HBVdb

Dataset for protein SHBs of genotype E

[Download (right click)] [Edit] [Sequences] [Repertoires]

856 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KU711638_SHBs_P-E      MERITSGFLGPLLALQAGFFLLTKILTIPQNLDSWWTSLNFLGGAPVCLG
FN547206_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGGAPVCLG
AB219533_SHBs_P-E      MESITSGFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547223_SHBs_P-E      MESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGVPVCPG
FN547224_SHBs_P-E      MESITSGFLGPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGGVPVCPG
AB091259_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
AB274975_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
AM494691_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494728_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY738921_SHBs_P-E      MESITSGFLDPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB194954_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412162_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY738923_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB219529_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JN604166_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547293_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547164_SHBs_P-E      MESITSGFXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
FN547193_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547299_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486411_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN594763_SHBs_P-E      MESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN594752_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547180_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547173_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547170_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547168_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGEAPVCLG
FN295555_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
EU159673_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412160_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412157_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412142_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412137_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412134_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ060829_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ060828_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ060827_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ060826_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ060823_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY935700_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB915175_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547186_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN594748_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB091264_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB201289_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB274981_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161826_SHBs_P-E      MESITSGFLGPLHVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLG
FN295507_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547189_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
AY738924_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB201290_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLG
AB091262_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
KU711608_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEHPVCRG
GQ161831_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711648_SHBs_P-E      MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363599_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161760_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
LT623882_SHBs_P-E      MENITSGFLGPLLXLQAGFFLLTKILTIPRSLDSWWTSLSFLGGVPVCPG
FN547205_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCRG
FN547171_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
EU239218_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLG
AB274979_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MF772357_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623886_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623885_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623856_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711610_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ000009_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ000008_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547200_SHBs_P-E      MEGITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRG
FN547199_SHBs_P-E      MEGITSGFLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
L24071_SHBs_P-E        MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF849718_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363606_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363594_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363566_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486701_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXAPVCLG
GQ161789_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
GQ161784_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
GQ161776_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
GQ161775_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
GQ161774_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ161766_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ161758_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FN547288_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
FN547213_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
FN547195_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXAPVCRG
FN547194_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
AB201288_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486579_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
JX849618_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
LT623879_SHBs_P-E      MESITSGFLGPLLVLQXGFFSLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623862_SHBs_P-E      MEGITSGFLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCLG
KU711653_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
KU711652_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
KU711651_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
GQ161828_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
FN547240_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547225_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
FN547210_SHBs_P-E      MENITSGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCRG
FN547209_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
FN547185_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
FN547178_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
FN547177_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
FN545822_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
LT623864_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILXIPQSLDSWWTSLNFLGGAPVCLG
LT623854_SHBs_P-E      MESISSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEAPVCLG
LT623845_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGAPVCLG
KY494038_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486295_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXAPVCXG
JX849621_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXAPVCXG
FN547227_SHBs_P-E      MESITSGFLGPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGEAPVCRG
FN547167_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
GQ486656_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JX849617_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547202_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCXG
FN547217_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCXG
FN547218_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCXG
FN547229_SHBs_P-E      MENITSGFLGPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGGSPVCXG
MH580652_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580649_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580648_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580647_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580646_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580645_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580638_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580637_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580636_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580635_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580634_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580632_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580631_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580629_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580625_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580624_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580622_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580621_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH464856_SHBs_P-E      MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MF772362_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MF772361_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MF772358_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623883_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623878_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623877_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623871_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623868_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623865_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCLG
LT623863_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623861_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623860_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623858_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623857_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGAPVCLG
LT623850_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623846_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY697839_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY494098_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KX372217_SHBs_P-E      MESITSGFLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547277_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXAPVCXG
FN547237_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
DQ412138_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
FN547230_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCXG
FN547284_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
FN547179_SHBs_P-E      MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
GQ161820_SHBs_P-E      MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
MH580626_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPVCLG
LT623870_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
LT623844_SHBs_P-E      MESITSGFLGPLLVLQXGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
LT623849_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
LT623848_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
MH464855_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MF772355_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MF772354_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623872_SHBs_P-E      MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623853_SHBs_P-E      MXSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623852_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KX372216_SHBs_P-E      MEXITSGFLGPLXVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXAPVCLG
LT623873_SHBs_P-E      MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JN226074_SHBs_P-E      MESITSGFPGPLLVLQAGFSSLTKILTIPRXXDSWWTSLNFLGGTPVCLG
JX849596_SHBs_P-E      MESITSGFPGPLLVLQAGFSSLTKILTIPRXXDSWWTSLNFLGGTPVCLG
KY271381_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY271383_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711631_SHBs_P-E      MESITSGFLGPLLALQAGYFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
AB274984_SHBs_P-E      MENITSGFLGPLRVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547258_SHBs_P-E      MESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
FN547262_SHBs_P-E      MESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
KM983583_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KM983590_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
EU239221_SHBs_P-E      MAGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303901_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB205327_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711628_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MF772359_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLIKILTIPQSLDSWWTSLNFLGGAPVCLG
KY271386_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILAIPPGLDSWWTSLNFLGGAPVCLG
GQ161825_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILKIPQSLDSWWTSLNFLGGAPVCLG
FN594751_SHBs_P-E      MESITSGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB205325_SHBs_P-E      MESITSGFLGPLLVLQAGFSWLIKILTIPQSLDSWWTSLNFLGGAPVCLG
AB205324_SHBs_P-E      MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB091266_SHBs_P-E      MESITSGFLRPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KM983584_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLIKILTIPQSLGSWWTSLNFLGGAPVCLG
HM363603_SHBs_P-E      METITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363572_SHBs_P-E      MESITSRFLGPLLVLQAGFFSLTKTLTIPQSLDSWWTSLNFLGGAPVCRG
DQ412148_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSFNFLGGAPVCRG
DQ412145_SHBs_P-E      MESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412135_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412153_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303889_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
DQ299407_SHBs_P-E      MESITSGFLGPLLVLQEGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363579_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
HM363581_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
AB205328_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB091260_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB205129_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB205189_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB205191_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB091255_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB091256_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623859_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCHG
KY493921_SHBs_P-E      MXSITSGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711665_SHBs_P-E      MENIISGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711654_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPG
KU711636_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KM983582_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGEAPVCRG
FN594749_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY738920_SHBs_P-E      MENITSGFLGPLLVLQEGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY738147_SHBs_P-E      MDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY738144_SHBs_P-E      MDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY738145_SHBs_C-E      MDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB205323_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB205190_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB205188_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB274972_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB274973_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB106564_SHBs_C-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF170787_SHBs_P-E      MESITSGFLGPLLVLQEGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF170751_SHBs_P-E      MESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN594766_SHBs_P-E      MESTTSGFLGPLHVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCLG
FN547254_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGAPVCPG
FN547204_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547198_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPKNLDSWWTSLNFLGEAPVCRG
FN547165_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
FJ692546_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412166_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY738919_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY738146_SHBs_P-E      MDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB274980_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486240_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGEAPVCRG
JX849622_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGEAPVCRG
AM494722_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494694_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494700_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ692551_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363575_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486778_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
FN547303_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547214_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRG
LT623881_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
JX849626_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRG
JN604235_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRG
GQ486079_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRG
GQ161834_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
GQ161833_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
GQ161822_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
GQ161803_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
FN594762_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
FN547226_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
FJ692542_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
FN545823_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
GQ486707_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486131_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JX849623_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486116_SHBs_P-E      MENITSGFLGPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
JX849624_SHBs_P-E      MENITSGFLGPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
KU711659_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCFG
KR139749_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KM108626_SHBs_P-E      MDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KM108623_SHBs_P-E      MEGITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF849723_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCLG
KF849720_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF771927_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF170779_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDTWWTSLNFLGGAPGCLG
JQ972818_SHBs_P-E      MESITSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGAPVCLG
HM363598_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161757_SHBs_P-E      MESITSRFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
FN547289_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
FN295520_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN295510_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
EU239220_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLSFLGGAPVCLG
DQ412169_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRG
DQ412159_SHBs_P-E      METITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412139_SHBs_P-E      MKSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ299402_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
AY738922_SHBs_P-E      MGSITSGFLGPLRVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY738918_SHBs_P-E      MKSITSGFLGPLLVLQAGFFLLQKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303915_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494738_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494736_SHBs_P-E      MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
AB274985_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412140_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
AB274982_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB194955_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
AB194948_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRG
AB091257_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB091258_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB091261_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB091263_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB091265_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB201287_SHBs_P-E      MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB205192_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB205329_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB274969_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB274971_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB274974_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB274976_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB274977_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB274978_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161836_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLIKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547295_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
DQ412172_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLXKILTIPQNLDSWWTSLNFLGGAPVCLG
FN594756_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486093_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JX849625_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623851_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLSFLGEAPVCLG
GQ161764_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGAPVCLG
FN547282_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGAPVCLG
FJ692540_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILXIPQXLDSWWTSLNFLGGAPVCLG
FJ692545_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711663_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363576_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363565_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPVCLG
GQ161777_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161763_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547260_SHBs_P-E      MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547281_SHBs_P-E      MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711643_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLIKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711639_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711630_SHBs_P-E      MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
KP997699_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KF170741_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363611_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363597_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363595_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPGCLG
HM363592_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161786_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161759_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547300_SHBs_P-E      MESSTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPGGSPVCLG
FN547286_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547278_SHBs_P-E      MESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547276_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547274_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547252_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547246_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547231_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547184_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCLG
FN547182_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
FJ349239_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
EU239224_SHBs_P-E      MESITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
EF547857_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412173_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412150_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412144_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPVCPG
AY303913_SHBs_P-E      MESITSGFLRPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303912_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
AY303894_SHBs_P-E      MEGITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
AM494746_SHBs_P-E      MENITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB205326_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRG
AB194947_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412149_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
DQ412158_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MH580633_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
KY498770_SHBs_P-E      MESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCLG
KU736894_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711658_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KU711641_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711629_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711612_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
KU711611_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KM108622_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF849727_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLG
KF849724_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF849716_SHBs_P-E      MDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF849715_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF849714_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363609_SHBs_P-E      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363608_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363602_SHBs_P-E      MESITSGFLGPLLALQAGFFSLIKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363588_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363583_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363582_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363577_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363573_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNILGGAPVCLG
GQ161810_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161808_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161804_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161778_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161770_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFVGGAPVCLG
FN594765_SHBs_P-E      MESITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN594750_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRG
FN547310_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547175_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
FN547163_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547158_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN545821_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547220_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN295552_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
FN295551_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN295509_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ692553_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ692552_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ692547_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412174_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412171_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412170_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412164_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
DQ412143_SHBs_P-E      MEAITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ299410_SHBs_P-E      MESIISGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ060825_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ060824_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303893_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
AY303886_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
AY303881_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTXPQSLDSWXTSLNFLGGAPVCLG
AM494735_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494724_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494703_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGAPVCLG
AM494698_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
AM494704_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
AM494697_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494696_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494695_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AF208871_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB915180_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB915177_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623843_SHBs_P-E      MESITSGFLGPLLVLQEGFFXLTKILTIPQSLDSWWTSLNFLGGAPVCRG
KU711661_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCLG
KU711657_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711635_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711634_SHBs_P-E      MESITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
KU711617_SHBs_P-E      MESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KM983581_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
