HBVdb

Dataset for protein LHBs of genotype E

[Download (right click)] [Edit] [Sequences] [Repertoires]

346 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


FN594751_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB205190_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRTPDWDHNPNKD
AB106564_LHBs_C-E      MGLSWTVPLE-WGKNHSTTKPLGCVPDHQLDPAFRANTRNPDWDHNPNKD
FN594765_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFKANTXNPDWDHNPNKD
EU239224_LHBs_P-E      MGLSWTVPLE-WGKNQSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKE
AB274973_LHBs_P-E      MGLSWTVPLE-WGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
LT623851_LHBs_P-E      MGLSWTVPLE-WGKNXSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161760_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
FN594762_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKD
AY738145_LHBs_C-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AY738146_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AY738147_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AY738144_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF849728_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKD
FN594750_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKD
AM494695_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB274979_LHBs_P-E      MGLSWTVPLE-WGKNQSTTNPLGFFPDHQLDPEFRANTRNPDWDHNPNKD
AB194948_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFSANTRNPDWDHNPNKD
GQ161831_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPEHQLDPAFRANTRNPDWDHNPNKD
AB915178_LHBs_P-E      MGLSWTVPLE-WGKNQSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB274975_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKD
GQ161803_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDQNPNKD
GQ161768_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKD
AB274977_LHBs_P-E      MGLSWTVPLE-WGKNQSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF170750_LHBs_P-E      MGLSWTVPLE-WGKNQSTTNPLGFLPDHQLDPAFRANTRNPDWDHNPNKD
KF170782_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFLPDHQLDPAFRANTRNPDWDHNPNKD
FN594749_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
FN545821_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
EU239223_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFKANTKNPDWDHNPNKD
AM494714_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB201287_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363610_LHBs_P-E      MGLSWTVPLE-WGKNQSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPTKD
FN594748_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKD
GQ161796_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB274985_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
FN545842_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363607_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494700_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494694_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494696_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
DQ060822_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494691_LHBs_P-E      MGLSWTVPLE-WGKNQSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB274980_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB274970_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB205129_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPDKD
AB205192_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF849715_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF170785_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPIKD
GQ161811_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161773_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161802_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB915177_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363590_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPTKD
HM363588_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPTKD
HM363589_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPTKD
HM363601_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPTKD
AM494707_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
FJ349226_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MF772360_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161775_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161762_LHBs_P-E      MGLSWTVPLE-WGKNYSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKD
FN594756_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTNNPDWDHNPNKD
FN545841_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
FN545823_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
FJ349239_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
EU239222_LHBs_P-E      MGLSWTVPLE-WGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
EU239217_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
DQ060824_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AY739675_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494713_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494705_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494704_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494699_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB274974_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB201288_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB194947_LHBs_P-E      MGLSWTVPLE-WGKNHSTTDPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
EU239218_LHBs_P-E      MGLSWTVPLE-WGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
EU239219_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKD
AY935700_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
FN594752_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDNNPNKD
AY739674_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161759_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161816_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB274982_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKD
GQ161778_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161810_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161790_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDLNPNKD
GQ161799_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDLNPNKD
GQ161805_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDLNPNKD
GQ161818_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDLNPNKD
GQ161782_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161792_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNHLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161812_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161814_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161758_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161766_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161774_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161757_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB274978_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
FJ349237_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
FJ349238_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
LT623844_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
LT623845_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161817_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161815_LHBs_P-E      MGLSWTVPLE-WGKNHSVTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161807_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161770_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161761_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKD
FN594763_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB915175_LHBs_P-E      MGLSWTVPLE-WGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB219529_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDNNPNID
KF170784_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363585_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161801_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161755_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161835_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736899_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494692_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFLPDHQLDPAFRANTRNPDWDHNPNKD
AB091255_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB201289_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB201290_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKD
AB274969_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB274971_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494690_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494693_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494697_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494701_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494702_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494706_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494708_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494709_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494715_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494717_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
DQ060823_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
DQ060825_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
DQ060826_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
DQ060827_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
DQ060828_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
DQ060829_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
DQ060830_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
EU239226_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363567_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161819_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161808_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161804_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161800_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161798_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161794_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161793_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161791_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161789_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161787_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161786_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161784_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161783_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPEFQANTRNPDWDHNPNKD
GQ161781_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161780_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161779_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161777_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161776_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161772_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161771_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161769_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161765_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161764_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161763_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
FN594758_LHBs_P-E      MGLSWTVPLQ-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
FN594760_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTSNPDWDDNPNKD
EU239220_LHBs_P-E      MGLSWTVPLE-WGKNLSTVNPLGFFPDHQLDPAFRANTRNPDWDNNPNKD
FN594766_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KM108623_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGIFPDHQLDPAFRANSRNPDWDHNPNKD
HM363608_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB219533_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDNNPNKD
KF849723_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KM108610_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFLPDHQLDPAFRANTKNPDWDHNPNKD
KF170787_LHBs_P-E      MGLSWTVPLE-WGKNQSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKD
HM363565_LHBs_P-E      MGLSWTVPLE-WGKNQSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKD
FN594761_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKD
MH580645_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KM108626_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363602_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFLPDHQLDPAFRANTRNPDWDHNPNKD
FN545822_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFXPDHQLDPAFRANTRNPDWDHNPNKD
HM363586_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF170751_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKD
EU239221_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580617_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580628_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580644_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MF772355_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363609_LHBs_P-E      MGLSWTVPLE-WGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363603_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKD
HM363597_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPTKD
GQ161825_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFKANTRSPDWDHNPNKD
AM494703_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161785_LHBs_P-E      MGLSWTVPLE-WGKNQSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB274981_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB205191_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB205189_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB091256_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580648_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKD
MF772357_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KM108622_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF170790_LHBs_P-E      MGLSWTVPLE-WGKNQSTTNPLGFFPDHQLDPAFRANTSNPDWDHNPNKD
JN604235_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
JN604166_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFXANTRNPDWDHNPNKD
