HBVdb

Dataset for protein HBx of genotype E

[Download (right click)] [Edit] [Sequences] [Repertoires]

364 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


HM363566_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVTGSLGDLSSPSPSAVPAVYG
HM363611_HBx_P-E      MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363599_HBx_P-E      MAARLCCQLDPARDVLRLRPVSGESWGRPVSGSLGDLSSPSPSAVPADHG
HM363597_HBx_P-E      MGARMCCQLDPGRDVLCLRPVSAESWGRPVSGSLGDLSSPSPSAVPGDHG
HM363596_HBx_P-E      MAARLGCQLDPGRDVLCLRPVSAESCGRPVSGSLGGLSSPSPSGVPADHG
HM363584_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGDLSSPSPSAVPADHG
MF772359_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAAHG
GQ161757_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161760_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161778_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
GQ161808_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161810_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
HM363600_HBx_P-E      MGARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDISSPSPSAVPAVHG
AY739674_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AY739675_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSSSPSAVPADHG
HM363590_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MF772355_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
HM363568_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVLGSLGDLPSPSPSAVPADHG
GQ161831_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161768_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGDLSSPSPSAVPADHG
AB274985_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274975_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPPPSAVPADHG
KF849720_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPPPSAVPADHG
AB219534_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDVSSPSPSAVPADHG
AB205189_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB219533_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
AB219529_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSFGGLSSPSPSAVPADHG
AB274973_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AY935700_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
FN545823_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594750_HBx_P-E      MAARLCCKLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
GQ161811_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KT749841_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB194948_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AB205188_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594762_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363576_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363579_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363580_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363581_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363586_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAAHG
HM363587_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363589_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363592_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363594_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLPSPSPSAVPADHG
HM363603_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
HM363608_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
LT623845_HBx_P-E      MAARLCCQLDPXRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594748_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPXDHG
KF170741_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSFGGLSSPSPSAVPADHG
HQ700551_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MF772356_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MF772357_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594749_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPAVHG
HM363606_HBx_P-E      MAARLCCQLAPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363565_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVPGSLGDLSSPSPSAVPADHG
HM363605_HBx_P-E      MAARLCCQLDPARDVLCIRPVSAESCGRPISGSLGDLPSPSPSAVPAVHG
GQ161781_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAIPADHG
LT623850_HBx_P-E      MAARLCCQLDTARDVLCLRPVSAESRGRPVSGSLGDLSSPSPSAVPADHG
HM363593_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDVSSPSPSAVPTDHG
AB915178_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776534_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MG776744_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
HM363609_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
FN545827_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPAAVPADHG
FJ349240_HBx_P-E      MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTDHG
EU239220_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KF849716_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849717_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGDLSSPSPSAVPADHG
MH580648_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580640_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLRDLSSPSPSAVPADHG
MH580641_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLRDLSSPSPSAVPADHG
MH580626_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776797_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776550_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCRRPVSGSLGDLSSPSPSAVPADHG
MG776503_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MF772358_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
LT623851_HBx_P-E      MAARLCCQLDPARDVLCLRPVXTESCGRPVPGSLGDLSSPSPSAVPAXHG
KF849715_HBx_P-E      MAARMCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
HM363582_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGDLSSPSPSAVPADHG
HM363583_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGDLSSPSPSAVPADHG
GQ161785_HBx_P-E      MAARLYCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594751_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTNHG
FJ349226_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDFSSPSPSAVPADHG
EU239222_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAKSCGRPVSGSLGDLSSPSPSAVPADHG
DQ060824_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADDG
AY738147_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
AY738144_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
AY738145_HBx_C-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
AY738146_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
AM494712_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
AM494714_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
AM494832_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
KF170742_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
AM494706_HBx_P-E      MAARLCCQLDPARDVLCLRPVSVESCGRPVSGSLGDLSSPSPSAVPADHG
AM494699_HBx_P-E      MAARLCCQLDTTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494692_HBx_P-E      MAARLYCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494691_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274984_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPPASAVPADHG
AB274981_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPTPSAVPPVHG
AB274979_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274978_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPTPSAVPADHG
AB274977_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPAPSAVPADHG
AB201290_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGGLSSPSPSAVPADHG
AB201287_HBx_P-E      MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
GQ161775_HBx_P-E      MAARLXCQLDXSRDVLCLRPVGAESRGRPLSGXLGTLSSPSPSAVPTDHG
MG776729_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGPLSSPSPSAVSTDHG
GQ161776_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161784_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161789_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161828_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161765_HBx_P-E      MAARMCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161769_HBx_P-E      MAARMCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161779_HBx_P-E      MAARMCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363591_HBx_P-E      MAARMCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274969_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPLSGSLGDLSSPTPSAVPADHG
EU239217_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPTPSAVPADHG
LT623849_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPTPSAVPADHG
HM363575_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363578_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
HM363598_HBx_P-E      MAARLCCQLDPGRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FJ349237_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
FJ349238_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
GQ161796_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
MH580631_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
MH580632_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
MH580652_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
GQ161782_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSLSAVPSDHG
GQ161792_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSLSAVPSDHG
GQ161814_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSLSAVPSDHG
AB106564_HBx_C-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPAAHG
AB274980_HBx_P-E      MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MK321264_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEXCGRPVSGSLGDLSSPSPSAVPADHG
MH580645_HBx_P-E      MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH464856_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPAVHG
MG776772_HBx_P-E      MAARLCCQLDPGRDVLCLRPVSAESCGRPVSGSLGDLSSSSPSAVPADHG
MF772361_HBx_P-E      MAARLCCQLDLARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MF772360_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTVHG
LT623842_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KM606739_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTVHG
KF849719_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPTDYG
KF849718_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
HM363574_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTDHG
GQ161812_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPPDHG
EU239224_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRSVSGSLGGLSSPSPSAVPADHG
DQ060823_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPTDHG
DQ060822_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