KF849713_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF771930_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF170752_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ000003_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363590_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486692_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161798_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN594761_SHBs_P-E      MESITSGFLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN594760_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547318_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRG
FN547248_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGAPVCLG
FN547234_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547233_SHBs_P-E      MESITSGFLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547207_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLG
FN547190_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547160_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547155_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVXLG
FN547154_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN295553_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ692543_SHBs_P-E      MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ349226_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
EU239222_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVYLG
DQ412165_SHBs_P-E      MESITSGFLGPLLVVQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412163_SHBs_P-E      MESITSGFLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412151_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFPGGAPVCLG
DQ412146_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
DQ412136_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ299420_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ299419_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ299417_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ299416_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ299414_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ299413_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ299412_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ299411_SHBs_P-E      MESITSGFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ299406_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ299405_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ299403_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
DQ060830_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ060822_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY739675_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY739674_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY738925_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303930_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303929_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303928_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303925_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
AY303924_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303923_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303922_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303921_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303919_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303918_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303917_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303916_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303914_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPXSLDSWXTSLNFLGGAPVCLG
AY303911_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303909_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303908_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303907_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303906_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303905_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303903_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303899_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303898_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303892_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303891_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303890_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303888_SHBs_P-E      MESITSGFLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303887_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303885_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303884_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303883_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303878_SHBs_P-E      MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494753_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494751_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494747_SHBs_P-E      MESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494745_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494741_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494732_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLG
AM494721_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB274970_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
GQ486451_SHBs_P-E      MESITSGFLGPLLVLQXGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
JX849619_SHBs_P-E      MESITSGFLGPLLVLQXGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
FN547253_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
FN547256_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
DQ299418_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711656_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711640_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711633_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
KU711632_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCRG
KU711609_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KT192626_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KM983589_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF922439_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF922438_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF849728_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF849726_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF849722_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF849721_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
KF849719_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF849717_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF771921_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF170781_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRG
KM108625_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
KC885607_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JX849620_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ972819_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ000006_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ000005_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ000004_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ000002_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JN604192_SHBs_P-E      MKSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWXTSLNFLGGAPVCLG
JN604168_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HQ700552_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HQ700551_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HQ700550_SHBs_P-E      IEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363610_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363607_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363605_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363604_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363601_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363600_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
HM363596_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363593_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363591_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363589_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363587_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363586_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363585_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363584_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363580_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
HM363578_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363574_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363568_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCLG
HM363567_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ491107_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPVCLG
GQ486756_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486728_SHBs_P-E      MESITSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486664_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486548_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161835_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161832_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161830_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161829_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161827_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161824_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161821_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161819_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161818_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161817_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161816_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ161815_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161814_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161812_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161811_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161807_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161805_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161802_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161801_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161800_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161799_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161797_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161796_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161795_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161794_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161793_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161792_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161791_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161790_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161787_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161785_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161783_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161782_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161781_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161780_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161779_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161773_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161772_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161771_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161769_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161768_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCLG
GQ161765_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161762_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161761_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161756_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161755_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547358_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547347_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
FN547339_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547333_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547297_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547287_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547285_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547283_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547275_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547272_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547271_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547270_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547268_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXAPVCLG
FN547267_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547266_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547264_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547263_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547261_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547259_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547255_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
FN547251_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547236_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547219_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547212_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547203_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547197_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547192_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547187_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547183_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547181_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547176_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547172_SHBs_P-E      MEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547159_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN295554_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN295550_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ692550_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ692548_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ349238_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ349237_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
EU239226_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
EU239223_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
EU239219_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
EU239217_SHBs_P-E      MESITSGFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412168_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412167_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412155_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
DQ412147_SHBs_P-E      MEAITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWGTSLNFLGGAPVCLG
AY303931_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494744_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AB915178_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MG383615_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