HM363611_LHBs_P-E      MGLSWTVPLE-WGKNQSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363604_LHBs_P-E      MGLSWTVPLE-WGKNHSTTPPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363598_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363584_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363572_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736913_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580638_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF849717_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363600_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
FN594759_LHBs_P-E      MGLSWTVPLS-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494710_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AB274976_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
X75657_LHBs_P-E        MGLSWTVPLE-WGKNISTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580652_LHBs_P-E      MGLSWTVPLE-WGKNYSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKD
MH580632_LHBs_P-E      MGLSWTVPLE-WGKNYSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKD
MH580631_LHBs_P-E      MGLSWTVPLE-WGKNYSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKD
LT623843_LHBs_P-E      MGLSWTVPLE-WGKNHSTXNPLGXFPDHQLDPAFRANTRNPDWDHNPNKD
KU736911_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736909_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736901_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPSKD
KU736893_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF849724_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF849718_LHBs_P-E      MGLSWXVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF849716_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF849713_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF170783_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HQ700552_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HQ700550_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363599_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKD
HM363596_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363595_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363594_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363583_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363577_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363566_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFTANTRNPDWDHNPNKD
GQ161834_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKD
GQ161821_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDLNPNKD
GQ161797_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGVFPDHQLDPAFRANTRNPDWDHNPNKD
LT623850_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF170742_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363591_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPTKD
MH580630_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
LT623849_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736898_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736897_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KM108624_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
JQ000008_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MK321264_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580650_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580649_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580647_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580646_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580641_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580640_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580637_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKD
MH580636_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580635_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580634_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580629_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580625_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKD
MH580624_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580622_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKD
MH580621_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTKNPDWDHNPNKD
MF772362_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MF772354_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
LT623848_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
LT623846_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KX186584_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736912_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736910_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736908_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736907_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736906_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736905_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736904_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736903_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736902_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736900_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736896_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736895_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736894_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736892_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KU736891_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KT192626_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KR139749_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KM108625_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF922439_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF922438_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF849726_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF849722_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF849721_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF849719_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF849714_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF170789_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF170788_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF170786_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKD
KF170741_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
JQ000009_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
JN604168_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363606_LHBs_P-E      MGLSWTVPLE-WGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363605_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363593_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363592_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363587_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDNNPNKD
HM363582_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363581_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363580_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363579_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363578_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363576_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363575_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363574_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363573_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363571_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363570_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363569_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
HM363568_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161836_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161833_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161832_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161830_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161829_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161828_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161827_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161824_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPEFQANTRNPDWDHNPNKD
GQ161822_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
GQ161820_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDXNPNKD
LT623847_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH464855_LHBs_P-E      MGLSWTVPLEXXGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH464856_LHBs_P-E      MGLSWTVPLEXXGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
KF849720_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFKANTRNPDWDHNPNKD
AM494711_LHBs_P-E      MGLSWTVPLE-WGKNHATTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
AM494712_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580614_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580615_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580616_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580618_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580619_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580620_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580623_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
MH580651_LHBs_P-E      MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKD
                       ***** ***.  *** :.   **  *:***** * **: .**** **  :

FN594751_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTPLPADPPPASTNRQ
AB205190_LHBs_P-E      HWTEANKVGVGAFGPGFSPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQ
AB106564_LHBs_C-E      HWTDANKVGVGAFGPGFTPPHGGLLGWSPQAQGMPKTSPAEPPPASTKRQ
FN594765_LHBs_P-E      HWTEANKVGVGSFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
EU239224_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPANPPPASTNRQ
AB274973_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGSSPQAQGMLKTLPADPPPASTNRQ
LT623851_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161760_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPANPPPASTIWQ
FN594762_LHBs_P-E      HWKKANKVGVGAFWPGLTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AY738145_LHBs_C-E      HWTAANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AY738146_LHBs_P-E      HWTAANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AY738147_LHBs_P-E      HWTAANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AY738144_LHBs_P-E      HWTAANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF849728_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTLPADPPPPSTNRQ
FN594750_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494695_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGDLLGWSPQAQGMLKTLPADPPSASTNRQ
AB274979_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPLAQGMLKTLPANPPPASTNRQ
AB194948_LHBs_P-E      HWTEANQVGVGAFGPGFTPPHGGLLGGSPQAQGMLTTLPADPPPASTNRQ
GQ161831_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPADPPPASTNRQ
AB915178_LHBs_P-E      HWXEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AB274975_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPTDPPTASTNRQ
GQ161803_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161768_LHBs_P-E      HWTEANKVGVGAFGPGLTPPHGGLLGWSPQAQGMLKTLPVDPPPASTNRQ
AB274977_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQ
KF170750_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMPKTLPADPPPASTNRQ
KF170782_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
FN594749_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMQKTLPADPPPASTNRQ
FN545821_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
EU239223_LHBs_P-E      HWTDANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494714_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPVSTNRQ
AB201287_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGFLGWSPQAQGMLKTLPADPPPASTNRQ
HM363610_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAPGMLKTLPADPPPASTNRQ
FN594748_LHBs_P-E      HWTDANKVGVGAFGPGXTPPHGGLLGWSPQAQGMLKTLPANPPPASTNRQ
GQ161796_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPVDPPPASTNRQ
AB274985_LHBs_P-E      HWTEPNKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
FN545842_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363607_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494700_LHBs_P-E      HWTEANKVGVGAFGPGLTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494694_LHBs_P-E      HWTEANKVGVGAFGPGLTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494696_LHBs_P-E      HWTEANKVGVGAFGPGLTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
DQ060822_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494691_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMXKTLPADPPPASTNRQ
AB274980_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASANRQ
AB274970_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGILKTLPADPPPASTNRQ
AB205129_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AB205192_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF849715_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMQKTLPADPPPASTNRQ
KF170785_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161811_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTVPADPPPASTNRQ
GQ161773_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161802_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AB915177_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363590_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363588_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363589_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363601_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494707_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
FJ349226_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
MF772360_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161775_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPADPPPASTNRQ
GQ161762_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQ
FN594756_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQ
FN545841_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPADPPPASTNRQ
FN545823_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGXSPQAQGMLTTLPANPPPASTNRQ
FJ349239_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQ
EU239222_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGSSPQAQGMLKTLPADPPPASTNRQ
EU239217_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPADPPPASTNRQ
DQ060824_LHBs_P-E      HWTKANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AY739675_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQ
AM494713_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRH
AM494705_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494704_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494699_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AB274974_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASSNRQ
AB201288_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPLASTNRQ
AB194947_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKMLPADPPPASTNRQ
EU239218_LHBs_P-E      HWTDANKVGVGAFGPGFTPPHGGLLGWSPQAQGMQKTLPADPPPASTNRQ
EU239219_LHBs_P-E      HWTDANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AY935700_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
FN594752_LHBs_P-E      HWTEANEVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AY739674_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQ
GQ161759_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQ
GQ161816_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQ
AB274982_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLVGWSPQAQGMLKTLPADPPPASTNRQ
GQ161778_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMQKSLPADPPPASTNRQ
GQ161810_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMXKSLPADPPPASTNRQ
GQ161790_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLNTLPADPPPASTNRQ
GQ161799_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLNTLPADPPPASTNRQ
GQ161805_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLNTLPADPPPASTNRQ
GQ161818_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLNTLPADPPPASTNRQ
GQ161782_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161792_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161812_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161814_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161758_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161766_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161774_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161757_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGSSPQAQGMLTTLPADPPPASTNRQ
AB274978_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPADPPPASTNRQ
FJ349237_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPADPPPASTNRQ
FJ349238_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPADPPPASTNRQ
LT623844_LHBs_P-E      HWTEANKVGVGAFGPGXTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQ
LT623845_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPANPPPASTNRQ
GQ161817_LHBs_P-E      HWTEANKVGVGTFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161815_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPAVPPPASTNRQ
GQ161807_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGSSPQAQGMLRTLPADPPPASTNRQ
GQ161770_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161761_LHBs_P-E      HWTEANKVGVGAFGPGFTPLHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
FN594763_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AB915175_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AB219529_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF170784_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPAEPPPASTNRQ
HM363585_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161801_LHBs_P-E      HWMEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161755_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161835_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736899_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPANPPPASTNRQ
AM494692_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGILGWSPQAQGMLKTLPADPPPASTNRQ
AB091255_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AB201289_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AB201290_LHBs_P-E      HWKEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AB274969_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGSLLGWSPQAQGMLKTLPADPPPASTNRQ
AB274971_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494690_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494693_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494697_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494701_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494702_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494706_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494708_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494709_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494715_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494717_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
DQ060823_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
DQ060825_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
DQ060826_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
DQ060827_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
DQ060828_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
DQ060829_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPANPPPASTNRQ
DQ060830_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
EU239226_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPANPPPASTNRQ
HM363567_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161819_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161808_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKSLPADPPPASTNRQ
GQ161804_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161800_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161798_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161794_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161793_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161791_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161789_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161787_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161786_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161784_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161783_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPAVPPPASTNRQ
GQ161781_LHBs_P-E      YWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161780_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161779_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161777_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161776_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161772_LHBs_P-E      HWKEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161771_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPANPPPASTNRQ
GQ161769_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161765_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161764_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161763_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
FN594758_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
FN594760_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
EU239220_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
FN594766_LHBs_P-E      HWTEANKVGVGSFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KM108623_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGRLTSLPANPPPASTNRQ
HM363608_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPTDPPPASIKRQ
AB219533_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF849723_LHBs_P-E      HWTEANKVGVGAFGPGVTPPHGGLLGWSPQAQGILKTLPADPPPASTNRQ
KM108610_LHBs_P-E      HWNAANKVGVGAFGPGFTPPHGGLLGWSPQAQGSLKTLPADPPPASTNRQ
KF170787_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADSPPASTNRQ
HM363565_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASANRQ
FN594761_LHBs_P-E      HWTDANKVGVGAFGPGLTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
MH580645_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKMLPADPPPASTNRQ
KM108626_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363602_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPADPPPASTNRQ
FN545822_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMQKTLPADPPLASTNRK
HM363586_LHBs_P-E      HWTKANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPADPPPASTNRQ
KF170751_LHBs_P-E      HWIEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPADPPPASTNRQ
EU239221_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPTDPPPASTNRQ
MH580617_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTVPADPPPASTNRQ
MH580628_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTVPADPPPASTNRQ
MH580644_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTVPADPPPASTNRQ
MF772355_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363609_LHBs_P-E      HWTEANKVGVGTFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363603_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMPKTLPSDPPPASTNRQ
HM363597_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRK
GQ161825_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494703_LHBs_P-E      HWPEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161785_LHBs_P-E      HWTEANKVGVGAFGTGFTPPHGGLLGWSPQAQGTLQTLPADPPPASTNRQ
AB274981_LHBs_P-E      HWTEPNEVGVSAFGPGFTPPHGGLLGWSPQAQGTLKTLPTDPPPASTNRQ
AB205191_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTVPTDPPPASTNRQ
AB205189_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPTDPPPASTNRQ
AB091256_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
MH580648_LHBs_P-E      HWTQANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKMLPADPPPASTNRQ
MF772357_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KM108622_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWDPQAQGMLKTLPADPPPASTNRQ
KF170790_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
JN604235_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
JN604166_LHBs_P-E      HWTEANKVGVGAFGPGFTPTHGGLLGWSPQAQGMQKTLPADPPPASTNRQ
HM363611_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGTQKTLPADPPPASTNRQ
HM363604_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMQKTLPADPPPASTNRQ
HM363598_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRM
HM363584_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMHITLPADPPPASTNRQ
HM363572_LHBs_P-E      HWSEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736913_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
MH580638_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF849717_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363600_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
FN594759_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AM494710_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
AB274976_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
X75657_LHBs_P-E        HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
MH580652_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
MH580632_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
MH580631_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
LT623843_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPABPPPASTNRQ
KU736911_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736909_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPADPPPASTNRQ
KU736901_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736893_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPANPPPASTNRQ
KF849724_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAHGMLKTLPADPPPASTNRQ
KF849718_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF849716_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF849713_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF170783_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HQ700552_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGIQKTLPADPPPASTNRQ
HQ700550_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGIQKTLPADPPPASTNRQ
HM363599_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363596_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363595_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363594_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363583_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMHITLPADPPPASTNRQ
HM363577_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPTDPPPASTNRQ
HM363566_LHBs_P-E      HWTEANQVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161834_LHBs_P-E      HWTEATKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161821_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLNTLPADPPPASTNRQ
GQ161797_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
LT623850_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF170742_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363591_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
MH580630_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
LT623849_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTVPADPPPASTNRQ
KU736898_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736897_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KM108624_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
JQ000008_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMIKTLPADPPPASTNRQ
MK321264_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
MH580650_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
MH580649_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKMLPADPPPASTNRQ
MH580647_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKMLPADPPPASTNRQ
MH580646_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKMLPADPPPASTNRQ
MH580641_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
MH580640_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
MH580637_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKMLPADPPPASTNRQ
MH580636_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKMLPADPPPASTNRQ
MH580635_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKMLPADPPPASTNRQ
MH580634_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKMLPADPPPASTNRQ
MH580629_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKMLPADPPPASTNRQ
MH580625_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKMLPADPPPASTNRQ
MH580624_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKMLPADPPPASTNRQ
MH580622_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKMLPADPPPASTNRQ
MH580621_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKMLPADPPPASTNRQ
MF772362_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
MF772354_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
LT623848_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
