG
JN040826_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIG
JN040811_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPGSSIFSRIG
JN040807_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040805_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTIVSPISSIFSRIG
JN040802_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040794_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040792_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040785_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040778_MHBs_P-D      MQWNSTTFHQTLQDPGVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040765_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040757_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754628_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754624_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPLSSIFSRIG
JF754618_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754608_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754607_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JF754604_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754601_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754600_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754596_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JF754595_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JF754593_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754592_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754591_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754590_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ833471_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
HQ833470_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
HQ833468_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTVSPISSIFSRIG
HQ700488_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700487_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700484_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700482_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700479_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700471_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700470_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700469_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700466_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700464_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700459_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700455_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700454_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700453_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700451_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700450_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700448_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700447_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700446_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSNSGTVNPVPTTVSHISSIFSRIG
HQ700445_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSNSGTVNPVPTTVSHISSIFSRIG
HQ700443_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700442_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700441_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HQ700440_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
HM750156_MHBs_P-D      MQWNSTTFHQTPQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
HM750154_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
HM750153_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTVSPISSIFSRIG
HM750152_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GU456681_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIG
GU456677_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456670_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456663_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GU456660_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GU456651_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GU456648_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GU456647_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GU456646_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GU456640_MHBs_P-D      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GU456638_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
GQ477459_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ377589_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ205380_MHBs_P-D      MQWTSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183483_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ183482_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ183480_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ183477_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ183475_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ183472_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ183470_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ904443_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ904435_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
FJ904433_MHBs_C-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
FJ904426_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ904424_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ904421_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ904420_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ904415_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ904412_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ904399_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
FJ692532_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
FJ386590_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ349230_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ349229_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ349228_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ349220_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ349216_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ349214_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPLSSIFSRIG
EU919197_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
EU787446_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
EU787442_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
EU787440_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
EU787436_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
EU594427_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594424_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594421_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594415_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594414_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594413_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594410_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKIG
EU594407_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594405_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594403_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594400_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594397_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
EU594396_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
X65257_MHBs_P-D        MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
V01460_MHBs_P-D        MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
MH464853_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH464848_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH464847_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH464845_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH464843_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYHPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH464839_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH464837_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH464832_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH464831_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MF979164_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MF979160_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MF979158_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MF979154_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MF618348_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MF618341_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
MF618340_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
MF618339_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
LT992454_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KX827292_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYYPAGGSSSGTVNPVPTTASPLSSIFSRIG
KU668446_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
KU668445_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
KU668442_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
KU668439_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLLSIFSKIG
KU668438_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
KU668437_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
KU668435_MHBs_P-D      MQWTSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
KU668434_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
KU668433_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
KT366507_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTAYHLSSIFSRIG
KT366497_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTAYHLSSIFSRIG
KT347090_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KR139747_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KP165603_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP165600_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP090181_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KP090180_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KM606754_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTACHISSIFSRIG
KM606745_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KM606744_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KM577668_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASSISSIFSRIG
KM524349_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVLTTASPLSSIFSRIG
KM524344_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KM519455_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KM108620_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
KM108605_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KF922432_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KF779318_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KF779303_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KF779296_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KF779292_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KF779288_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KF779285_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KF779216_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KF779214_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KF779212_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KF679993_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTAYHLSSIFSRIG
KF679992_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTAYHLSSIFSRIG
KF679989_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KF476029_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KF476028_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KF170767_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHISSIFSRIG
KF170763_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KF170746_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
KC774460_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KC774437_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTASHVSSIFSRIG
KC774436_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX096954_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090710_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX090709_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX090702_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090694_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090691_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX090676_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTLNPVPTTVSPISSIFSRIG
JX090674_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX090673_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX090670_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX090666_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX090662_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX090661_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX090659_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHISSIFSRIG
JX090656_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JX090639_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX090628_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JX090620_MHBs_P-D      MQWNSTTFRQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN792911_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN688708_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JN688695_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
JN688683_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN664936_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
JN664920_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN664914_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
JN664913_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
JN664911_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
JN664910_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JN664909_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
JN604207_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN604189_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSILSRIG
JN604174_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN370953_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN370952_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN370951_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN370950_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN370949_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN257186_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRTG
JN257181_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
JN257149_MHBs_P-D      MQWNSTTFHQTLQDPRVXGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN040781_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
HQ700514_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700513_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700511_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
HQ700449_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTXNPVPTTXSHISSIFSRIG
HQ236016_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTASPLSSIFSRIG
HQ236014_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
GQ922005_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHTSSIFSRIG
GQ922003_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHTSSIFSRIG
GQ922002_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
GQ922001_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVSTTASPLSSIFSRIG
GQ183485_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
GQ183481_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ183478_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
FJ904439_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ904422_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FJ692533_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
FJ692507_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
FJ692506_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
FJ349232_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
FJ349209_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
EU594433_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594426_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU414143_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
EU414141_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
X97849_MHBs_P-D        MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
X72702_MHBs_P-D        MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
LT992444_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KX357638_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KU736925_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KR905423_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP322601_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KM108593_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KF679995_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX096957_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090718_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090713_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090699_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090696_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090685_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090683_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090679_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090625_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090618_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ687530_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSRTVNPVPTTASPISSIFSRIG
JN664939_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JN604295_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN257188_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLNFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JF754597_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700512_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700510_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ349208_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ349205_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594430_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594425_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594418_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594399_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594398_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTASPISSIFSRIG
KY629630_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KU736924_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KT962025_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP230541_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP202945_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP165602_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP165601_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP165599_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRIG
KP165598_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP143745_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP143744_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KJ470889_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KF584162_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSXISSIFSRIG
JX096956_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090717_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090711_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090675_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN604238_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKIG
JN257150_MHBs_P-D      MQWNSTTFHQTLQDPRVXGLXFPAGGSSSGTVNPVPTTVSHISSIFSRIG
GQ924652_MHBs_P-D      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ477452_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKIG
EU594428_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594423_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594422_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594420_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594419_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594408_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRIG
X97848_MHBs_P-D        MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX090716_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN792910_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN792909_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN792908_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN792907_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN792904_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU414140_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASXISSIFSRIG
JN792903_MHBs_P-D      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
                                .             .          .               