MF772360_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
LT623876_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCPG
FN547174_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
FJ692544_SHBs_P-E      MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412141_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
DQ412152_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSPVCLG
AB915176_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494689_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494690_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494692_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494693_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494699_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494701_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494702_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494705_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623874_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623855_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623847_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
L29017_SHBs_P-E        MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
KY697849_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPVCLG
KY271380_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KX186584_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736899_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
KU736898_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736897_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736896_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736895_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711664_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711662_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711655_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU711647_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KM983588_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KM983586_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLNSWWTSLNFLGGAPVCLG
KF771944_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF771926_SHBs_P-E      MESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF170785_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JX849631_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
JX849630_SHBs_P-E      MESITSGFLGPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGXAPVCPG
JX849629_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486665_SHBs_P-E      MESITSGFLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ486765_SHBs_P-E      MESITSGFLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN594758_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547362_SHBs_P-E      MESITSGFLRPLLVLQAGFXLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
FN547211_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPVCLG
FN547201_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
AM494714_SHBs_P-E      MESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494711_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRG
GQ486258_SHBs_P-E      MENITSGFLGPLXVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPXCLG
KF170780_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547222_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547279_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547359_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ972815_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXAPVCLG
JQ972820_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ972821_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ972825_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ972824_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ972823_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ972817_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ972816_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ972814_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ972813_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ972812_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363571_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363570_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
HM363569_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN594759_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547356_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547290_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547269_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547265_SHBs_P-E      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547196_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547191_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547161_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547156_SHBs_P-E      MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN545841_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ349240_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
DQ299415_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303927_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303926_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303920_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303910_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303904_SHBs_P-E      MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303902_SHBs_P-E      MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303882_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494752_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494740_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494739_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494737_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494734_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494733_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494731_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494726_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494725_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494723_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494717_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494715_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494713_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494710_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494709_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494708_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494707_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547162_SHBs_P-E      MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCLG
FN547188_SHBs_P-E      MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCLG
FN547257_SHBs_P-E      MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGXPVCLG
FN547304_SHBs_P-E      MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494706_SHBs_P-E      MEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494720_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
AM494727_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
AM494730_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ972822_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
FN547319_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRG
FN547239_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
FN545842_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
AM494832_SHBs_P-E      MESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494748_SHBs_P-E      MESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494743_SHBs_P-E      MESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AM494729_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
AM494712_SHBs_P-E      MESITSXFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCRG
AM494719_SHBs_P-E      MESITSXFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY303897_SHBs_P-E      MESITSGFXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547221_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY494047_SHBs_P-E      MEXITSXLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
LT623869_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY494096_SHBs_P-E      MESITSGXLGPLLXLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPVCXG
KM108624_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF170750_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN545827_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736911_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736913_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
KU736912_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FN547215_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
FN547311_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
X75657_SHBs_P-E        MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MK321264_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580651_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580650_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580644_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580641_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580640_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580630_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580628_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580623_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580620_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580619_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580618_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580617_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580616_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580615_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH580614_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MH165306_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY494018_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736910_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736909_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736908_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736907_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736906_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736905_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736904_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736903_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736902_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736901_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736900_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736893_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736892_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KU736891_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KM983587_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KM983585_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KM108610_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPVCLG
KM108590_SHBs_P-E      MESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF170790_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF170789_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF170788_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF170786_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF170784_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF170783_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF170782_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF170742_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ972829_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
JQ972826_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCXG
JQ972828_SHBs_P-E      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
                       :    *    **  :*  :  *   *  *   .:* **:   *  *   *

KU711638_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDS
FN547206_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDC
AB219533_SHBs_P-E      QNSQSQISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547223_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547224_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB091259_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB274975_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494691_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494728_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738921_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB194954_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412162_SHBs_P-E      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738923_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB219529_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604166_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547293_SHBs_P-E      QNSQSQISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547164_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547193_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547299_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486411_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594763_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594752_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547180_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547173_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547170_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547168_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295555_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU159673_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412160_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412157_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412142_SHBs_P-E      QNSQSQISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412137_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412134_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ060829_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ060828_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ060827_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ060826_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ060823_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY935700_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB915175_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547186_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594748_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB091264_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB201289_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB274981_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161826_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLGY
FN295507_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547189_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738924_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB201290_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB091262_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711608_SHBs_P-E      QNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161831_SHBs_P-E      QNSQSPTSNHSPTSCPPTCPGNRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711648_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363599_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161760_SHBs_P-E      QNSQSPTSNHSLTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
LT623882_SHBs_P-E      QNSQSPTSNHSPXSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547205_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547171_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU239218_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB274979_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF772357_SHBs_P-E      QNSQFPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623886_SHBs_P-E      QNLQSPTSNHSPTSCPPICPGYRWMCLRRSIISLFILLLCLIFLLVLLDY
LT623885_SHBs_P-E      QNLQSPTSNHSPTSCPPICPGYRWMCLRRSIISLFILLLCLIFLLVLLDY
LT623856_SHBs_P-E      QNSQSQISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDY
KU711610_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ000009_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ000008_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547200_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547199_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
L24071_SHBs_P-E        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF849718_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363606_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363594_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363566_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486701_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161789_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161784_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161776_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161775_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161774_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161766_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161758_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547288_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547213_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547195_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547194_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB201288_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486579_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849618_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623879_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623862_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711653_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711652_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711651_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161828_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547240_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547225_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547210_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547209_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547185_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDS
FN547178_SHBs_P-E      QNSQSPTSNHSPTSCPPICTGYRWMCLRRFITFLFILLLCLIFLLVLLDS
FN547177_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDS
FN545822_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623864_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623854_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623845_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLXCLIFLLVLLDY
KY494038_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486295_SHBs_P-E      QNSQXPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849621_SHBs_P-E      QNSQXPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547227_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
FN547167_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486656_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849617_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547202_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
FN547217_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
FN547218_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547229_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580652_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580649_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580648_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580647_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580646_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580645_SHBs_P-E      QNSQSPTCNHSPTSCPPTCPGFRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580638_SHBs_P-E      QNSQSQISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580637_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580636_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580635_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580634_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580632_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580631_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580629_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580625_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580624_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580622_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580621_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH464856_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDS
MF772362_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF772361_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF772358_SHBs_P-E      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623883_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
LT623878_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623877_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623871_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623868_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623865_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623863_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623861_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623860_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623858_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623857_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623850_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623846_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY697839_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY494098_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372217_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIICLFILLLCLIFLLVLLDY
FN547277_SHBs_P-E      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
FN547237_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412138_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547230_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
FN547284_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547179_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161820_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLIFLLVLLXY
MH580626_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623870_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623844_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623849_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623848_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH464855_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF772355_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF772354_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623872_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623853_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623852_SHBs_P-E      QNSQSPISNHSPTSCPPXCPGXRXMCLRRFIIFLFILLLCLIFLLVLLDY
KX372216_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIXLFILLLCLIFLLVLLDY
LT623873_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226074_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
JX849596_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
KY271381_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY271383_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711631_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLICLLVLLDS
AB274984_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
FN547258_SHBs_P-E      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547262_SHBs_P-E      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM983583_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM983590_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU239221_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303901_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205327_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711628_SHBs_P-E      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MF772359_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY271386_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLIGSWGSLPLDY
GQ161825_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594751_SHBs_P-E      QNSQSPTSSHSPTSCPPIWPGYRWMCLRRFIIFLFILLLCLIFWWDLQDY
AB205325_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205324_SHBs_P-E      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB091266_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
KM983584_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363603_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363572_SHBs_P-E      QNSQSPTSNHSPISCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412148_SHBs_P-E      QNSQSPISNHSPTSCPPTCPGYHWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412145_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
DQ412135_SHBs_P-E      QNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412153_SHBs_P-E      QNSQSPTSNHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303889_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCXRRFIIFLFILLLCLIFLLVLLDY
DQ299407_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363579_SHBs_P-E      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363581_SHBs_P-E      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205328_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB091260_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205129_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205189_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205191_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB091255_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLGY
AB091256_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLGY
LT623859_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
KY493921_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711665_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711654_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDS
KU711636_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM983582_SHBs_P-E      QNSQSPTSNHSPISCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594749_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738920_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738147_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFTIFLFILLLCLIFLLVLLDY
AY738144_SHBs_P-E      QNSRSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738145_SHBs_C-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205323_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205190_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205188_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB274972_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB274973_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB106564_SHBs_C-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170787_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIYLFILLLCLIFLLVLLDY
KF170751_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594766_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRIFIFLFILLLCLIFLLDLLDY
FN547254_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFWLALLDY
FN547204_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547198_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
FN547165_SHBs_P-E      RNSQSPISNHSPTSCPPICPGYRWMCLRXFIIFLFILLLCLIFLLVLLDY
FJ692546_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412166_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738919_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWLCLRRFIIFLFILLLCLIFLLVLLDY
AY738146_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB274980_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMFLRRFIIFLFILLLCLIFLLVLLDY
GQ486240_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849622_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494722_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCPIFLLVLLDY
AM494694_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494700_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692551_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363575_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486778_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547303_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547214_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623881_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849626_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604235_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486079_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161834_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161833_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161822_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161803_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
FN594762_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547226_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692542_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN545823_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486707_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRXFIIFLFILLLCLIFLLVLLDY
GQ486131_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849623_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486116_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
JX849624_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
KU711659_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KR139749_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM108626_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM108623_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF849723_SHBs_P-E      QNSQSPISNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF849720_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF771927_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFXLXLLDY
KF170779_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972818_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363598_SHBs_P-E      QNSQSPISNHLPTSCPPICPGYRWMCQRRFIIFLFILLLCLIFLLVLLDY
GQ161757_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547289_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
FN295520_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295510_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU239220_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412169_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412159_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
DQ412139_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ299402_SHBs_P-E      QNSQSPTSNHSPTFCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738922_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738918_SHBs_P-E      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303915_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494738_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494736_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
AB274985_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412140_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB274982_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB194955_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB194948_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB091257_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB091258_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB091261_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB091263_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB091265_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB201287_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205192_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205329_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB274969_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB274971_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB274974_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB274976_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB274977_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB274978_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161836_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547295_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412172_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594756_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486093_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849625_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623851_SHBs_P-E      QNSQSPTSNHSPTSCPPTCPGFRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161764_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547282_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692540_SHBs_P-E      QNSQSPTSNHSPTSCPPXCPGYRXMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692545_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711663_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
HM363576_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363565_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161777_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161763_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547260_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547281_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711643_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711639_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
KU711630_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997699_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLISLLVLLDS
KF170741_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363611_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363597_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363595_SHBs_P-E      QNSQSQISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363592_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161786_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161759_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547300_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGFRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547286_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547278_SHBs_P-E      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLXCLLVLLDY
FN547276_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGFRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547274_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547252_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547246_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIISLFILLLCLIFLLVLLDY
FN547231_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIICLFILLLCLIFLLVLLDY
FN547184_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIICLFILLLCLIFLLVLLDY
FN547182_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFIQLLCLIFLLVLLDY
FJ349239_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU239224_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF547857_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412173_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412150_SHBs_P-E      QNSQFPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412144_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303913_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMSLRRFIIFLFILLLCLIFLLVLLDY
AY303912_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303894_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494746_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWTCLRRFIIFLFILLLCLIFLLVLLDY
AB205326_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB194947_SHBs_P-E      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412149_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412158_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580633_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY498770_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736894_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711658_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711641_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711629_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711612_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711611_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM108622_SHBs_P-E      QNSQSPISSHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF849727_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF849724_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF849716_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF849715_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF849714_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363609_SHBs_P-E      QNLQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363608_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCRRRFIIFLFILLLCLIFLLVLLDY
HM363602_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363588_SHBs_P-E      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363583_SHBs_P-E      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363582_SHBs_P-E      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363577_SHBs_P-E      QNSQSPTSNHSPTSSPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363573_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161810_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161808_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161804_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161778_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161770_SHBs_P-E      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594765_SHBs_P-E      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594750_SHBs_P-E      QNSQSPISNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547310_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547175_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547163_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547158_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN545821_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILLLCLIFLLVLLDY
FN547220_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILLLCLIFLLVLLDY
FN295552_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295551_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295509_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692553_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692552_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692547_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412174_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412171_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412170_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412164_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412143_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFIXLLCLIFLLVLLDY
DQ299410_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ060825_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ060824_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303893_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303886_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303881_SHBs_P-E      QNXQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494735_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494724_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494703_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494698_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494704_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494697_SHBs_P-E      QNSQSPTSSHSPTSCPLICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494696_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494695_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF208871_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDS
AB915180_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB915177_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623843_SHBs_P-E      QNSQSPISNHSPTSCPXICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711661_SHBs_P-E      QNSQSPTSNHSPTSCPPTCPGFRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711657_SHBs_P-E      PNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711635_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711634_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711617_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM983581_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF849713_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF771930_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KF170752_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ000003_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363590_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486692_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161798_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594761_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594760_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLMVLLDY
FN547318_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547248_SHBs_P-E      QNSQSPTSNHSPTSCPXTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547234_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547233_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547207_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547190_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLLILLLCLIFLLVLLDY
FN547160_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547155_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547154_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295553_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692543_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLNY
FJ349226_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU239222_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412165_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412163_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412151_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIICLCILLLCLIFLLVLLDY
DQ412146_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
DQ412136_SHBs_P-E      QNSQSPTFSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ299420_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ299419_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ299417_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ299416_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ299414_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ299413_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ299412_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ299411_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ299406_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ299405_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ299403_SHBs_P-E      QNSQSPTSNHSPTFCPPICPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