DQ060830_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB091255_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRSVSGSLGDLSSPSPSAVPADHG
AB915176_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB915180_HBx_P-E      MAARLCCQLDPERDVLCLRPVSAESSGRPVSGSLGDLSSPSPSAVPADHG
AM494695_HBx_P-E      MAARLCCQLDPXRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494711_HBx_P-E      MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594765_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
KU736891_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
KU736892_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
KU736909_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
EU239223_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGGLSSPSPSAVPADHG
FJ349227_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN545822_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
FN594752_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
FN594761_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPAXHG
GQ161815_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161823_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAAHG
GQ161834_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLPSPSPSAVPADHG
KF849725_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849728_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF922438_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
KF922439_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
KM606738_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
KT192626_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
LT623844_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESSGRPVSGSLGGLSSPSPSAVPADHG
MG776426_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
LT623847_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
MH580633_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
FN545841_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPAAVPADHG
MH580614_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580615_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580616_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580618_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580619_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580620_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580623_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580651_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
FN545842_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPAAVPADHG
GQ161807_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
EU239219_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGGLSSPSPSAVPADHG
GQ161790_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161799_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161805_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161818_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161821_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KF849727_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KU736899_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736904_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736903_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494705_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274982_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTDHG
FJ349239_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTDHG
AM494689_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494698_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
FN594758_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776800_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSSSPSAVPAVHG
AB915177_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPANHG
AM494690_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494693_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494697_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494701_HBx_P-E      MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGALSSPSPSAVPADHG
AM494702_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494703_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494704_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494707_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494708_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494709_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494710_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
AM494713_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494715_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494717_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594766_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363569_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363570_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363571_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363572_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363573_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
KU736893_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736900_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736901_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736902_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
KU736905_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736906_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736907_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736908_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736910_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736911_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736912_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736913_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776403_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776512_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776678_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776737_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776798_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776799_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580617_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPISGSLGDLSSPSPSAVPADHG
MH580628_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPISGSLGDLSSPSPSAVPADHG
MH580630_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580644_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580650_HBx_P-E      MAARLCCQLDPARDVLCLRPVNAESCGRPVSGSLGDLSSPSPSAVPADHG
X75657_HBx_P-E        MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB091256_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGGLSSPSPSAVPADHG
AB194947_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB201288_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB201289_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGGLSSPSPSAVPADHG
AB205129_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB205190_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB205191_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
AB205192_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274970_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274971_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274972_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274974_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274976_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB915175_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
AM494694_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494696_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494700_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
DQ060825_HBx_P-E      MAARLCCQLDPERDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
DQ060826_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
DQ060827_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
DQ060828_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
DQ060829_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
EU239221_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
EU239226_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
FN545821_HBx_P-E      MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594756_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594763_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
GQ161755_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161756_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161758_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161759_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161761_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161762_HBx_P-E      MAARLCCQLDPARDVLCLRPVRAESCGRPVSGSLGGLSSPSPSAVPADHG
GQ161763_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161764_HBx_P-E      MAARLCCQLDPTRDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161766_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161770_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161771_HBx_P-E      MAARLCCQLDPTRDVLCLRPVGAESCGRPVSGSLGALSSPSPSAVPADHG
GQ161772_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161773_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161774_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161777_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161780_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161783_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161786_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161787_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161791_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161793_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161794_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161795_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161797_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161798_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161800_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161801_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161802_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161803_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161804_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161816_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161817_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSTVPADHG
GQ161819_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580649_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPAVHG
MH580647_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580646_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPAVHG
MH580638_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580637_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580636_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580635_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580634_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580629_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPAVHG
MH580625_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580624_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPAVHG
MH580622_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580621_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MF772362_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSSSPSAVPADHG
LT623848_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
LT623846_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGGLSSPSPSAVPADHG
LT623843_HBx_P-E      MAARLYCQLDPARDVLCLRPVSAESCGRPVSGSFGGLSSPSPSAVPAVHG
KX186584_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736898_HBx_P-E      MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736897_HBx_P-E      MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736896_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736895_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736894_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGGLSSPSPSAVPADHG
KF849726_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849724_HBx_P-E      MAARLYCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
KF849723_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849722_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849721_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849714_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849713_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
JQ000009_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
JQ000008_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HQ700552_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HQ700550_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363588_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363577_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
GQ161836_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPANHG
GQ161835_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161833_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
GQ161832_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161830_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161829_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161827_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161826_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161825_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSPGDLSSPSPSAVPADHG
GQ161824_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161820_HBx_P-E      MAARLCCQLDPARDVLCLRPVXAESCGRXVSGSLGDLSSPSPSAVPADHG
GQ161822_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
MG776745_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MG776734_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776427_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MF772354_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPTDHG
FN594759_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSXSPSAVPPDHG
JQ272902_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
FN594753_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTDHG
FN594760_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTDHG
                      *.**: *:*   **** :***  :   * . *    ..* . : :.   *

HM363566_HBx_P-E      SHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363611_HBx_P-E      AHLSLRGLPVCGFTSAGPWGLPFTSARLMAPTVN--AHQSLAKVLHKRTL
HM363599_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363597_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETIVN--AHQLLAKGLYKRTL
HM363596_HBx_P-E      AHLSLPGLPVWGFSSGGPGGLRFTSGRHMETTVN--AQQILPKVLHKRTL
HM363584_HBx_P-E      AHLSLRGLPVWGFSSAGPCALPFTSARRMETTVN--AHQILPKVLHKRTL
MF772359_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVN--ARQILPKVLHKRTL
GQ161757_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161760_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161778_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161808_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161810_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363600_HBx_P-E      AHLSLPGLPVCAFSSAGPCALRFTSARRMETTVN--AHQCLPKVLHKRTL
AY739674_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--THQILPKVLHKRTL
AY739675_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--THQILPKVLHKRTL
HM363590_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--THQILPKVLHKRTL
MF772355_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQFLPKVLHKRTL
HM363568_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
GQ161831_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161768_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
AB274985_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB274975_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KF849720_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB219534_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB205189_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPRVLHKRTL
AB219533_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHAHQILPKVLYKRTL
AB219529_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQPLPKVLHKRTL
AB274973_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AY935700_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
FN545823_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
FN594750_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQVLPKVLHKRTL
GQ161811_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KT749841_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB194948_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB205188_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQFLPKVLYKRTL
FN594762_HBx_P-E      AHLSLRGLPICAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363576_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363579_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363580_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363581_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363586_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTV
HM363587_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARSMETTVN--AHQILPKVLHKRTL
HM363589_HBx_P-E      AHLSLRGLPVCGFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363592_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363594_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363603_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSPRRMETTVN--AHQSLPKVLHKRTL
HM363608_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKGLHKRTL
LT623845_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQXLPKVLHKRTL
FN594748_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQXLPKVLHKRTL
KF170741_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HQ700551_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MF772356_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
MF772357_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
FN594749_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363606_HBx_P-E      AHLSLRGLPVCALSSAGPCALRFTSPRRMETTVN--AHQLSPKVGHKRTL
HM363565_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTFARRMETTVN--AHQILPKVLHKRTL
HM363605_HBx_P-E      AHLSLRGLPVCALSSNGPCALRFTFPRRMETTVN--AHQLLPKVLYKRTL
GQ161781_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
LT623850_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--THQILPKVLHKRTL
HM363593_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
AB915178_HBx_P-E      AHVSLRRLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MG776534_HBx_P-E      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
MG776744_HBx_P-E      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
HM363609_HBx_P-E      AHLSLRGLPVCAFSSAAPCALRFTSARRMETTVN--AHLILPKVLHKRTL
FN545827_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
FJ349240_HBx_P-E      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
EU239220_HBx_P-E      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVN--AHQSLPKVLHKRTL
KF849716_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KF849717_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580648_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580640_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
MH580641_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
MH580626_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHRLLPKVLHKRTL
MG776797_HBx_P-E      AHLSLRGLPVCACSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MG776550_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MG776503_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MF772358_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMEATVN--AHQILPKVLYKRTL
LT623851_HBx_P-E      AHLSLRGLPVCAFSXAGPCALRFTSVRRMETTVN--AHQFLPKVLHKRTL
KF849715_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363582_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363583_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161785_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
FN594751_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQXLPKVLYKRTI
FJ349226_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
EU239222_HBx_P-E      AHLSLRSLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
DQ060824_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AY738147_HBx_P-E      AHLSVRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AY738144_HBx_P-E      AHLSVRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AY738145_HBx_C-E      AHLSVRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AY738146_HBx_P-E      AHLSVRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AM494712_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
AM494714_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
AM494832_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KF170742_HBx_P-E      AHLSLRGLPVCXFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AM494706_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
AM494699_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AM494692_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
AM494691_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETPVN--AHKILPKVLHKRTL
AB274984_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