GQ477455_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
JX310734_MHBs_P-D      DPAMNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB222710_MHBs_P-D      DPXLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU787438_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524340_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT201234_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875298_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT201292_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT201240_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN688685_MHBs_P-D      DLALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257153_MHBs_P-D      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257195_MHBs_P-D      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT201241_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ399006_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU155895_MHBs_P-D      DPALSMENITSGFLGPLLVLQAGFFLLTRILRIPQSLDSWWTSLNFQGGT
EU155893_MHBs_P-D      DPALNMGNITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX310727_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY090452_MHBs_P-D      APALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
DQ464168_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979165_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB674420_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB048701_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
JN642154_MHBs_P-D      DPAMNMEKIISEHLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ991752_MHBs_P-D      DPALNMGNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB270550_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
AB674424_MHBs_P-D      VPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
AB674406_MHBs_P-D      DPALKMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGA
AB205128_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRIFTIPQSLDSWWTSLNFLGGS
JX090615_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
AY796031_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGET
AB674428_MHBs_P-D      DPARNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB674425_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
AB674416_MHBs_P-D      GPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY161153_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
AY161155_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
AY741798_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGDT
AY090453_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF439699_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF439700_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF439701_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF439704_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF439705_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF439706_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF439709_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF439710_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF439711_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF439718_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGT
JF439708_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF439692_MHBs_P-D      DPALNMENITSGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF439703_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTKILAIPQSLDSWWTSLNFLGGT
DQ329356_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGT
DQ329357_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGT
DQ336690_MHBs_P-D      TLALNMENITSRLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGN
AY236160_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGN
DQ336678_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGN
DQ336679_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGN
DQ336675_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGN
DQ336676_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGN
DQ336677_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGN
DQ336674_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGN
DQ464176_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLSTRILTIPQSLDSWWTSLSFLGGN
DQ336691_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGN
DQ464175_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGN
DQ464178_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGN
AY236164_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWRTSLSFLGGN
DQ486021_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILAIPQCLDSWRTSLSFLGGN
DQ486022_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWRTSLSFLGGN
DQ336685_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGN
DQ336689_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGN
DQ464172_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGN
DQ464173_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGN
DQ464174_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGN
DQ464177_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGN
DQ336686_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGN
DQ336687_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGN
DQ336688_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGN
DQ336692_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGN
GQ167301_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ167302_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB674431_MHBs_P-D      DPALNMENITSRFLGPLLGLLAGFSLLTRILTIPQSLDSWWTSLNFLGGT
AB126581_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ304548_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTTILTIPQSLDSWWTSLNFLGGT
DQ304550_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTTILTIPQSLDSWWTSLNFLGGT
EF103281_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY236162_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ304547_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ304551_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB674411_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB330367_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB270546_MHBs_P-D      DPAXNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AF151735_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB674429_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB674427_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB270547_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY161159_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY161160_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY741794_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY741795_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY741796_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ111986_MHBs_P-D      VPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGN
AB104709_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB222712_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB222713_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB674422_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AF214660_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY661792_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY661793_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY721605_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY721606_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY721608_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY721612_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY796030_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY796032_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB786644_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY161150_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AJ344116_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB583680_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB104712_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU414136_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU414135_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ991754_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY741797_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGSFLLTRILTIPQSLDSWWTSLNFLGGT
AY721607_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AJ627224_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AF121241_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AF121240_MHBs_C-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB270548_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB270543_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB270542_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB246347_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB222709_MHBs_P-D      DPXLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB222711_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979155_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX310735_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040769_MHBs_P-D      DPALNMENITSGLLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754617_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
GQ184322_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EF103276_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB555500_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB119255_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
AB090270_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB119256_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB090268_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB120308_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB078031_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB078032_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB078033_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB109475_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB109476_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB109477_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB109479_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
AB110075_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB119251_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB119252_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
AB119253_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB119254_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB205126_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB210821_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB210822_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB267090_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB471856_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB471857_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB090269_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ464182_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ486025_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGT
DQ464170_MHBs_P-D      DPALNMENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY230116_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLDFLGGT
AB330369_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB493846_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AF214659_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AM422939_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY233291_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY233296_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ131122_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ315776_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB330370_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456665_MHBs_P-D      DPALNMENITSGFLGPLVVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGT
GQ183467_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
AY233292_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGT
AY233294_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGT
AB674419_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGGT
AB555496_MHBs_P-D      DLALNMENITSGFLGALLMIQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108608_MHBs_P-D      DPARNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF439696_MHBs_P-D      DPVLNMENITSGLLGPLLVLQAGFFLLTKILAIPQSLDSWWTSLNFLGGT
AB674408_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
AB188244_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
AB104711_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB786650_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK052954_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
MK052953_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
JX096955_MHBs_P-D      DPALNMENTTSGFLGPLLVLQAEFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090609_MHBs_P-D      DPALNMENITSGFLGPLLVLLAGFFLLTRILTIPQSLDSWWTSLNFLGET
JN604139_MHBs_P-D      GLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
JF754588_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456636_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904429_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFSLLTRILTMPQSLDSWWTSLSFLGGT
AB555497_MHBs_P-D      GPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB188242_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK052949_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
MF979166_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX276998_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
KM108595_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGT
KC012652_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX470760_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090690_MHBs_P-D      DLARNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
JN604250_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040782_MHBs_P-D      DPALNMENNTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGET
JN040775_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456684_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456678_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456657_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456642_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFRGGT
DQ464169_MHBs_P-D      DPALNMENITSGILGPLLVLQAGFFLLTRILTIRQSLDSWWTSLNFLGGT
AY945307_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AJ627219_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AF280817_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB674423_MHBs_P-D      DLVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB674403_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB555501_MHBs_P-D      DPAMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB270539_MHBs_P-D      DHALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979168_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ647350_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGT
KF471659_MHBs_P-D      VPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF471655_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090680_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090634_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGT
JX090611_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGET
JN642164_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642158_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642126_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040822_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
GU456639_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183448_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
FJ904419_MHBs_P-D      DPALNMENITSGFLGPLLVFQAGCFLLTRILTMPQSLDSWWTSLNFLGGT
FJ349215_MHBs_P-D      DLALNMENITSGFLGPLLVIQAGFFLLIRILTITHSLDSWWTSLNFLGGT
AJ627223_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AJ131956_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AF214661_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AF043594_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB674407_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB116266_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB109478_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB104710_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
X65258_MHBs_P-D        DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGT
MK052952_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFLLLTRILTVPQSLDSWWTSLSFLGGT
MK052950_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF925391_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP090179_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGET
KJ843187_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF471640_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGT
KF170768_MHBs_P-D      APALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSSLGGT
KF170756_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JX090610_MHBs_P-D      DPARNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN688711_MHBs_P-D      NPAMNMENFQSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642157_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642140_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040817_MHBs_P-D      DPALNMENITSGLLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040790_MHBs_P-D      APALNMENITSGFLGPLLELQAGFFLLTRILTIPQNLDSWWTSLNFLGGN
JN040787_MHBs_P-D      DPALNMENITSGFLRPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
JN040784_MHBs_P-D      DPALKMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
JF754631_MHBs_P-D      DPALTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700444_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456649_MHBs_P-D      DLALNMENITSGFLGPLLGLQAGFFLLTRILTIPQSLDWWWTSLNFLGGT
FJ899792_MHBs_P-D      DLALNMENVTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB246348_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB210820_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB205127_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFLGGT
MK052959_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK052951_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979173_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108596_MHBs_P-D      DPARNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF679990_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF061169_MHBs_P-D      DLALNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090712_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFWLTRILTIPQSLDSWWTSLIFLGGT
JX090616_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLWTRILTIPQSLDSWWTSLNFLGGT
JQ707689_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JN642163_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGET
JN642150_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFVGGT
JN642149_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
JN642138_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFVGGT
JN642131_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPASLDSWWTSLNFLGGT
JN604275_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLSFLGGT
JN040786_MHBs_P-D      DPALNMENITSGFLRPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
JN040771_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGT
JF754629_MHBs_P-D      DPAMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456682_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456654_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456645_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGET
GU456643_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGGT
FJ349219_MHBs_P-D      VPALNMENITSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ349213_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
EU159677_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EF103275_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ315778_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY221115_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY161158_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY161157_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AJ627222_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AJ627215_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AF121242_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGT
AF121239_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB674405_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
U87737_MHBs_P-D        DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK052947_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
MF979174_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
M32138_MHBs_P-D        DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGT
L27106_MHBs_P-D        DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
KP165597_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP143743_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP143742_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108621_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF476030_MHBs_P-D      DPARNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF471644_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF053178_MHBs_P-D      VPAMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX310733_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRIXTIPQSLDSWWTSLNFLGGT
JX090677_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ927384_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707690_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JN664919_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642133_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040812_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGGT
JN040788_MHBs_P-D      DPALNMENITSGFLRPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
JN040753_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456653_MHBs_P-D      VPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183468_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
GQ183466_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
GQ183465_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
GQ183464_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
GQ183463_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
GQ183462_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
GQ183458_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
GQ183457_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
GQ183455_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
GQ183454_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
GQ183453_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
GQ183452_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
GQ183451_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
GQ183450_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
GQ183449_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
FJ349235_MHBs_P-D      DLALNMENITSGFLRPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
JQ707682_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707684_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707685_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707686_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707687_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707688_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707691_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707692_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707693_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707694_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707695_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707696_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707698_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707700_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707701_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707703_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707704_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707705_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
MK052975_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK052973_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK052972_MHBs_P-D      DPALNMENITSGFLGLLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
MK052961_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
MK052960_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK052958_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK052956_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK052955_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK052948_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF925390_MHBs_P-D      VPAMNMENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF925366_MHBs_P-D      DPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KX827291_MHBs_P-D      DPALNMENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196233_MHBs_P-D      DPALNMENITAGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT151620_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP168419_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108599_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ647353_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLIFLGGT
KF779222_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLQLLGGT
KF170761_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGT
JX090723_MHBs_P-D      DLARNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090641_MHBs_P-D      DPALNMENITSGFLGPLIVLQAAFFLLTRILTIPQSLDSWWNSLNFLGGT
JX090637_MHBs_P-D      DLAQNMENITSGFLGPLIVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JX090629_MHBs_P-D      DPALNMENITSGFLGPLLVLEAGFFLLTRILTLPHSLDSWWTSLNFLGGT
JX090622_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTMPKSLDSWWTSLNFLGGT
JX036334_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707529_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707517_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707513_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664928_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642166_MHBs_P-D      DPALNMESVTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
JN642165_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
JN642161_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642151_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604301_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604259_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604196_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
JN257201_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
JN257200_MHBs_P-D      DPALNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040830_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
JN040809_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040800_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTTPKSLDSWWTSLNFLGGT
JN040779_MHBs_P-D      DPAMNMENITSGFLGPLLVLQAGSFLLTRILTIPQSLDSWWTSLNFLGGT
JN040770_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
JF754623_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700474_MHBs_P-D      DPALNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700472_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456675_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456669_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPSSLDSWWTSLNFLGGT
GU456666_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
GU456661_MHBs_P-D      DPALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456650_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTMPKSLDSWWTSLNFLGGT
GQ183479_MHBs_P-D      DPALNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183456_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
FJ904418_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU939681_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB188241_MHBs_P-D      DPAMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
U87851_MHBs_P-D        DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK052974_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK052971_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK052966_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK052963_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464838_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
MH464836_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979175_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979171_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLXSWWTSLNFLGGT
MF979163_MHBs_P-D      DPALNMENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979161_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979157_MHBs_P-D      DXALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979156_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF618349_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366465_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KR139748_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
KM606755_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524341_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108609_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
KF779376_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779341_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF061170_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090700_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090689_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090644_MHBs_P-D      DPALNMENITSGFLGPLLVLLAAFFLLTRILTTPQSLDSWWTSLNFLGGT
JX090635_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090624_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX036331_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTVPQSLDSWWTSLNFLGGT
JQ707525_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707524_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN688712_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664932_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGET
JN664931_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664926_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JN642144_MHBs_P-D      DPALNMENITSGFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604318_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGYFLLTRILTIPQNLDSWWTSLNFLGGT
JN604170_MHBs_P-D      DPALNMESITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257183_MHBs_P-D      DXALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLXFLGGT
JN257148_MHBs_P-D      DLALNMENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040814_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040791_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040773_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGSFLLTRILTIPQSLDSWWTSLNFLGGT
JN040766_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040762_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF815679_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF815678_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF815674_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF815673_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF815670_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF815666_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754635_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTQVLTIPQSLDSWWTSLSFLGGT
JF754633_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754611_MHBs_P-D      DLVTNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGX
GU456683_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456679_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
GU456652_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ477458_MHBs_P-D      DPALKMENITSGFLGPLLVLQAGFFLLTKIIKIPQSLDSWWTSLNFLGGT
FJ904438_MHBs_P-D      DLAVNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
FJ904410_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ562338_MHBs_P-D      DXALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU787443_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU414139_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU414138_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EF103277_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AJ627220_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AJ627218_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB270541_MHBs_P-D      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257176_MHBs_P-D      DXALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257177_MHBs_P-D      DXALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ470895_MHBs_P-D      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
X80926_MHBs_P-D        DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
X80924_MHBs_P-D        DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX276857_MHBs_P-D      VPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX276856_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196227_MHBs_P-D      GPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTALNFLGGT
KX196222_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196219_MHBs_P-D      DPALNMDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196215_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196212_MHBs_P-D      GPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196209_MHBs_P-D      GPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNVLGGT
KX196208_MHBs_P-D      DPALNMENITSGFLGPLLVLPAGFFLLTRILTIPQRLDSWWTSLNFLGGT
KT366494_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP090178_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP090177_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524338_MHBs_P-D      VPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM212957_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108592_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
KJ647355_MHBs_P-D      GPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF779289_MHBs_P-D      DPALNMENITSEALGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779225_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF471654_MHBs_P-D      VLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF471647_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF471641_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF061168_MHBs_P-D      DPALNMEDITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF061167_MHBs_P-D      DLALNMEDITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875301_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875290_MHBs_P-D      GPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX310729_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090697_MHBs_P-D      DPALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
JX090688_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090647_MHBs_P-D      DPALKMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JX090640_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGS
JX090623_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFSLTRILTMPQSLDSWWTSLNFLGGS
JQ707706_MHBs_P-D      DLVLNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707702_MHBs_P-D      DLVLNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707699_MHBs_P-D      DLVLNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707697_MHBs_P-D      DLVLNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JQ707683_MHBs_P-D      DLVLNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JN792912_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
JN792906_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN792905_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN688710_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