DQ060830_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ060822_SHBs_P-E      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY739675_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY739674_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738925_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303930_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303929_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303928_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303925_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303924_SHBs_P-E      QNSQSQTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303923_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303922_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303921_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303919_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303918_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303917_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303916_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303914_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303911_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303909_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303908_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303907_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303906_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303905_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303903_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303899_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303898_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303892_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303891_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303890_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303888_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303887_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303885_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303884_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303883_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303878_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494753_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494751_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494747_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494745_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494741_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494732_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494721_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB274970_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486451_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849619_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547253_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547256_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ299418_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711656_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711640_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711633_SHBs_P-E      QISQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711632_SHBs_P-E      QNSRSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711609_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT192626_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM983589_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF922439_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF922438_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF849728_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF849726_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF849722_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF849721_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF849719_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF849717_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF771921_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170781_SHBs_P-E      QNSQSPTSSHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM108625_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC885607_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849620_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972819_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ000006_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ000005_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ000004_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ000002_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604192_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604168_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
HQ700552_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700551_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700550_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363610_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363607_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363605_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363604_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363601_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363600_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363596_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363593_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363591_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363589_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363587_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363586_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363585_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363584_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363580_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363578_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363574_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363568_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363567_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ491107_SHBs_P-E      QNSQSPTSSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486756_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486728_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486664_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486548_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161835_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161832_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161830_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161829_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161827_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161824_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161821_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161819_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161818_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161817_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161816_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161815_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161814_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161812_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161811_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161807_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161805_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161802_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161801_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161800_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161799_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161797_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161796_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161795_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161794_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161793_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161792_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161791_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161790_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161787_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161785_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161783_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161782_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161781_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161780_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161779_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161773_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161772_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161771_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161769_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161768_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161765_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161762_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161761_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161756_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161755_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547358_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547347_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547339_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547333_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547297_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547287_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547285_SHBs_P-E      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547283_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547275_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547272_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547271_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547270_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547268_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547267_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547266_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547264_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547263_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547261_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547259_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547255_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547251_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547236_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547219_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547212_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547203_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547197_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547192_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547187_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547183_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547181_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547176_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547172_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547159_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295554_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295550_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692550_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692548_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349238_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349237_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU239226_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU239223_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU239219_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU239217_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412168_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412167_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412155_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412147_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
AY303931_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFXIFLXILLLCLIFLLVLLDY
AM494744_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB915178_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG383615_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIISLFILLLCLIFLLVLLDY
MF772360_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623876_SHBs_P-E      QNSQSPTSNHSPTSCPPTCPGYRWMCLRXFIIFLFILLLCLIFLLVLLDY
FN547174_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692544_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412141_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIXLFILLLCLIFLLVLLDY
DQ412152_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB915176_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494689_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494690_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494692_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494693_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494699_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLALLDY
AM494701_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494702_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494705_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT623874_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCXRRFIIFLFILLLCLIFLLVLLDY
LT623855_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVXLDY
LT623847_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
L29017_SHBs_P-E        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY697849_SHBs_P-E      QNSQSPTSSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY271380_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX186584_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736899_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736898_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736897_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736896_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736895_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711664_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711662_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711655_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU711647_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM983588_SHBs_P-E      QNSQSPTSSHSPTSCPPICLGYRWMCLRRFIIFLFIQLLCLIFLLVLLDY
KM983586_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF771944_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF771926_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170785_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849631_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849630_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849629_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486665_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486765_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594758_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547362_SHBs_P-E      QNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547211_SHBs_P-E      QNSQXPTSSHSPTSCPPICPGYRXMCLRRFIIFLFILLLCLIFLLVLLDY
FN547201_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIXLLVLLDY
AM494714_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494711_SHBs_P-E      QNSQSPTSSHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486258_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