LT623846_LHBs_P-E      HWSEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KX186584_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736912_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736910_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736908_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736907_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736906_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736905_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736904_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMQKTLPADPPPASTNRQ
KU736903_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736902_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736900_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736896_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736895_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736894_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736892_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KU736891_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KT192626_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPANPPPASTNRQ
KR139749_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KM108625_LHBs_P-E      HWSEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMQKTLPANPPPASTNRQ
KF922439_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPANPPPASTNRQ
KF922438_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPANPPPASTNRQ
KF849726_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF849722_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF849721_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF849719_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF849714_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF170789_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF170788_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF170786_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF170741_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
JQ000009_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMIKTLPADPPPASTNRQ
JN604168_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363606_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGSSPQAQGMLKTLPADPPPASTNRQ
HM363605_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363593_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363592_LHBs_P-E      HWIEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363587_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363582_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMQKTLPADPPPASTNRQ
HM363581_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMQKTLPADPPPASTNRQ
HM363580_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMQKTLPADPPPASTNRQ
HM363579_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMQKTLPADPPPASTNRQ
HM363578_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363576_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363575_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363574_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363573_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKMLPADPPPASTNRQ
HM363571_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363570_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363569_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
HM363568_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161836_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161833_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161832_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161830_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161829_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161828_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161827_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161824_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPAVPPPASTNRQ
GQ161822_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
GQ161820_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
LT623847_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTXRQ
MH464855_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
MH464856_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQ
KF849720_LHBs_P-E      HWTEANEVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPADPPPASTNRQ
AM494711_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLNTLPADPPPASTNRQ
AM494712_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPVSTNRQ
MH580614_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPTDPPPASTNRQ
MH580615_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPTDPPPASTNRQ
MH580616_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPTDPPPASTNRQ
MH580618_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPTDPPPASTNRQ
MH580619_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPTDPPPASTNRQ
MH580620_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPTDPPPASTNRQ
MH580623_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPTDPPPASTNRQ
MH580651_LHBs_P-E      HWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLKTLPTDPPPASTNRQ
                       :*  ..:***.:* .* :* **.::* .* * *     *  .*  *  . 

FN594751_LHBs_P-E      SGRQPTPITPPLRDTHPQAIQWNSKTFHQALQDPRVRGLHXSAGGSSSGT
AB205190_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLFLPAGGSSSGT
AB106564_LHBs_C-E      SGRQPTPITPPLRDTHPQAMQRNSTTFHQALQDPRVRGLYFPAGGSSSGT
FN594765_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
EU239224_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AB274973_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQVQQDHRVRGL--PAGGSSSGT
LT623851_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161760_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLNFPAGGSSSGT
FN594762_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALLDPTVGGLSSPAGGSSSGT
AY738145_LHBs_C-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AY738146_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AY738147_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AY738144_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF849728_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPKAK----PAGGSSSGT
FN594750_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSKTFHQALQDPRVRGLYFPAGGSSSGT
AM494695_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
AB274979_LHBs_P-E      SGRQPTPITPPLRVTHPQAIQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
AB194948_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYRPAGGSSSGT
GQ161831_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVR----PAGGSSSGT
AB915178_LHBs_P-E      SGRQPTPITPPLRDTPVQAMQWNSKTFHQALQDXRVRGLYLPAGGSSSGT
AB274975_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
GQ161803_LHBs_P-E      SGRQPTPITPPLRDTHPQAVQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161768_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
AB274977_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPKVRGLYFPAGGSSSGT
KF170750_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
KF170782_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
FN594749_LHBs_P-E      SGRQPTPITPPLRDTHPQAMKWNSTTFHQALQDPRVRGLYSPAGGSSSGT
FN545821_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPKVKGLYFPAGGSSSGT
EU239223_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494714_LHBs_P-E      SGRQPTPITPPLRDTHPLAVQWNSKTFHQALQDPRVRGLYPPAGGSSSGT
AB201287_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363610_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHKALQDPRVRGLYLPAGGSSSGK
FN594748_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161796_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNYTTFHQALQDPKVR----PAGGSSSGT
AB274985_LHBs_P-E      SGRQPTPITPPLRDTHPQAIQWNSTTFHQALQDPRVRGL--PAGGSSSGT
FN545842_LHBs_P-E      SGRQPTPITPPLRDTHPQAIQWNSTAFHQALQDPRVKGLYFPAGGSSSGT
HM363607_LHBs_P-E      SGRQPTPITPPLRDTHPQAIQWNSTTFHQALQDPRVKGLYFPAGGSSSGT
AM494700_LHBs_P-E      SGRQPTPITPPLRDTHPQAIQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494694_LHBs_P-E      SGRQPTPITPPLRDTHPQAIQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494696_LHBs_P-E      SGRQPTPITPPLRDTHPQAIQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
DQ060822_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494691_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
AB274980_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AB274970_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AB205129_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPKVRGLYFPAGGSSSGT
AB205192_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPKVRGLYFPAGGSSSGT
KF849715_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF170785_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHKTLQDPRVRGLYFPAGGSSSGT
GQ161811_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
GQ161773_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGT
GQ161802_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGT
AB915177_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363590_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363588_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363589_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363601_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
AM494707_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
FJ349226_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MF772360_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
GQ161775_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQPLQNPRVRGQDFPAGGSSSGT
GQ161762_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
FN594756_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVTGLYFPAGGSSSGT
FN545841_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSSSGT
FN545823_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
FJ349239_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
EU239222_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQNPRVRGLYFPAGGSSSGT
EU239217_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
DQ060824_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AY739675_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494713_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494705_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494704_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494699_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSGT
AB274974_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGFSSGT
AB201288_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AB194947_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
EU239218_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
EU239219_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSET
AY935700_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
FN594752_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPKVRGLYLPAGGSSSGT
AY739674_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161759_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161816_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AB274982_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161778_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161810_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161790_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161799_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161805_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161818_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161782_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161792_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161812_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161814_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161758_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNYTTFHQALQDPRVKGLYFPAGGSSSGT
GQ161766_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNYTTFHQALQDPRVKGLYFPAGGSSSGT
GQ161774_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNYTTFHQALQDPRVKGLYFPAGGSSSGT
GQ161757_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
AB274978_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVTGLYFPAGGSSSGT
FJ349237_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
FJ349238_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
LT623844_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHKALQDPRVRGLYLPAGGSSSGT
LT623845_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYYPAGGSSSGT
GQ161817_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPVGGSSSGT
GQ161815_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161807_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161770_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161761_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
FN594763_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AB915175_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRNLYFPAGGSSSGT
AB219529_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVT----PAGGSSSGT
KF170784_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSFGT
HM363585_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLSFPAGGSSSGT
GQ161801_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161755_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSFGT
GQ161835_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSFGT
KU736899_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSFGT
AM494692_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
AB091255_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AB201289_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AB201290_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AB274969_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AB274971_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494690_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494693_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494697_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSGT
AM494701_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494702_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494706_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494708_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494709_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494715_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494717_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