JN642134_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604239_MHBs_P-D      DLAXNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257165_MHBs_P-D      DPALNMENITSGXLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
JN257160_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257159_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040808_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGT
JN040806_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
JN040799_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGET
JN040768_MHBs_P-D      DLAPNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040755_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGT
JF754634_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTXPKSLDSWWTSLNFLGGT
JF754632_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF754614_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754610_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754603_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754602_MHBs_P-D      DPALNMENITSGFLGPLIVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456635_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU357846_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183473_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183459_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH932714_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979176_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF925379_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
KX357639_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX276975_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196232_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGT
KX196225_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196224_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196221_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196220_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGT
KX196217_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT963508_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT962022_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT749821_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366510_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGT
KP202944_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP202942_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP202941_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP184498_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP184497_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP184496_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP184495_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP165604_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524351_MHBs_P-D      DPALNMEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524346_MHBs_P-D      DPALNMEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108601_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ470894_MHBs_P-D      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
KF471656_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF471642_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170776_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170774_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170772_MHBs_P-D      DPARNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170771_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170757_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170755_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
KC875337_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGT
KC875334_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875328_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875323_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875322_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875320_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875316_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875315_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875314_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875289_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875287_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875284_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875281_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875279_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875275_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774477_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774445_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774440_MHBs_P-D      DPALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX310726_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX096958_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090724_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090720_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090719_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090708_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090707_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090703_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDWWWTSLNFLGGT
JX090658_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090646_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPHSLDSWWTSLNFLGGT
JX090621_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX036333_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707530_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707528_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707527_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707526_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707523_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707522_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707521_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707520_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707519_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707518_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707516_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707515_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707514_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707512_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707493_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707486_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707483_MHBs_P-D      DPALNMENIISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ687531_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664941_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGT
JN664922_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGET
JN664917_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642146_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642143_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642142_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642132_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642129_MHBs_P-D      DPARNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604278_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604263_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604120_MHBs_P-D      DPALNMENISSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257205_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257203_MHBs_P-D      DPALNMENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257172_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257169_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257163_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040824_MHBs_P-D      DPALNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
JN040823_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040821_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040820_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGT
JN040819_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040815_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040813_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040810_MHBs_P-D      DPAMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040801_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTTPKSLDSWWTSLNFLGGT
JN040797_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040796_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040795_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040793_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JN040783_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040774_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040767_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040758_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDWWWTSLNFLGGT
JN040751_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
JN040750_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
JF815668_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF815665_MHBs_P-D      DPALSMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754626_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754619_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
JF754615_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754612_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754609_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754599_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754594_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ833469_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ833465_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700473_MHBs_P-D      DPALNMENTXSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700463_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HM750155_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456680_MHBs_P-D      DPAMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456674_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLSFLGGT
GU456673_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456668_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456667_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456664_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456659_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456658_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456656_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456655_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456637_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGT
GQ477456_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ477453_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ205384_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183476_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183474_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183471_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183469_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183461_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183460_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904445_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGT
FJ904432_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904402_MHBs_P-D      DXALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904395_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGT
FJ349234_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ349231_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ349206_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU939680_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
EU787441_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594432_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594431_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594429_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594417_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594416_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594409_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594402_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594401_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU414142_MHBs_P-D      DPALNMENITSGXLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
U87738_MHBs_P-D        DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464849_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464833_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979170_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979167_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979162_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF618343_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF618342_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
LT992439_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX827290_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX357622_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196231_MHBs_P-D      DPALNMDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196229_MHBs_P-D      DPAPNMENITSGFLGRLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196228_MHBs_P-D      DPALNMENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196214_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196211_MHBs_P-D      DPALNMENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU668449_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU668448_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU668447_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU668436_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP995100_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP202936_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524361_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524358_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
KM524345_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108604_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108598_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108597_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108594_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ647352_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ470893_MHBs_P-D      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779382_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779377_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779340_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779302_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779301_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779230_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLIRILTIPQSLDSWWTSLNFLGGT
KF779229_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779228_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779224_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779218_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779217_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779209_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF679997_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF679994_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF192834_MHBs_P-D      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF192832_MHBs_P-D      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF192831_MHBs_P-D      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF192830_MHBs_P-D      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170775_MHBs_P-D      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170770_MHBs_P-D      DRVPNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGT
KC875342_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875340_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875336_MHBs_P-D      DPALNMDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875331_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875329_MHBs_P-D      DPALNMENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875313_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875305_MHBs_P-D      GPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875303_MHBs_P-D      VPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875299_MHBs_P-D      GPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875296_MHBs_P-D      DPALNMENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875288_MHBs_P-D      DPALNMENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875286_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875277_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875276_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774462_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX898697_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX898694_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX898692_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX898691_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX898689_MHBs_P-D      DPALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX310728_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090721_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090698_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090693_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090672_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
JX090667_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090665_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090663_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090619_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090605_MHBs_P-D      DPALNMENITSGFLGPLLALQAGFFLLTGILTIPQSLDSWWTSLNFLGGT
JN688713_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN688678_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664938_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664937_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664924_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664921_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664912_MHBs_P-D      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642136_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604313_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604272_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604175_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604152_MHBs_P-D      DLALNMENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLXFLGGN
JN040777_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040761_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040759_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF815676_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754627_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700478_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700458_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456641_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ922004_MHBs_P-D      DLVRNMENITSGFLGPLLXLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
GQ922000_MHBs_P-D      DPALNMENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ205389_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ205388_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ205385_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904431_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGGT
FJ904427_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU787437_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AJ627216_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464834_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGT
KX357637_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU736927_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU736926_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT749828_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT749827_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
KM577670_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM577669_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524356_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
KM524339_MHBs_P-D      DPALSMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108619_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ470896_MHBs_P-D      DPAQNMENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGT
KF679998_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLQTRILTIPQSLDSWWTSLNFLGGT
KF170764_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170760_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGN
KC875324_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875308_MHBs_P-D      GPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875306_MHBs_P-D      GPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875302_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875295_MHBs_P-D      GPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875294_MHBs_P-D      GPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875293_MHBs_P-D      GPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090701_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090686_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090682_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090671_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090657_MHBs_P-D      GPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090636_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090633_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
JX090617_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090613_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
JX090612_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090608_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090607_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090606_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642159_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257214_MHBs_P-D      DXALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257209_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257190_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257162_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGX
JN257152_MHBs_P-D      DXALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040818_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
HQ833467_MHBs_P-D      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGT
HQ700553_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700483_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700481_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700480_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ236015_MHBs_P-D      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTTPQSLDSWWTSLNFLGGT
HM750151_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ477457_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ205382_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ349233_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ349218_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU921419_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
EU921418_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLIRILTIPQSLDSWWTSLSFLGGT
EU787447_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594434_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594404_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
EU594382_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
Z35716_MHBs_P-D        DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
Y07587_MHBs_P-D        DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
X02496_MHBs_P-D        DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464854_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGET
MH464844_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464842_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464841_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464840_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF925393_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF925383_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF925364_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF925363_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGT
MF925358_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
LT992438_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
LC365689_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KY629634_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KY629633_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
KY382414_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KY382412_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX827301_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX827300_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX276999_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196236_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196234_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196230_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196226_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196218_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGT
KX196216_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX196213_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLASWWTSLNFLGGT
KX196210_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU668444_MHBs_P-D      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU668441_MHBs_P-D      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT962024_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT962023_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT962021_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366511_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366509_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366508_MHBs_P-D      DPALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366506_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366502_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366501_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366500_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366499_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366498_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366496_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366495_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366491_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KR905424_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP322600_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP322599_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP202943_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP202940_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP202939_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP202938_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP202937_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP184499_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP165605_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM606753_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM606752_MHBs_P-D      DPALSMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM577671_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524355_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524354_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524353_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524352_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524350_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524347_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524342_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108607_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108606_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108603_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108602_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108600_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108591_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779220_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779219_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF679996_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF584166_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF584165_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF584164_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF584163_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF584161_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF584160_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF471660_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF471658_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF471657_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF471652_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF471651_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF471650_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF471649_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
KF471646_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170778_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
KF170766_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170765_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170759_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170758_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170747_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875335_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875333_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875332_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875330_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875326_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875325_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875321_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875319_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875318_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875317_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875312_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875311_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875310_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875309_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875304_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875300_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875297_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875292_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875291_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875285_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875283_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875282_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875280_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875278_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774459_MHBs_P-D      DPALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774444_MHBs_P-D      DPALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090715_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFWLTRILTIPQSLDSWWTSLNFLGGT
JX090706_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILIIPQSLDSWWTSLNFLGGT
JX090705_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090704_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090695_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090687_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090684_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090681_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090678_MHBs_P-D      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090668_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
JX090660_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
JX090655_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090654_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090653_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090652_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090651_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090650_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090649_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090645_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090643_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090642_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090638_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090632_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090631_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090630_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090627_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090626_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707508_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707507_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707505_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707503_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707502_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707500_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707499_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707497_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707496_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707494_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707490_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707489_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707488_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707487_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707485_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707484_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707482_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707481_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707480_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707479_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707478_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ707476_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN688679_MHBs_P-D      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664930_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664927_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664918_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
JN642167_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642156_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642153_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642148_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642147_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642145_MHBs_P-D      DPALNMENITSGFLGPLVVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642135_MHBs_P-D      DPALNMENITSGFLGPLFVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642130_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604312_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604265_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604206_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604161_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN370954_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257211_MHBs_P-D      DPAXNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257202_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257199_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257196_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257193_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257185_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257182_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257179_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257171_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257170_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257155_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257151_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040829_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040828_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGT
JN040827_MHBs_P-D      DPALNMENITSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040826_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040811_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIQQSLDSWWTSLNFLGGT
JN040807_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040805_MHBs_P-D      DPALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040802_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040794_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040792_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040785_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040778_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040765_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040757_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754628_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754624_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754618_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754608_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754607_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754604_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754601_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754600_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754596_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754595_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754593_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754592_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754591_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754590_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ833471_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ833470_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
HQ833468_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700488_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700487_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700484_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700482_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700479_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700471_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700470_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700469_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700466_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700464_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700459_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700455_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700454_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700453_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700451_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700450_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700448_MHBs_P-D      DPALNMENITSXFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700447_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700446_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700445_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700443_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700442_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700441_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700440_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HM750156_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HM750154_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HM750153_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGT
HM750152_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456681_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456677_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
GU456670_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456663_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456660_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456651_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
GU456648_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456647_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456646_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456640_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU456638_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ477459_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ377589_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ205380_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183483_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183482_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183480_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGT
GQ183477_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183475_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183472_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
GQ183470_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904443_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904435_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904433_MHBs_C-D      DPALTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904426_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904424_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904421_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904420_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904415_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904412_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904399_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ692532_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ386590_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ349230_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ349229_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ349228_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ349220_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ349216_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ349214_MHBs_P-D      DPARSMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU919197_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU787446_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU787442_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU787440_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU787436_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594427_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594424_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594421_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594415_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594414_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594413_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594410_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594407_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594405_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRTLTIPQSLDSWWTSLNFLGGT
EU594403_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594400_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594397_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594396_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
X65257_MHBs_P-D        DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
V01460_MHBs_P-D        DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464853_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464848_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464847_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464845_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464843_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464839_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464837_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464832_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464831_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979164_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979160_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979158_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF979154_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF618348_MHBs_P-D      DPALNMEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF618341_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF618340_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF618339_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
LT992454_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX827292_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU668446_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU668445_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU668442_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU668439_MHBs_P-D      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU668438_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU668437_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU668435_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU668434_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU668433_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366507_MHBs_P-D      DPALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366497_MHBs_P-D      DPALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT347090_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KR139747_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP165603_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP165600_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP090181_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP090180_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM606754_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM606745_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM606744_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM577668_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524349_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524344_MHBs_P-D      DPALNMEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM519455_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108620_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108605_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF922432_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779318_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779303_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779296_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779292_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779288_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779285_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779216_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779214_MHBs_P-D      DPAMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779212_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF679993_MHBs_P-D      DPALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF679992_MHBs_P-D      DPALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF679989_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF476029_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF476028_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170767_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170763_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF170746_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774460_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774437_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KC774436_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX096954_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090710_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090709_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090702_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090694_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090691_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090676_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090674_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090673_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090670_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090666_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090662_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090661_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090659_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090656_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090639_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090628_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
JX090620_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN792911_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN688708_MHBs_P-D      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN688695_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN688683_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664936_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664920_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664914_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664913_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664911_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664910_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664909_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604207_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604189_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604174_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN370953_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN370952_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN370951_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN370950_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN370949_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257186_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257181_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257149_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN040781_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700514_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700513_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700511_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700449_MHBs_P-D      DPALNMEXXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGX
HQ236016_MHBs_P-D      DLAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ236014_MHBs_P-D      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ922005_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSLWTSLNFLGGT
GQ922003_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ922002_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ922001_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183485_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183481_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183478_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904439_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904422_MHBs_P-D      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ692533_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ692507_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ692506_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ349232_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ349209_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594433_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594426_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU414143_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU414141_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
X97849_MHBs_P-D        DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
X72702_MHBs_P-D        DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
LT992444_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX357638_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU736925_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KR905423_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP322601_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM108593_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF679995_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX096957_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090718_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090713_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090699_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090696_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090685_MHBs_P-D      DPALNMEYITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090683_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090679_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090625_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGT
JX090618_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ687530_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGT
JN664939_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604295_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257188_MHBs_P-D      XPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754597_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700512_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700510_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ349208_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ349205_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594430_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594425_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594418_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594399_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594398_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KY629630_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU736924_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT962025_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP230541_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP202945_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP165602_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP165601_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP165599_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP165598_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP143745_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP143744_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ470889_MHBs_P-D      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF584162_MHBs_P-D      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX096956_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090717_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090711_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090675_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN604238_MHBs_P-D      DPVRNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257150_MHBs_P-D      DXAXNMENITSGFLGPLLVLQAGFFLLTXILTIPXSLDSWWTSLNFLGGT
GQ924652_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ477452_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594428_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594423_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594422_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594420_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594419_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594408_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
X97848_MHBs_P-D        DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX090716_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN792910_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN792909_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN792908_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN792907_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN792904_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU414140_MHBs_P-D      DPVPNMESITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGT
JN792903_MHBs_P-D      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
                           .*    :  *  *  : *              *    .:*   *  

GQ477455_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX310734_MHBs_P-D      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB222710_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU787438_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM524340_MHBs_P-D      TACLGQNSQSPTSNHSPTSCPPTCTGYRWMCLRRFIIFLFILLLCLIFLL
KT201234_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCTGYRWMCLRRFIIFLFILLLCLIFLL
KC875298_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KT201292_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KT201240_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN688685_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN257153_MHBs_P-D      TVCLGQNSQSPTCSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN257195_MHBs_P-D      TVCLGQNSQSPTCSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KT201241_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ399006_MHBs_P-D      TVCRGQNSQSPTSNHSPTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLL
EU155895_MHBs_P-D      TVCLGQNSQSPTFNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSL
EU155893_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX310727_MHBs_P-D      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY090452_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ464168_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPACPGCRWVCLRRFVSFLFSLLLCLIFLL
MF979165_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674420_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB048701_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCVGYRWMCLRRFIIFLFILLLCLIFLL
JN642154_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
DQ991752_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB270550_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674424_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674406_MHBs_P-D      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB205128_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFPFILLLCLIFLL
JX090615_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY796031_MHBs_P-D      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674428_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLL
AB674425_MHBs_P-D      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674416_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLL
AY161153_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY161155_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY741798_MHBs_P-D      TVCLGQNSQSPTSSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY090453_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLL
JF439699_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF439700_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF439701_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF439704_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF439705_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF439706_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF439709_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF439710_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF439711_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF439718_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF439708_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF439692_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFPFILLLCLIFLL
JF439703_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFPFILLLCLIFLL
DQ329356_MHBs_P-D      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ329357_MHBs_P-D      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ336690_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY236160_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ336678_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ336679_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ336675_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ336676_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ336677_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ336674_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ464176_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ336691_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ464175_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ464178_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY236164_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ486021_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ486022_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ336685_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ336689_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ464172_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ464173_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ464174_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ464177_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ336686_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCSRRFIIFLFILLLCLIFLL
DQ336687_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCSRRFIIFLFILLLCLIFLL
DQ336688_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCSRRFIIFLFILLLCLIFLL
DQ336692_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCSRRFIIFLFILLLCLIFLL
GQ167301_MHBs_P-D      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSL
GQ167302_MHBs_P-D      TACRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSL
AB674431_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB126581_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ304548_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ304550_MHBs_P-D      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EF103281_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY236162_MHBs_P-D      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ304547_MHBs_P-D      TACRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ304551_MHBs_P-D      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674411_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB330367_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLL
AB270546_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF151735_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674429_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674427_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB270547_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY161159_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY161160_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY741794_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY741795_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY741796_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ111986_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB104709_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB222712_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB222713_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674422_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF214660_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY661792_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY661793_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY721605_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY721606_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY721608_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY721612_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY796030_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY796032_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB786644_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY161150_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AJ344116_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB583680_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB104712_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU414136_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU414135_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ991754_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY741797_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY721607_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AJ627224_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF121241_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF121240_MHBs_C-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB270548_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB270543_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB270542_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB246347_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB222709_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB222711_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF979155_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX310735_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040769_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF754617_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIICLFILLLCLIFLL
GQ184322_MHBs_P-D      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EF103276_MHBs_P-D      TVCLGQQLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB555500_MHBs_P-D      TVCLGQNSQSPTSNHSPTCCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB119255_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIICLFILLLCLIFLL
AB090270_MHBs_P-D      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB119256_MHBs_P-D      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB090268_MHBs_P-D      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB120308_MHBs_P-D      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB078031_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB078032_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB078033_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB109475_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB109476_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB109477_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB109479_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB110075_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB119251_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB119252_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB119253_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB119254_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB205126_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB210821_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB210822_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB267090_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB471856_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB471857_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB090269_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ464182_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ486025_MHBs_P-D      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ464170_MHBs_P-D      TVCLGENSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY230116_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB330369_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB493846_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF214659_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTRPGYRWMCLRRFIIFLFILLLCLIFLL
AM422939_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY233291_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY233296_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ131122_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ315776_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB330370_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456665_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183467_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCVLRGIILLFLLLLCLIFLL
AY233292_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY233294_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674419_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB555496_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM108608_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439696_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTRPGYRWMYLRRFIIFPFILLLCLIFLL
AB674408_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB188244_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB104711_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB786650_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK052954_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCLRRFIIFLFTLLLCLIFLL
MK052953_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCLRRFIIFLFTLLLCLIFLL
JX096955_MHBs_P-D      TVCLGQNSQSPTTNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX090609_MHBs_P-D      TVCLGQNSQFPTSNHSLTSCPPTCPGYHWMCLRRFIIFLFILLLCLIFLL
JN604139_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF754588_MHBs_P-D      TVCIGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLL
GU456636_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904429_MHBs_P-D      TVCLGQNSQSPTSNHSPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB555497_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB188242_MHBs_P-D      TVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK052949_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSL
MF979166_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX276998_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM108595_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC012652_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX470760_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX090690_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIICLCILLLCLIFLL
JN604250_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040782_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040775_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCAGYRWMYLRRFIIFLFILLLCLIFLL
GU456684_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456678_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456657_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLL
GU456642_MHBs_P-D      TVCLGQNSQSPTSNHSLTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLL
DQ464169_MHBs_P-D      TVCLGENSQSPTSNHSPTSCPPTCPGYRSMCLRRFIIFLFILLLCLIFLL
AY945307_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AJ627219_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF280817_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674423_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
AB674403_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB555501_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB270539_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF979168_MHBs_P-D      TVCLGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLL
KJ647350_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLL
KF471659_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF471655_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX090680_MHBs_P-D      TVCRGQNSQSPTSNHSPTSCPPTCPGYRLMCLRRSIIFLFILLLCLIFLL
JX090634_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX090611_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPLTCPGYRWMCLRRFIIFLFILMLCLIFLL
JN642164_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN642158_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN642126_MHBs_P-D      TVSLGKNSQSPTSNHSQTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLL
JN040822_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456639_MHBs_P-D      TVCLGQNSQCPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183448_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904419_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLL
FJ349215_MHBs_P-D      TVCVVQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AJ627223_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AJ131956_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF214661_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF043594_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674407_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB116266_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB109478_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB104710_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
X65258_MHBs_P-D        TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRGFIIFLFILLLCLIFLL
MK052952_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCPRRFIIFLFILLLCLIFLL
MK052950_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSL
MF925391_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP090179_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ843187_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF471640_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF170768_MHBs_P-D      TACLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF170756_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX090610_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN688711_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN642157_MHBs_P-D      TVCLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLL
JN642140_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFHFILLLCLIFLL
JN040817_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JN040790_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPSCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040787_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040784_MHBs_P-D      TVCLGQNSQSLTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF754631_MHBs_P-D      TGCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700444_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456649_MHBs_P-D      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ899792_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB246348_MHBs_P-D      TVCLGQSSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB210820_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB205127_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK052959_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSL
MK052951_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLL
MF979173_MHBs_P-D      TVCLGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLL
KM108596_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF679990_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF061169_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX090712_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFLLLLCLIFLL
JX090616_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLL
JQ707689_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN642163_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN642150_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN642149_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN642138_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPVYRWMCLRHFIIILFILLLCLIFLL
JN642131_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPRTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN604275_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040786_MHBs_P-D      TVCLGQNSQSLTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040771_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF754629_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456682_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456654_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456645_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456643_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ349219_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ349213_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
EU159677_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EF103275_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ315778_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY221115_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY161158_MHBs_P-D      TVCLGQNSQSPASNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY161157_MHBs_P-D      TVCLGQNSQSPASNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AJ627222_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AJ627215_MHBs_P-D      TVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF121242_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF121239_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
AB674405_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
U87737_MHBs_P-D        TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK052947_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCLRRFIIFLFILLLCLIFLL
MF979174_MHBs_P-D      TVCLGQNSQSLTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
M32138_MHBs_P-D        TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
L27106_MHBs_P-D        TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP165597_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
KP143743_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
KP143742_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
KM108621_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLSLIFLL
KF476030_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF471644_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSL
KF053178_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX310733_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX090677_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ927384_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707690_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN664919_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLL
JN642133_MHBs_P-D      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTSLL
JN040812_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JN040788_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040753_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456653_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
GQ183468_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183466_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183465_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183464_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183463_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183462_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183458_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183457_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183455_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183454_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183453_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183452_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183451_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183450_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183449_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ349235_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707682_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707684_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707685_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707686_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707687_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707688_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707691_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707692_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707693_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLL
JQ707694_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707695_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707696_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707698_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707700_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707701_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707703_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707704_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707705_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK052975_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK052973_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK052972_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCLGYRWMCLRRFIIFLFILLLCLIFLL
MK052961_MHBs_P-D      TVCLGQNSQSPTSNYSPTSCPPTCLGYRWMCLRRFIIFLFILLLCLIFLL
MK052960_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLL
MK052958_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLL
MK052956_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLL
MK052955_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLL
MK052948_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLL
MF925390_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRSMCLRRFIIFLFILLLCLIFLL
MF925366_MHBs_P-D      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
KX827291_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX196233_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KT151620_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP168419_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM108599_MHBs_P-D      TVGLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ647353_MHBs_P-D      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF779222_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF170761_MHBs_P-D      TVCLGQNSQSPTSSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLL
JX090723_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX090641_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX090637_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX090629_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX090622_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX036334_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYHWMCLRRFIIFLFILLLCLIFLL
JQ707529_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRRMCLRRFIIFLFILLLCLIFLL
JQ707517_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707513_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN664928_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLYSLIFLL
JN642166_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN642165_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN642161_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN642151_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN604301_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN604259_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN604196_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN257201_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN257200_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040830_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040809_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040800_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040779_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040770_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF754623_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700474_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700472_MHBs_P-D      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456675_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456669_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456666_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456661_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456650_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ183479_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMRLRRFIIFLFILLLCLIFLL
GQ183456_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904418_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU939681_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB188241_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
U87851_MHBs_P-D        TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK052974_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK052971_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLL
MK052966_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLL
MK052963_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLL
MH464838_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MH464836_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF979175_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF979171_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF979163_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF979161_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF979157_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF979156_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF618349_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KT366465_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KR139748_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM606755_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM524341_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM108609_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSL
KF779376_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF779341_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF061170_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX090700_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLL
JX090689_MHBs_P-D      TVCLGQNSQSPTSHHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX090644_MHBs_P-D      TACLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX090635_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX090624_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGFRWMCLRRFIIFLFILLLCLIFLL
JX036331_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707525_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707524_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN688712_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN664932_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN664931_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIISLFILLLCLIFLL
JN664926_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN642144_MHBs_P-D      TVCLGLNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN604318_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLL
JN604170_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN257183_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN257148_MHBs_P-D      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040814_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040791_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040773_MHBs_P-D      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040766_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040762_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF815679_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF815678_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF815674_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF815673_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF815670_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF815666_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF754635_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF754633_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF754611_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456683_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456679_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU456652_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ477458_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904438_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904410_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTWPGYRWMCLRRFIIFLFILLLCLIFLL
FJ562338_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU787443_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU414139_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU414138_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EF103277_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCVRRLIIFLFILLLCLIFLL
AJ627220_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AJ627218_MHBs_P-D      TVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB270541_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN257176_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN257177_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ470895_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
X80926_MHBs_P-D        TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
X80924_MHBs_P-D        TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX276857_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX276856_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFXLLLCLXFLL
KX196227_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX196222_MHBs_P-D      TVCLGQNSQSPTSNDSATSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX196219_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX196215_MHBs_P-D      TVCLGQNSQSPTSNQSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX196212_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX196209_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX196208_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KT366494_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP090178_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP090177_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM524338_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLILLL
KM212957_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM108592_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ647355_MHBs_P-D      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF779289_MHBs_P-D      TVCLGQNSQSPTSNHSPTS