AB274981_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB274979_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB274978_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB274977_HBx_P-E      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB201290_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQVLPKVLHKRTL
AB201287_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161775_HBx_P-E      AHLSLRGLPVCAFSPAGPCALRFTSARCMETTVN--AHQILPKVLHKRTL
MG776729_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQVLPKVLHKRTL
GQ161776_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161784_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161789_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161828_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161765_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161769_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161779_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363591_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
AB274969_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
EU239217_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
LT623849_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363575_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETSVN--AHQILPKVLHKRTL
HM363578_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETIVN--AHQILPKVLYKRTL
HM363598_HBx_P-E      AHLSLRGLPVCAFSSAGPCGLRFTSARRMETIVN--APQILAKGLHKRTL
FJ349237_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
FJ349238_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161796_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580631_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580632_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580652_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161782_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161792_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161814_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB106564_HBx_C-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHRILPKVLHKRTL
AB274980_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHRSLPKVLHKRTL
MK321264_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETPVN--ARQILPKVLHKRTL
MH580645_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRVTSARRMETTVN--AHQILPKVLHKRTL
MH464856_HBx_P-E      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MG776772_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
MF772361_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
MF772360_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
LT623842_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KM606739_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KF849719_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KF849718_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHNRTL
HM363574_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHRILPKVLHKRTL
GQ161812_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
EU239224_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
DQ060823_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
DQ060822_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
DQ060830_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB091255_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB915176_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB915180_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVS--AHQILPKVLYKRTL
AM494695_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
AM494711_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
FN594765_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQSLPKVLHKRTL
KU736891_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KU736892_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLXKRTL
KU736909_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
EU239223_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
FJ349227_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
FN545822_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVS--AHQSLPKVLHKRTL
FN594752_HBx_P-E      AHLSLRGLPICAFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
FN594761_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161815_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161823_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQSLPKVLHKRTL
GQ161834_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KF849725_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQSLPKVLHKRTL
KF849728_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
KF922438_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KF922439_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KM606738_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KT192626_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
LT623844_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLXKRTL
MG776426_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
LT623847_HBx_P-E      AHLSLRGLPVCAFSXAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580633_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
FN545841_HBx_P-E      AHLSLRGLPICAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
MH580614_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
MH580615_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
MH580616_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
MH580618_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
MH580619_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
MH580620_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
MH580623_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
MH580651_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
FN545842_HBx_P-E      AHLSLRGLPXCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
GQ161807_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHTILPKVLHKRTL
EU239219_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHKILPKVLHKRTL
GQ161790_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHLILPKVLHKRTL
GQ161799_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHLILPKVLHKRTL
GQ161805_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHLILPKVLHKRTL
GQ161818_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHLILPKVLHKRTL
GQ161821_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHLILPKVLHKRTL
KF849727_HBx_P-E      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHHVLPKVLHKRTL
KU736899_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHHILPKVLHKRTL
KU736904_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHRXLPKVLHKRTL
KU736903_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHRILPKVLHKRTL
AM494705_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHKILPKVLHKRTL
AB274982_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
FJ349239_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AM494689_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
AM494698_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
FN594758_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
MG776800_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVS--AHQLLPKVLYKRTL
AB915177_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
AM494690_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AM494693_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AM494697_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
AM494701_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQVLPKVLHKRTL
AM494702_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AM494703_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
AM494704_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AM494707_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQVLPKVLHKRTL
AM494708_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AM494709_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
AM494710_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
AM494713_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AM494715_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AM494717_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
FN594766_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
HM363569_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
HM363570_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363571_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
HM363572_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
HM363573_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KU736893_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KU736900_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KU736901_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
KU736902_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KU736905_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KU736906_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KU736907_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KU736908_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KU736910_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KU736911_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
KU736912_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KU736913_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MG776403_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MG776512_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MG776678_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MG776737_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
MG776798_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MG776799_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580617_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
MH580628_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
MH580630_HBx_P-E      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
MH580644_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
MH580650_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
X75657_HBx_P-E        AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB091256_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB194947_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB201288_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB201289_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB205129_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB205190_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
AB205191_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB205192_HBx_P-E      AHLYLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB274970_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQFLPKVLHKRTL
AB274971_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB274972_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB274974_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AB274976_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKALHKRTL
AB915175_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AM494694_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AM494696_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
AM494700_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
DQ060825_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
DQ060826_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
DQ060827_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
DQ060828_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
DQ060829_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
EU239221_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
EU239226_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
FN545821_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
FN594756_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
FN594763_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161755_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161756_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161758_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161759_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQVLPKVLHKRTL
GQ161761_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161762_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161763_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161764_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161766_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161770_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161771_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161772_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161773_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161774_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161777_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161780_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161783_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161786_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161787_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161791_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161793_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161794_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161795_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161797_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQFLPKVLHKRTL
GQ161798_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161800_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161801_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQMLPKVLHKRTL
GQ161802_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161803_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
GQ161804_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161816_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161817_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161819_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580649_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580647_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580646_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580638_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580637_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580636_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580635_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580634_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580629_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580625_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580624_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580622_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MH580621_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MF772362_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
LT623848_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQFLPKVLHKRTL
LT623846_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
LT623843_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQFLPKVLHKRTL
KX186584_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KU736898_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KU736897_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KU736896_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KU736895_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KU736894_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KF849726_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSTRRMETTVT--AHQILPKVLHKRTL
KF849724_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KF849723_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVN--AHQILPKVLHKRTL
KF849722_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KF849721_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KF849714_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
KF849713_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
JQ000009_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
JQ000008_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HQ700552_HBx_P-E      AHLSLRGLPICAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HQ700550_HBx_P-E      AHLSLRGLPICAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363588_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
HM363577_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161836_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161835_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161833_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
GQ161832_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161830_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161829_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161827_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161826_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161825_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161824_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161820_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
GQ161822_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
MG776745_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
MG776734_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
MG776427_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLYKRTL
MF772354_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQILPKVLHKRTL
FN594759_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
JQ272902_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--ARQILPKVLHKRTL
FN594753_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLYKRTL
FN594760_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVN--AHQLLPKVLHKRTL
                      : : :  **    :  .* .* .*  * * . *.  :    ..   :**:

HM363566_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363611_HBx_P-E      GLSAMSTTDLEGYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363599_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363597_HBx_P-E      GLSGMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363596_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363584_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
MF772359_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHNLVCAPAPC
GQ161757_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPC
GQ161760_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161778_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161808_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161810_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVIVLGGCRHKLVCAPAPC
HM363600_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
AY739674_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCVPAPC
AY739675_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCVPAPC
HM363590_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
MF772355_HBx_P-E      GLSAMSTTDLEAYFRDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
HM363568_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
GQ161831_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
GQ161768_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
AB274985_HBx_P-E      GLSAMSTTGLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
AB274975_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPSPC
KF849720_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEDLGEETRLMIFVLGGCRHKLVCAPAPC
AB219534_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPSPC
AB205189_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPC
AB219533_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIYVLGGCRHKLVCAPVPC
AB219529_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLLIFVLGDCRHKLVCAPAPC
AB274973_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
AY935700_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
FN545823_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
FN594750_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
GQ161811_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
KT749841_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
AB194948_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLQVFVLGGCRHKLVCAPSPC
AB205188_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLQVFVLGGCRHKLVCAPAPC
FN594762_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363576_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363579_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363580_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363581_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363586_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363587_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363589_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363592_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363594_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363603_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363608_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
LT623845_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
FN594748_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLRLFVLGGCRHKLVCAPAPC
KF170741_HBx_P-E      GLSAMSTTVLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700551_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPC
MF772356_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPC
MF772357_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPC
FN594749_HBx_P-E      GLSGMSTTVLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPC
HM363606_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPC
HM363565_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HM363605_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161781_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
LT623850_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HM363593_HBx_P-E      GLLAMSTTDLEAYFKDCLFKDWEELGEESRLKVFVLGGCRHKLVCAPAPC
AB915178_HBx_P-E      GLSAMSTTDLEAYFKDCVFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPC
MG776534_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMTFVLGGCRHKLVCAPAPC
MG776744_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMTFVLGGCRHKLVCAPAPC
HM363609_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPC
FN545827_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEESRLMIFVLGGCRHKXVCAPAPC
FJ349240_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEETRLMIFVLGGCRHKLVCAPPPC
EU239220_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCVPAPC
KF849716_HBx_P-E      GLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCALAPC
KF849717_HBx_P-E      GLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH580648_HBx_P-E      GLSAMSTTDLEAYFKDCLLKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MH580640_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MH580641_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MH580626_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPC
MG776797_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEELRLKVFVLGGCRHKLVCAPAPC
MG776550_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MG776503_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGRRHKLVCSPAPC
MF772358_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIYVLGGCRHKLVCAPAPC
LT623851_HBx_P-E      GLSAMSTSDLEAYFKDCLFKDWEELGEEXRLMIFVLGGCRHKLVCAPAPC
KF849715_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HM363582_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPC
HM363583_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPC
GQ161785_HBx_P-E      GLSALSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGGCRHKLVCAPAPC
FN594751_HBx_P-E      GLSAMSTTGLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FJ349226_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
EU239222_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPTPC
DQ060824_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AY738147_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPC
AY738144_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AY738145_HBx_C-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AY738146_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AM494712_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494714_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494832_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
KF170742_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494706_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494699_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494692_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEESRLMIFVLGGCRHKLVCAPAPC
AM494691_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEELRLMIFVLGGCRHKLVCAPAPC
AB274984_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCVPAPC
AB274981_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPC
AB274979_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPC
AB274978_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPSPC
AB274977_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB201290_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB201287_HBx_P-E      GLCAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161775_HBx_P-E      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
MG776729_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
GQ161776_HBx_P-E      GLYAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161784_HBx_P-E      GLYAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161789_HBx_P-E      GLYAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161828_HBx_P-E      GLYAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161765_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161769_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161779_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HM363591_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB274969_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPC
EU239217_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
LT623849_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVXVLGGCRHKLVCAPSPC
HM363575_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPC
HM363578_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPC
HM363598_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPC
FJ349237_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FJ349238_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161796_HBx_P-E      GLSAMSTTDLEAYFKECLFKDWEELGEEIRLQVFVLGGCRHKLVCAPAPC
MH580631_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH580632_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH580652_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161782_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161792_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161814_HBx_P-E      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB106564_HBx_C-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB274980_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLQVFVLGGCRHKLVCAPAPC
MK321264_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEEFGEEIRLKVFVLGGCRHKLVCAPAPC
MH580645_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH464856_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MG776772_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPC
MF772361_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MF772360_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
LT623842_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCAPAPC
KM606739_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRLKFLCSPAPC
KF849719_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KF849718_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HM363574_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
GQ161812_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLTVFVLGGCRHKLVCAPAPC
EU239224_HBx_P-E      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
DQ060823_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
DQ060822_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
DQ060830_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB091255_HBx_P-E      GLSAMSTTDLEAYFKACLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPC
AB915176_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPC
AB915180_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPC
AM494695_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPC
AM494711_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPC
FN594765_HBx_P-E      GLSXMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCVPAPC
KU736891_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPC
KU736892_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPC
KU736909_HBx_P-E      GLSTMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPC
EU239223_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
FJ349227_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
FN545822_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
FN594752_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
FN594761_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
GQ161815_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
GQ161823_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
GQ161834_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
KF849725_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
KF849728_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
KF922438_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
KF922439_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
KM606738_HBx_P-E      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
KT192626_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
LT623844_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEEXGEEIRLMIFVLGGCRHKLVCAPAPC
MG776426_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPC
LT623847_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
MH580633_HBx_P-E      GLSAMSTTDLEAYFKNCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
FN545841_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MH580614_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MH580615_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MH580616_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MH580618_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MH580619_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MH580620_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MH580623_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MH580651_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
FN545842_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161807_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
EU239219_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161790_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161799_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161805_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161818_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161821_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KF849727_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU736899_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU736904_HBx_P-E      GLSTMSTTDLEAYFKDCLFKDWEESGEEXRLKVFVLGGCRHKLVCVPAPC
KU736903_HBx_P-E      GLSTMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCVPAPC
AM494705_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AB274982_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FJ349239_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AM494689_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEETRLMIFVLGGCRHKLVCAPAPC
AM494698_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEETRLMIFVLGGCRHKLVCAPAPC
FN594758_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEETRLMIFVLGGCRHKLVCAPAPC
MG776800_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEETRLMIFVLGGCRHKLVCAPAPC