DQ060823_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
DQ060825_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
DQ060826_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
DQ060827_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
DQ060828_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
DQ060829_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
DQ060830_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
EU239226_LHBs_P-E      SGRQPTPITPSLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363567_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLDFPAGGSSSGT
GQ161819_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161808_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161804_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161800_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161798_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161794_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161793_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161791_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161789_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161787_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161786_LHBs_P-E      LGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161784_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161783_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSGT
GQ161781_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161780_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161779_LHBs_P-E      LGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161777_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161776_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161772_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161771_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161769_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161765_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161764_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161763_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
FN594758_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLXFPAGGSSSGT
FN594760_LHBs_P-E      SGRRPTPITPPLRDTHPQAMQWNSKTFHQALQDPRVRGLXFPAGGSSSGT
EU239220_LHBs_P-E      SGRQPTPITPPLRDTHPQAVQWNSTTFHQNLQDPRVRGLYFPAGGSSSGT
FN594766_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KM108623_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363608_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSRTFHQALQDPRVRGLYLPAGGSSSGT
AB219533_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKNLYFPAGGSSSGT
KF849723_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KM108610_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGT
KF170787_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
HM363565_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
FN594761_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580645_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KM108626_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363602_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPKVRGLYFPAGGSSSGT
FN545822_LHBs_P-E      SGRQPTPITPPLRETHPQAMKWNSTTFHQALQDPRIKGLYLPAGGSSSGT
HM363586_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTKFHQALQDPRVRGLYFPAGGSSSGT
KF170751_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSKTFHQALQDPRVRGLYLPAGGSSSGT
EU239221_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580617_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580628_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580644_LHBs_P-E      SGRQPTPITLPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MF772355_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPKVRGLYFPAGGSSSGT
HM363609_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363603_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
HM363597_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161825_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSGT
AM494703_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
GQ161785_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYPPAGGSSSGT
AB274981_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AB205191_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AB205189_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AB091256_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580648_LHBs_P-E      SGRQPTPITPPLRDTHPLAVQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MF772357_LHBs_P-E      SKRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KM108622_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
KF170790_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSET
JN604235_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQXPTVRGLYFPAGGCSSGT
JN604166_LHBs_P-E      SGRQPTPITPPLRETHPQAMXWNSTTFHQALQDPRVKGLYFPAGGSSSGT
HM363611_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSKTFHQALQDPRVRGLYLPAGGSSSGT
HM363604_LHBs_P-E      SGRKPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363598_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363584_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSGT
HM363572_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRCLYLPAGGSSSGT
KU736913_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYIPAGGSSSGT
MH580638_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF849717_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGT
HM363600_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQNPRVTGLYPPAGGSSSGT
FN594759_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AM494710_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
AB274976_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
X75657_LHBs_P-E        SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580652_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580632_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580631_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
LT623843_LHBs_P-E      SGRQPTPITPPLRDTHPQVMQWNSTTFRQALQDPRVRXLXXXAGGSSSGT
KU736911_LHBs_P-E      SRRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736909_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736901_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736893_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF849724_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF849718_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF849716_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF849713_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF170783_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPKVSALYLPAGGSSSGT
HQ700552_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HQ700550_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363599_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
HM363596_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
HM363595_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363594_LHBs_P-E      SGRLPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363583_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSGT
HM363577_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363566_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161834_LHBs_P-E      SGRQPTPITPPLRDTHPQPMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
GQ161821_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161797_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPKIRGPYLPAGGSSSGT
LT623850_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSSSGT
KF170742_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGT
HM363591_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580630_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGT
LT623849_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736898_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGT
KU736897_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGT
KM108624_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
JQ000008_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MK321264_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580650_LHBs_P-E      SGRQPTPITPPLRDTHPQAMRWNSPTFHQALQDPRVRGLYFPAGGSSSGT
MH580649_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580647_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580646_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580641_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580640_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580637_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580636_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580635_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580634_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580629_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580625_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580624_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580622_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH580621_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MF772362_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MF772354_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
LT623848_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
LT623846_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KX186584_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736912_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736910_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736908_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736907_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736906_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736905_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736904_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736903_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736902_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736900_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736896_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736895_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736894_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736892_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KU736891_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KT192626_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KR139749_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KM108625_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
KF922439_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF922438_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF849726_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
KF849722_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF849721_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF849719_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF849714_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF170789_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF170788_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF170786_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSGT
KF170741_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
JQ000009_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
JN604168_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363606_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363605_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
HM363593_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSKTFHQALQDPRVRGLYLPAGGSHSGT
HM363592_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363587_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363582_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363581_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363580_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363579_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363578_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
HM363576_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363575_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363574_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363573_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363571_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363570_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363569_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
HM363568_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161836_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYLPAGGSSSGT
GQ161833_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161832_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161830_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161829_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161828_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161827_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
GQ161824_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVKGLYFPAGGSSSGT
GQ161822_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
GQ161820_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQXLQDPRVRGLYFPAGGSSSGT
LT623847_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYLPAGGSSSGT
MH464855_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
MH464856_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
KF849720_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQXNSTTFHQALQDPRVRGLY-PAGGSSSGT
AM494711_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLY-PAGGSSSGT
AM494712_LHBs_P-E      SGRQPTPITPPLRDTHPLAVQWNSKTFHQALQDPRVRGLY-PAGGSSSGT
MH580614_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLY-PAGGSSSGT
MH580615_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLY-PAGGSSSGT
MH580616_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLY-PAGGSSSGT
MH580618_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLY-PAGGSSSGT
MH580619_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLY-PAGGSSSGT
MH580620_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLY-PAGGSSSGT
MH580623_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLY-PAGGSSSGT
MH580651_LHBs_P-E      SGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLY-PAGGSSSGT
                         * ***** .** *    :  *   *.:             .**    .