AB915177_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494690_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494693_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494697_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494701_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494702_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494703_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494704_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494707_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494708_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494709_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494710_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494713_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494715_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AM494717_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
FN594766_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
HM363569_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
HM363570_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
HM363571_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
HM363572_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
HM363573_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
KU736893_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
KU736900_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
KU736901_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
KU736902_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
KU736905_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
KU736906_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
KU736907_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
KU736908_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
KU736910_HBx_P-E      GLSVMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
KU736911_HBx_P-E      GLSVMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
KU736912_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
KU736913_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MG776403_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPSPC
MG776512_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MG776678_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MG776737_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MG776798_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MG776799_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPSPC
MH580617_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MH580628_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MH580630_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MH580644_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
MH580650_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
X75657_HBx_P-E        GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
AB091256_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPC
AB194947_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPC
AB201288_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPC
AB201289_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB205129_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB205190_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLQVFVLGGCRHKLVCAPAPC
AB205191_HBx_P-E      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB205192_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB274970_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB274971_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB274972_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB274974_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPC
AB274976_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB915175_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AM494694_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AM494696_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AM494700_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
DQ060825_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
DQ060826_HBx_P-E      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
DQ060827_HBx_P-E      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
DQ060828_HBx_P-E      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
DQ060829_HBx_P-E      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
EU239221_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
EU239226_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FN545821_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FN594756_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPC
FN594763_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161755_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161756_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161758_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161759_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161761_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161762_HBx_P-E      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161763_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161764_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161766_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161770_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161771_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161772_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161773_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161774_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161777_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161780_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161783_HBx_P-E      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161786_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161787_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161791_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161793_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161794_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161795_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161797_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPR
GQ161798_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161800_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161801_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161802_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161803_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161804_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161816_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPC
GQ161817_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161819_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH580649_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH580647_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH580646_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH580638_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH580637_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH580636_HBx_P-E      GLSAMSTTDLEAYFKNCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH580635_HBx_P-E      GLSAMSTTDLEAYFKNCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH580634_HBx_P-E      GLSAMSTTDLEAYFKNCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH580629_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH580625_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH580624_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH580622_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPC
MH580621_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MF772362_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
LT623848_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
LT623846_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
LT623843_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KX186584_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU736898_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU736897_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU736896_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU736895_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU736894_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KF849726_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KF849724_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCPPAPC
KF849723_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KF849722_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KF849721_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KF849714_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KF849713_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JQ000009_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JQ000008_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700552_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700550_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HM363588_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HM363577_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161836_HBx_P-E      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161835_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161833_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161832_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161830_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161829_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161827_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161826_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161825_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161824_HBx_P-E      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161820_HBx_P-E      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161822_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVYVLGGCRHKLVCAPAPC
MG776745_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEELRLKVFVLGGCRHKLVCAPSPC
MG776734_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEELRLKVFVLGGCRHKLVCAPAPC
MG776427_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMMFVLGGCRHKLVCAPAPC
MF772354_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEEIKLSVIVWGGCRHKLVXXXXXC
FN594759_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEISLKVFVLGGCRHKLVCAPAPC
JQ272902_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCAPAPC
FN594753_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEEXRLKXFVLGGCRHKLVCAPAPC
FN594760_HBx_P-E      GLSAMSTTDLEAYFKDCLFKDWEESGEELRLKVFVLGGCRHKLVCAPAPC
                      **  :**: **.**. *::*:**: ***      * *. * : :      

HM363566_HBx_P-E      NFFTSA
HM363611_HBx_P-E      NFFTSA
HM363599_HBx_P-E      NFFTSA
HM363597_HBx_P-E      NFFTSA
HM363596_HBx_P-E      NFFTSA