FN594751_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMESITSGLLGPLPVLQAGFFLLTKIL
AB205190_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB106564_LHBs_C-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FN594765_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMESITSGLLGPLLVLQAGFFLLTKIL
EU239224_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGLLGPLLVLQAGFFLLTKIL
AB274973_LHBs_P-E      VNPVPTTASLISSIFSRIGDHAPNMENITSGFLGPLLVLQAGFFLLTKIL
LT623851_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161760_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FN594762_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AY738145_LHBs_C-E      VNPVPTTASLISSIFSRIGDPAPNMDSITSGFLGPLLVLQAGFFLLTKIL
AY738146_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMDSITSGFLGPLLVLQAGFFLLTKIL
AY738147_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMDSITSGFLGPLLVLQAGFFLLTKIL
AY738144_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMDSITSGFLGPLLVLQAGFFLLTKIL
KF849728_LHBs_P-E      VNPVPTTASLISSIFSRIGVPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FN594750_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494695_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB274979_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
AB194948_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161831_LHBs_P-E      VNPVPTTASLISSISSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
AB915178_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB274975_LHBs_P-E      VNPVPTTASLISSISSRIGDPVPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161803_LHBs_P-E      VNPVPTTASLISSTFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161768_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB274977_LHBs_P-E      VNPVPTTVSLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF170750_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF170782_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FN594749_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKIL
FN545821_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
EU239223_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494714_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSRFLGPLLVLQAGFFLLTKIL
AB201287_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLALQAGFFLLTKIL
HM363610_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FN594748_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161796_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB274985_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FN545842_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363607_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494700_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494694_LHBs_P-E      VNPVPTTASLISSIFSRXGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494696_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
DQ060822_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494691_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB274980_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB274970_LHBs_P-E      VSPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
AB205129_LHBs_P-E      VSPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
AB205192_LHBs_P-E      VSPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF849715_LHBs_P-E      VNPVPTTASLISSIFSRTGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
KF170785_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161811_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKIL
GQ161773_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161802_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB915177_LHBs_P-E      VNPVPNTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363590_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363588_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363589_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363601_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494707_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FJ349226_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MF772360_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161775_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161762_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAQNMESITSGFLGPLLVLQAGFFLLTKIL
FN594756_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FN545841_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FN545823_LHBs_P-E      VNPVPTTASLISSIFSRIGGLAPNMESITSGFLGPLLVLQAGFFLLTKIL
FJ349239_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
EU239222_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMENITSGFLGPLLVLQAGFFLLTKIL
EU239217_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPSMESITSGFLGPLLGLQAGFFLLTKIL
DQ060824_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
AY739675_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494713_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494705_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494704_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494699_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB274974_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB201288_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKIL
AB194947_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
EU239218_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKIL
EU239219_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AY935700_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FN594752_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AY739674_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161759_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161816_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB274982_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161778_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161810_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161790_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161799_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161805_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161818_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161782_LHBs_P-E      VSPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161792_LHBs_P-E      VSPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161812_LHBs_P-E      VSPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161814_LHBs_P-E      VSPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161758_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKIL
GQ161766_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKIL
GQ161774_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKIL
GQ161757_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSRFLGPLLGLQAGFFLLTKIL
AB274978_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FJ349237_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FJ349238_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
LT623844_LHBs_P-E      VNPVPTTASLISSIFSRIGDXAPNMESITSGFLGPLLVLQXGFFLLTKIL
LT623845_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161817_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161815_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161807_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161770_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161761_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FN594763_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFSLLTKIL
AB915175_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB219529_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF170784_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363585_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161801_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161755_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKIL
GQ161835_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKIL
KU736899_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494692_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB091255_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
AB201289_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB201290_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKIL
AB274969_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB274971_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494690_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494693_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494697_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494701_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494702_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494706_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEXITSGFLGPLLVLQAGFFLLTKIL
AM494708_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494709_LHBs_P-E      VNPVPTTASLISSIFSRIGDPALNMESITSGFLGPLLVLQAGFFLLTKIL
AM494715_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494717_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
DQ060823_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
DQ060825_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
DQ060826_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
DQ060827_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
DQ060828_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
DQ060829_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
DQ060830_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
EU239226_LHBs_P-E      VNPVPTTASLISPIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363567_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161819_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161808_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161804_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161800_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161798_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161794_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161793_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161791_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161789_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161787_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161786_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161784_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161783_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161781_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161780_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKIL
GQ161779_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
GQ161777_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161776_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161772_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161771_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161769_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161765_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161764_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161763_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FN594758_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FN594760_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
EU239220_LHBs_P-E      VNPVPTTASLTSSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FN594766_LHBs_P-E      VNPVRTTASLISSIFSRIGDPAPNMESTTSGFLGPLHVLQAGFFLLTKIL
KM108623_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFSLLTKIL
HM363608_LHBs_P-E      VNPVPTTVSLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB219533_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLGLQAGFFLLTKIL
KF849723_LHBs_P-E      VNPVPTTVSLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KM108610_LHBs_P-E      VNPVPTTASLISSIFSTIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF170787_LHBs_P-E      VNPVPTTASLTSSIFSTIGDLVPNMESITSGFLGPLLVLQEGFSLLTKIL
HM363565_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKIL
FN594761_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMESITSGFLRPLLVLQAGFFLLTKIL
MH580645_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KM108626_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMDSITSGFLGPLLVLQAGFFLLTKIL
HM363602_LHBs_P-E      VNPVPTTASRISSIFSRIGDLAPNMESITSGFLGPLLALQAGFFSLIKIL
FN545822_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMENITSGFLGPLLVLQAGFFLLTKIL
HM363586_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF170751_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFSLLTKIL
EU239221_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMAGITSGFLGPLLVLQAGFFLLTKIL
MH580617_LHBs_P-E      VNPVPTTVSLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580628_LHBs_P-E      VNPVPTTVSLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580644_LHBs_P-E      ANPVPTTVSLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MF772355_LHBs_P-E      VXPVPTTASLISSIFSRIGDLVPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363609_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLTKIL
HM363603_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMETITSGFLGPLLVLQAGFFLLTKIL
HM363597_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161825_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMEGITSGFLGPLLVLQAGFFLLTKIL
AM494703_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161785_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB274981_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB205191_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
AB205189_LHBs_P-E      VNPVPTTVSLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
AB091256_LHBs_P-E      VNPVPTTVSLISSIFSRTGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
MH580648_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MF772357_LHBs_P-E      VNPVPTTASLISSIFSRIGDLASNMESITSGFLGPLLVLQAGFFLLTKIL
KM108622_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF170790_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
JN604235_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
JN604166_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363611_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKIL
HM363604_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363598_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363584_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363572_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSRFLGPLLVLQAGFFSLTKTL
KU736913_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580638_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF849717_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPKMESITSGFLGPLLVLQAGFFLLTKIL
HM363600_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
FN594759_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494710_LHBs_P-E      VNPVPTTVSLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AB274976_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
X75657_LHBs_P-E        VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580652_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580632_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580631_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
LT623843_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMESITSGFLGPLLVLQEGFFXLTKIL
KU736911_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736909_LHBs_P-E      VNPVPTTASLISSIFSRIGDXAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736901_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736893_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF849724_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
KF849718_LHBs_P-E      VNPVPTTVSLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF849716_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMDSITSGFLGPLLVLQAGFFLLTKIL
KF849713_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKIL
KF170783_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HQ700552_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
HQ700550_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNIEGITSGFLGPLLVLQAGFFLLTKIL
HM363599_LHBs_P-E      VNPVPTTASLISSIFSRIGDHAPNMEGITSGFLGPLLVLQAGFFLLTKIL
HM363596_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363595_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAQNMESITSGFLGPLLVLQAGFFLLTKIL
HM363594_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363583_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363577_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363566_LHBs_P-E      VNPVPTTASLISSIFSRIGDLALNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161834_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161821_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161797_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
LT623850_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
KF170742_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363591_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580630_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
LT623849_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736898_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736897_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KM108624_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
JQ000008_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MK321264_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580650_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580649_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580647_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580646_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580641_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580640_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580637_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580636_LHBs_P-E      VNPVPTTASLISSIFSRIGDPARNMESITSGFLGPLLVLQAGFFLLTKIL
MH580635_LHBs_P-E      VNPVPTTASLISSIFSRIGDPARNMESITSGFLGPLLVLQAGFFLLTKIL
MH580634_LHBs_P-E      VNPVPTTASLISSIFSRIGDPARNMESITSGFLGPLLVLQAGFFLLTKIL
MH580629_LHBs_P-E      VNPVPTSASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580625_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580624_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580622_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580621_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MF772362_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MF772354_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
LT623848_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
LT623846_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KX186584_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736912_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736910_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736908_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736907_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736906_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736905_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736904_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736903_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736902_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736900_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736896_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736895_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736894_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736892_LHBs_P-E      VNPVPTTASLISSIFSRIGDXAPNMESITSGFLGPLLVLQAGFFLLTKIL
KU736891_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KT192626_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KR139749_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
KM108625_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF922439_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF922438_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF849726_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF849722_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF849721_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF849719_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF849714_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
KF170789_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF170788_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF170786_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
KF170741_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
JQ000009_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
JN604168_LHBs_P-E      VNPVPTTXSLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363606_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363605_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363593_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363592_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTKIL
HM363587_LHBs_P-E      VNPVPTTASLISSIFSKIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363582_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363581_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
HM363580_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
HM363579_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
HM363578_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363576_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363575_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363574_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363573_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363571_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363570_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363569_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
HM363568_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161836_LHBs_P-E      VNPVPTTASLISSIFSTIGDPAPNMESITSGFLGPLLVLQAGFFLLIKIL
GQ161833_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161832_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161830_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161829_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161828_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161827_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161824_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161822_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
GQ161820_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEXITSGFLGPLLVLQAGFFLLTKIL
LT623847_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMENITSGFLGPLLVLQAGFFLLTKIL
MH464855_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMEGITSGFLGPLLVLQAGFFLLTKIL
MH464856_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLALQAGFFLLTKIL
KF849720_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494711_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMESITSGFLGPLLVLQAGFFLLTKIL
AM494712_LHBs_P-E      VNPVPTTASLISSIFSRIGDLAPNMESITSXFLGPLLVLQAGFFLLTKIL
MH580614_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580615_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580616_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580618_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580619_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580620_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580623_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
MH580651_LHBs_P-E      VNPVPTTASLISSIFSRIGDPAPNMESITSGFLGPLLVLQAGFFLLTKIL
                       . ** .: *  *.  *  *  . .:   ** :* **  ** **  * * *

FN594751_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPIWPGYRWMC
AB205190_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AB106564_LHBs_C-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
FN594765_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMC
EU239224_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AB274973_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
LT623851_LHBs_P-E      TIPQNLDSWWTSLSFLGEAPVCLGQNSQSPTSNHSPTSCPPTCPGFRWMC
GQ161760_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSLTSCPPICPGYRWMY
FN594762_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMC
AY738145_LHBs_C-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
AY738146_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
AY738147_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
AY738144_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSRSPISNHSPTSCPPICPGYRWMC
KF849728_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
FN594750_LHBs_P-E      TIPQSLDSWWTSLNFLGEAPVCRGQNSQSPISNHSLTSCPPICPGYRWMC
AM494695_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AB274979_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMC
AB194948_LHBs_P-E      TIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161831_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGNRWMC
AB915178_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSSHSPTSCPPICPGYRWMC
AB274975_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161803_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161768_LHBs_P-E      TIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AB274977_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
KF170750_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KF170782_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
FN594749_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
FN545821_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRLMC
EU239223_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AM494714_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AB201287_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363610_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
FN594748_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
GQ161796_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AB274985_LHBs_P-E      TIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
FN545842_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSPTSCPPICPGYRWMC
HM363607_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AM494700_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AM494694_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AM494696_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
DQ060822_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPTCPGYRWMC
AM494691_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AB274980_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMF
AB274970_LHBs_P-E      TIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AB205129_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AB205192_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
KF849715_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
KF170785_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161811_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161773_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161802_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AB915177_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
HM363590_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363588_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNLQSPTSNHSPTSCPPICPGYRWMC
HM363589_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363601_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AM494707_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
FJ349226_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
MF772360_LHBs_P-E      TIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161775_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161762_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
FN594756_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
FN545841_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
FN545823_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMC
FJ349239_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
EU239222_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVYLGQNSQSPTSNHSPTSCPPICPGYRWMC
EU239217_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
DQ060824_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
AY739675_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AM494713_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AM494705_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AM494704_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSPTSCPPICPGYRWMC
AM494699_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AB274974_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AB201288_LHBs_P-E      TIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AB194947_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNLQSPTSNHSPTSCPPICPGYRWMC
EU239218_LHBs_P-E      TIPQSLDSWWTSLNFLGGVPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
EU239219_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AY935700_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
FN594752_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
AY739674_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161759_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161816_LHBs_P-E      TIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AB274982_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161778_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161810_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161790_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161799_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161805_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161818_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161782_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161792_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161812_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161814_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161758_LHBs_P-E      TIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161766_LHBs_P-E      TIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161774_LHBs_P-E      TIPQSLDSWWTSLNFLGGTPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161757_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMC
AB274978_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
FJ349237_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
FJ349238_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
LT623844_LHBs_P-E      TIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
LT623845_LHBs_P-E      TIPQSLDSWWTSLXFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161817_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161815_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161807_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161770_LHBs_P-E      TIPQSLDSWWTSLNFVGGAPVCLGQNLQSPTSNHSPTSCPPICPGYRWMC
GQ161761_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
FN594763_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
AB915175_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
AB219529_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
KF170784_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
HM363585_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161801_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161755_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161835_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
KU736899_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMC
AM494692_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AB091255_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AB201289_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
AB201290_LHBs_P-E      TIPQSLDSWWTSLNFLGGVPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
AB274969_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AB274971_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AM494690_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AM494693_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AM494697_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPLICPGYRWMC
AM494701_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AM494702_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AM494706_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AM494708_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AM494709_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AM494715_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AM494717_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
DQ060823_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
DQ060825_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
DQ060826_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
DQ060827_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
DQ060828_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
DQ060829_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
DQ060830_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
EU239226_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363567_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161819_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161808_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161804_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161800_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161798_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161794_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161793_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161791_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161789_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161787_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161786_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161784_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161783_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161781_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161780_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161779_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161777_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161776_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCPGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161772_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161771_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161769_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161765_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161764_LHBs_P-E      TIPQNLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161763_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
FN594758_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
FN594760_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
EU239220_LHBs_P-E      TIPQNLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
FN594766_LHBs_P-E      TIPQSLDSWWTSLNFLGEAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KM108623_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
HM363608_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AB219533_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSQISNHSPTSCPPICPGYRWMC
KF849723_LHBs_P-E      TIPQSLDSWWTSLNFLGEAPVCLGQNSQSPISNHSLTSCPPICPGYRWMC
KM108610_LHBs_P-E      TIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KF170787_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
HM363565_LHBs_P-E      TIPKSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
FN594761_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580645_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTCNHSPTSCPPTCPGFRWMC
KM108626_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
HM363602_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
FN545822_LHBs_P-E      TIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363586_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
KF170751_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
EU239221_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580617_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
MH580628_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
MH580644_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
MF772355_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
HM363609_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNLQSPISNHSPTSCPPICPGYRWMC
HM363603_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363597_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161825_LHBs_P-E      KIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AM494703_LHBs_P-E      TIPQNLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
GQ161785_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AB274981_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
AB205191_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AB205189_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
AB091256_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580648_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MF772357_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQFPTSNHSPTSCPPICPGYRWMC
KM108622_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISSHSPTSCPQICPGYRWMC
KF170790_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
JN604235_LHBs_P-E      TIPQSLDSWWTSLNFLGEAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMC
JN604166_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
HM363611_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363604_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363598_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHLPTSCPPICPGYRWMC
HM363584_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363572_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPISCPPICPGYRWMC
KU736913_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSPTSCPPICPGYRWMC
MH580638_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSQISNHSPTSCPPICPGYRWMC
KF849717_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
HM363600_LHBs_P-E      TIPQSLDSWWTSLSFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
FN594759_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AM494710_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
AB274976_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
X75657_LHBs_P-E        TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
MH580652_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580632_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580631_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
LT623843_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCRGQNSQSPISNHSPTSCPXICPGYRWMC
KU736911_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KU736909_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KU736901_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KU736893_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KF849724_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
KF849718_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
KF849716_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
KF849713_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
KF170783_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
HQ700552_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HQ700550_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363599_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
HM363596_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363595_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPGCLGQNSQSQISNHSPTSCPPICPGYRWMC
HM363594_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363583_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNLQSPTSNHSPTSCPPICPGYRWMC
HM363577_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSSPPICPGYRWMC
HM363566_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
GQ161834_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161821_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161797_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
LT623850_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
KF170742_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
HM363591_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580630_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
LT623849_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMC
KU736898_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
KU736897_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
KM108624_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
JQ000008_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
MK321264_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
MH580650_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
MH580649_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580647_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580646_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580641_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
MH580640_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
MH580637_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580636_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580635_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580634_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580629_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580625_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580624_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580622_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MH580621_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MF772362_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
MF772354_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
LT623848_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCXGQNSQSPTSNHSPTSCPPICPGYRWMC
LT623846_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
KX186584_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
KU736912_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KU736910_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KU736908_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KU736907_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KU736906_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KU736905_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KU736904_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KU736903_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KU736902_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KU736900_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KU736896_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
KU736895_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
KU736894_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
KU736892_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KU736891_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KT192626_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
KR139749_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
KM108625_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCRGQNSQSPTSSHSPTSCPPICPGYRWMC
KF922439_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
KF922438_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
KF849726_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
KF849722_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
KF849721_LHBs_P-E      TIPQSLDSWWTSLNFLGGSPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
KF849719_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
KF849714_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
KF170789_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KF170788_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KF170786_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
KF170741_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
JQ000009_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
JN604168_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363606_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPISNHSPTSCPPICPGYRWMC
HM363605_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363593_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363592_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363587_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363582_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNLQSPTSNHSPTSCPPICPGYRWMC
HM363581_LHBs_P-E      TIPQSLDSWWTSLNFLGGSPVCLGQNLQSPTSNHSPTSCPPICPGYRWMC
HM363580_LHBs_P-E      TIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363579_LHBs_P-E      TIPQSLDSWWTSLNFLGGSPVCLGQNLQSPTSNHSPTSCPPICPGYRWMC
HM363578_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363576_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363575_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363574_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363573_LHBs_P-E      TIPQSLDSWWTSLNILGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
HM363571_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
HM363570_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
HM363569_LHBs_P-E      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSSHSPTSCPPICPGYRWMC
HM363568_LHBs_P-E      TIPQSLDSWWTSLNFLGGVPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
GQ161836_LHBs_P-E     &nbs