HM363584_HBx_P-E      NFFTSA
MF772359_HBx_P-E      FFFTSA
GQ161757_HBx_P-E      NFFTSA
GQ161760_HBx_P-E      NFFTSA
GQ161778_HBx_P-E      NFFTSA
GQ161808_HBx_P-E      NFFTSA
GQ161810_HBx_P-E      NFFTSA
HM363600_HBx_P-E      NFFTSA
AY739674_HBx_P-E      NFFTSA
AY739675_HBx_P-E      NFFTSA
HM363590_HBx_P-E      NFFTSA
MF772355_HBx_P-E      NFFTSA
HM363568_HBx_P-E      NFFTSA
GQ161831_HBx_P-E      NFFTSA
GQ161768_HBx_P-E      NFFTSA
AB274985_HBx_P-E      NFFTSA
AB274975_HBx_P-E      NFFTSA
KF849720_HBx_P-E      NFFTSA
AB219534_HBx_P-E      NFFTSA
AB205189_HBx_P-E      NFFTSA
AB219533_HBx_P-E      NFFTSA
AB219529_HBx_P-E      NFFTSA
AB274973_HBx_P-E      NFFTSA
AY935700_HBx_P-E      NFFTSA
FN545823_HBx_P-E      NFFTSA
FN594750_HBx_P-E      NFFTSA
GQ161811_HBx_P-E      NFFTSA
KT749841_HBx_P-E      NFFTSA
AB194948_HBx_P-E      NFFTSA
AB205188_HBx_P-E      NFFTSA
FN594762_HBx_P-E      NFFTSA
HM363576_HBx_P-E      NFFTSA
HM363579_HBx_P-E      NFFTSA
HM363580_HBx_P-E      NFFTSA
HM363581_HBx_P-E      NFFTSA
HM363586_HBx_P-E      NFFTSA
HM363587_HBx_P-E      NFFTSA
HM363589_HBx_P-E      NFFTSA
HM363592_HBx_P-E      NFFTSA
HM363594_HBx_P-E      NFFTSA
HM363603_HBx_P-E      NFFTSA
HM363608_HBx_P-E      NFFTSA
LT623845_HBx_P-E      NFFTSA
FN594748_HBx_P-E      NFFTSA
KF170741_HBx_P-E      NFFTPA
HQ700551_HBx_P-E      NFFTSA
MF772356_HBx_P-E      NFFTSA
MF772357_HBx_P-E      NFFTSA
FN594749_HBx_P-E      NFFTSA
HM363606_HBx_P-E      NFFTSA
HM363565_HBx_P-E      NFFTSA
HM363605_HBx_P-E      NFFTSA
GQ161781_HBx_P-E      IFFTSA
LT623850_HBx_P-E      NFFTSA
HM363593_HBx_P-E      NFFTSA
AB915178_HBx_P-E      NFFTSA
MG776534_HBx_P-E      NFFTSA
MG776744_HBx_P-E      NFFTSA
HM363609_HBx_P-E      NFFTSA
FN545827_HBx_P-E      NFFTSA
FJ349240_HBx_P-E      NFFTSA
EU239220_HBx_P-E      NFFTSA
KF849716_HBx_P-E      NFFTSA
KF849717_HBx_P-E      NFLTSA
MH580648_HBx_P-E      NFFTSA
MH580640_HBx_P-E      NFFTSA
MH580641_HBx_P-E      NFFTSA
MH580626_HBx_P-E      NFLTSA
MG776797_HBx_P-E      NFFTSA
MG776550_HBx_P-E      NFFTSA
MG776503_HBx_P-E      NFFTSA
MF772358_HBx_P-E      NFFTSA
LT623851_HBx_P-E      NFFTSA
KF849715_HBx_P-E      YFFTSA
HM363582_HBx_P-E      NFFTSA
HM363583_HBx_P-E      NFFTSA
GQ161785_HBx_P-E      NFFTSA
FN594751_HBx_P-E      NFFTSA
FJ349226_HBx_P-E      NFFTSA
EU239222_HBx_P-E      NFFTSA
DQ060824_HBx_P-E      NFFTSA
AY738147_HBx_P-E      NFFTSA
AY738144_HBx_P-E      NFFTSA
AY738145_HBx_C-E      NFFTSA
AY738146_HBx_P-E      NFFTSA
AM494712_HBx_P-E      NFFTSA
AM494714_HBx_P-E      NFFTSA
AM494832_HBx_P-E      NFFTSA
KF170742_HBx_P-E      NFFTSA
AM494706_HBx_P-E      NFFTSA
AM494699_HBx_P-E      NFFTSA
AM494692_HBx_P-E      NFFTSA
AM494691_HBx_P-E      NFFTSA
AB274984_HBx_P-E      NFFTSA
AB274981_HBx_P-E      NFFTSA
AB274979_HBx_P-E      NFFTSA
AB274978_HBx_P-E      NFFTSA
AB274977_HBx_P-E      NFFTSA
AB201290_HBx_P-E      NFFTSA
AB201287_HBx_P-E      NFFTSA
GQ161775_HBx_P-E      NFFTSA
MG776729_HBx_P-E      NFFTSA
GQ161776_HBx_P-E      NFFTSA
GQ161784_HBx_P-E      NFFTSA
GQ161789_HBx_P-E      NFFTSA
GQ161828_HBx_P-E      NFFTSA
GQ161765_HBx_P-E      NFFTSA
GQ161769_HBx_P-E      NFFTSA
GQ161779_HBx_P-E      NFFTSA
HM363591_HBx_P-E      NFFTSA
AB274969_HBx_P-E      NFFTSA
EU239217_HBx_P-E      NFFTSA
LT623849_HBx_P-E      NFFTSA
HM363575_HBx_P-E      NFFTSA
HM363578_HBx_P-E      NFFTSA
HM363598_HBx_P-E      NFFTSA
FJ349237_HBx_P-E      NFFTSA
FJ349238_HBx_P-E      NFFTSA
GQ161796_HBx_P-E      NFFTSA
MH580631_HBx_P-E      NFFTSA
MH580632_HBx_P-E      NFFTSA
MH580652_HBx_P-E      NFFTSA
GQ161782_HBx_P-E      NFFTSA
GQ161792_HBx_P-E      NFFTSA
GQ161814_HBx_P-E      NFFTSA
AB106564_HBx_C-E      NFLTSA
AB274980_HBx_P-E      NFFTSA
MK321264_HBx_P-E      NFFTSA
MH580645_HBx_P-E      NFFTSA
MH464856_HBx_P-E      NFFTSA
MG776772_HBx_P-E      HFFTSA
MF772361_HBx_P-E      NFFTSA
MF772360_HBx_P-E      NFFTSA
LT623842_HBx_P-E      NFFTSA
KM606739_HBx_P-E      NFFTSA
KF849719_HBx_P-E      NFFTSA
KF849718_HBx_P-E      NFFTSA
HM363574_HBx_P-E      NFFTSA
GQ161812_HBx_P-E      NFFTSA
EU239224_HBx_P-E      NFFTSA
DQ060823_HBx_P-E      NFLTSA
DQ060822_HBx_P-E      NFLTSA
DQ060830_HBx_P-E      NFLTSA
AB091255_HBx_P-E      NFFTSA
AB915176_HBx_P-E      NFFTSA
AB915180_HBx_P-E      NFFTSA
AM494695_HBx_P-E      NFFTSA
AM494711_HBx_P-E      NFFTSA
FN594765_HBx_P-E      NFFTSA
KU736891_HBx_P-E      NFFTSA
KU736892_HBx_P-E      NFFTSA
KU736909_HBx_P-E      NFFTSA
EU239223_HBx_P-E      NFFTSA
FJ349227_HBx_P-E      NFFTSA
FN545822_HBx_P-E      NFFTSA
FN594752_HBx_P-E      NFFTSA
FN594761_HBx_P-E      NFFTSA
GQ161815_HBx_P-E      NFFTSA
GQ161823_HBx_P-E      NFFTSA
GQ161834_HBx_P-E      NFFTSA
KF849725_HBx_P-E      NFFTSA
KF849728_HBx_P-E      NFFTSA
KF922438_HBx_P-E      NFFTSA
KF922439_HBx_P-E      NFFTSA
KM606738_HBx_P-E      NFFTSA
KT192626_HBx_P-E      NFFTSA
LT623844_HBx_P-E      NFFTSA
MG776426_HBx_P-E      NFFTSA
LT623847_HBx_P-E      NFFTSA
MH580633_HBx_P-E      NFFTSA
FN545841_HBx_P-E      NFFTSA
MH580614_HBx_P-E      NFFTSA
MH580615_HBx_P-E      NFFTSA
MH580616_HBx_P-E      NFFTSA
MH580618_HBx_P-E      NFFTSA
MH580619_HBx_P-E      NFFTSA
MH580620_HBx_P-E      NFFTSA
MH580623_HBx_P-E      NFFTSA
MH580651_HBx_P-E      NFFTSA
FN545842_HBx_P-E      BFFTSA
GQ161807_HBx_P-E      NFFTSA
EU239219_HBx_P-E      NFFTSA
GQ161790_HBx_P-E      NFFTSA
GQ161799_HBx_P-E      NFFTSA
GQ161805_HBx_P-E      NFFTSA
GQ161818_HBx_P-E      NFFTSA
GQ161821_HBx_P-E      NFFTSA
KF849727_HBx_P-E      NFFTSA
KU736899_HBx_P-E      NFFTSA
KU736904_HBx_P-E      NFFTSA
KU736903_HBx_P-E      NFFTSA
AM494705_HBx_P-E      NFFTSA
AB274982_HBx_P-E      NFFTSA
FJ349239_HBx_P-E      NFFTSA
AM494689_HBx_P-E      NFFTSA
AM494698_HBx_P-E      NFFTSA
FN594758_HBx_P-E      NFFTSA
MG776800_HBx_P-E      NFFTSA
AB915177_HBx_P-E      NFFTSA
AM494690_HBx_P-E      NFFTSA
AM494693_HBx_P-E      NFFTSA
AM494697_HBx_P-E      NFFTSA
AM494701_HBx_P-E      NFFTSA
AM494702_HBx_P-E      NFFTSA
AM494703_HBx_P-E      NFFTSA
AM494704_HBx_P-E      NFFTSA
AM494707_HBx_P-E      NFFTSA
AM494708_HBx_P-E      NFFTSA
AM494709_HBx_P-E      NFFTSA
AM494710_HBx_P-E      NFFTSA
AM494713_HBx_P-E      NFFTSA
AM494715_HBx_P-E      NFFTSA
AM494717_HBx_P-E      NFFTSA
FN594766_HBx_P-E      NFFTSA
HM363569_HBx_P-E      NFFTSA
HM363570_HBx_P-E      NFFTSA
HM363571_HBx_P-E      NFFTSA
HM363572_HBx_P-E      NFFTSA
HM363573_HBx_P-E      NFFTSA
KU736893_HBx_P-E      NFFTSA
KU736900_HBx_P-E      NFFTSA
KU736901_HBx_P-E      NFFTSA
KU736902_HBx_P-E      NFFTSA
KU736905_HBx_P-E      NFFTSA
KU736906_HBx_P-E      NFFTSA
KU736907_HBx_P-E      NFFTSA
KU736908_HBx_P-E      NFFTSA
KU736910_HBx_P-E      NFFTSA
KU736911_HBx_P-E      NFFTSA
KU736912_HBx_P-E      NFFTSA
KU736913_HBx_P-E      NFFTSA
MG776403_HBx_P-E      NFFTSA
MG776512_HBx_P-E      NFFTSA
MG776678_HBx_P-E      NFFTSA
MG776737_HBx_P-E      NFFTSA
MG776798_HBx_P-E      NFFTSA
MG776799_HBx_P-E      NFFTSA
MH580617_HBx_P-E      NFFTSA
MH580628_HBx_P-E      NFFTSA
MH580630_HBx_P-E      NFFTSA
MH580644_HBx_P-E      NFFTSA
MH580650_HBx_P-E      NFFTSA
X75657_HBx_P-E        NFFTSA
AB091256_HBx_P-E      NFFTSA
AB194947_HBx_P-E      NFFTSA
AB201288_HBx_P-E      NFFTSA
AB201289_HBx_P-E      NFFTSA
AB205129_HBx_P-E      NFFTSA
AB205190_HBx_P-E      NFFTSA
AB205191_HBx_P-E      NFFTSA
AB205192_HBx_P-E      NFFTSA
AB274970_HBx_P-E      NFFTSA
AB274971_HBx_P-E      NFFTSA
AB274972_HBx_P-E      NFFTSA
AB274974_HBx_P-E      NFFTSA
AB274976_HBx_P-E      NFFTSA
AB915175_HBx_P-E      NFFTSA
AM494694_HBx_P-E      NFFTSA
AM494696_HBx_P-E      NFFTSA
AM494700_HBx_P-E      NFFTSA
DQ060825_HBx_P-E      NFFTSA
DQ060826_HBx_P-E      NFFTSA
DQ060827_HBx_P-E      NFFTSA
DQ060828_HBx_P-E      NFFTSA
DQ060829_HBx_P-E      NFFTSA
EU239221_HBx_P-E      NFFTSA
EU239226_HBx_P-E      NFFTSA
FN545821_HBx_P-E      NFFTSA
FN594756_HBx_P-E      NFFTSA
FN594763_HBx_P-E      NFFTSA
GQ161755_HBx_P-E      NFFTSA
GQ161756_HBx_P-E      NFFTSA
GQ161758_HBx_P-E      NFFTSA
GQ161759_HBx_P-E      NFFTSA
GQ161761_HBx_P-E      NFFTSA
GQ161762_HBx_P-E      NFFTSA
GQ161763_HBx_P-E      NFFTSA
GQ161764_HBx_P-E      NFFTSA
GQ161766_HBx_P-E      NFFTSA
GQ161770_HBx_P-E      NFFTSA
GQ161771_HBx_P-E      NFFTSA
GQ161772_HBx_P-E      NFFTSA
GQ161773_HBx_P-E      NFFTSA
GQ161774_HBx_P-E      NFFTSA
GQ161777_HBx_P-E      NFFTSA
GQ161780_HBx_P-E      NFFTSA
GQ161783_HBx_P-E      NFFTSA
GQ161786_HBx_P-E      NFFTSA
GQ161787_HBx_P-E      NFFTSA
GQ161791_HBx_P-E      NFFTSA
GQ161793_HBx_P-E      NFFTSA
GQ161794_HBx_P-E      NFFTSA
GQ161795_HBx_P-E      NFFTSA
GQ161797_HBx_P-E      NFFTSA
GQ161798_HBx_P-E      NFFTSA
GQ161800_HBx_P-E      NFFTSA
GQ161801_HBx_P-E      NFFTSA
GQ161802_HBx_P-E      NFFTSA
GQ161803_HBx_P-E      NFFTSA
GQ161804_HBx_P-E      NFFTSA
GQ161816_HBx_P-E      NFFTSA
GQ161817_HBx_P-E      NFFTSA
GQ161819_HBx_P-E      NFFTSA
MH580649_HBx_P-E      NFFTSA
MH580647_HBx_P-E      NFFTSA
MH580646_HBx_P-E      NFFTSA
MH580638_HBx_P-E      NFFTSA
MH580637_HBx_P-E      NFFTSA
MH580636_HBx_P-E      NFFTSA
MH580635_HBx_P-E      NFFTSA
MH580634_HBx_P-E      NFFTSA
MH580629_HBx_P-E      NFFTSA
MH580625_HBx_P-E      NFFTSA
MH580624_HBx_P-E      NFFTSA
MH580622_HBx_P-E      NFFTSA
MH580621_HBx_P-E      NFFTSA
MF772362_HBx_P-E      NFFTSA
LT623848_HBx_P-E      NFFTSA
LT623846_HBx_P-E      NFFTSA
LT623843_HBx_P-E      NFFTSA
KX186584_HBx_P-E      NFFTSA
KU736898_HBx_P-E      NFFTSA
KU736897_HBx_P-E      NFFTSA
KU736896_HBx_P-E      NFFTSA
KU736895_HBx_P-E      NFFTSA
KU736894_HBx_P-E      NFFTSA
KF849726_HBx_P-E      NFFTSA
KF849724_HBx_P-E      NFFTSA
KF849723_HBx_P-E      NFFTSA
KF849722_HBx_P-E      NFFTSA
KF849721_HBx_P-E      NFFTSA
KF849714_HBx_P-E      NFFTSA
KF849713_HBx_P-E      NFFTSA
JQ000009_HBx_P-E      NFFTSA
JQ000008_HBx_P-E      NFFTSA
HQ700552_HBx_P-E      NFFTSA
HQ700550_HBx_P-E      NFFTSA
HM363588_HBx_P-E      NFFTSA
HM363577_HBx_P-E      NFFTSA
GQ161836_HBx_P-E      NFFTSA
GQ161835_HBx_P-E      NFFTSA
GQ161833_HBx_P-E      NFFTSA
GQ161832_HBx_P-E      NFFTSA
GQ161830_HBx_P-E      NFFTSA
GQ161829_HBx_P-E      NFFTSA
GQ161827_HBx_P-E      NFFTSA
GQ161826_HBx_P-E      NFFTSA
GQ161825_HBx_P-E      NFFTSA
GQ161824_HBx_P-E      NFFTSA
GQ161820_HBx_P-E      NFFTSA
GQ161822_HBx_P-E      NFFTSA
MG776745_HBx_P-E      NFFTSA
MG776734_HBx_P-E      NFFTSA
MG776427_HBx_P-E      NFFTSA
MF772354_HBx_P-E      NFFTSA
FN594759_HBx_P-E      NFFTSA
JQ272902_HBx_P-E      NFFTSA
FN594753_HBx_P-E      NFFTSA
FN594760_HBx_P-E      NFFTSA
                       *:*.*

© 1998-2019