KF170780_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547222_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547279_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547359_SHBs_P-E      QNXQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972815_SHBs_P-E      QNSXSXTSXHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972820_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972821_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972825_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972824_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972823_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972817_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972816_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972814_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972813_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972812_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363571_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363570_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM363569_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594759_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547356_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547290_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547269_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547265_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547196_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547191_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547161_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547156_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN545841_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349240_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ299415_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303927_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303926_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303920_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303910_SHBs_P-E      QNSQSPTCSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303904_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303902_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303882_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494752_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494740_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494739_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494737_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494734_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494733_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494731_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494726_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494725_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494723_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494717_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494715_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494713_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494710_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494709_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494708_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494707_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547162_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547188_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547257_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547304_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494706_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494720_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRXFIIFLFILLLCLIFLLVLLDY
AM494727_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRXFIIFLFILLLCLIFLLVLLDY
AM494730_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972822_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547319_SHBs_P-E      QNSQSPTSSHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547239_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN545842_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494832_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494748_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494743_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494729_SHBs_P-E      QNSQSPTSSHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494712_SHBs_P-E      QNSQSPTSSHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494719_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303897_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547221_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY494047_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
LT623869_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY494096_SHBs_P-E      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM108624_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLISLLVLLDY
KF170750_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN545827_SHBs_P-E      QNSQSPTSXHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736911_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736913_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736912_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547215_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN547311_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
X75657_SHBs_P-E        QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK321264_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580651_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580650_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580644_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580641_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580640_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580630_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580628_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580623_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580620_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580619_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580618_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580617_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580616_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580615_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH580614_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH165306_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY494018_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736910_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736909_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736908_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736907_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736906_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736905_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736904_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736903_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736902_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736901_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736900_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736893_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736892_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736891_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM983587_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM983585_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM108610_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM108590_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170790_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170789_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170788_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170786_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170784_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170783_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170782_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170742_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972829_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972826_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ972828_SHBs_P-E      QNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
                                *    .*    * .    *     *   *            

KU711638_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPMDGNCTCI
FN547206_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
AB219533_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCI
FN547223_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547224_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB091259_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB274975_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AM494691_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AM494728_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY738921_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB194954_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDGNCTCI
DQ412162_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY738923_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB219529_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN604166_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547293_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547164_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547193_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547299_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486411_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN594763_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN594752_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547180_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547173_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547170_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547168_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN295555_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
EU159673_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412160_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412157_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412142_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412137_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412134_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ060829_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ060828_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ060827_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ060826_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ060823_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY935700_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB915175_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDGNCTCI
FN547186_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAXGTSMFPSCCCSKPSDGNCTCI
FN594748_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB091264_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB201289_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB274981_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161826_SHBs_P-E      QGMLPVCPLIPGSSTTRTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN295507_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSLFPSCCCSKPSDGNCTCI
FN547189_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
AY738924_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB201290_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB091262_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU711608_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161831_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU711648_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPLDGNCTCI
HM363599_SHBs_P-E      QGMLPVCPLIPGSSTTSTGSCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161760_SHBs_P-E      QGILPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPLCCCSKPSDGNCTCI
LT623882_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547205_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547171_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EU239218_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB274979_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MF772357_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
LT623886_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623885_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623856_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
KU711610_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JQ000009_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JQ000008_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSXGNCTCI
FN547200_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547199_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
L24071_SHBs_P-E        QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSEPSDGNCTCI
KF849718_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363606_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363594_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363566_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486701_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161789_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161784_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161776_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161775_SHBs_P-E      HGMLPVCPLIPXSSTTSTGPCRTCTTXAQGXSMFPSCCCSKPSDGNCTCI
GQ161774_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161766_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161758_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547288_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547213_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547195_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLVQGTSMFPSCCCSKPSDGNCTCI
FN547194_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB201288_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486579_SHBs_P-E      QGMLPVCPXIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JX849618_SHBs_P-E      QGMLPVCPXIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623879_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623862_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAXGTSMFPSCCCLKPSDGNCTCI
KU711653_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU711652_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU711651_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSAGNCTCI
GQ161828_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547240_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547225_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547210_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547209_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547185_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547178_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547177_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN545822_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623864_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623854_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623845_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY494038_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486295_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JX849621_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547227_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547167_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486656_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JX849617_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547202_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547217_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547218_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547229_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580652_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580649_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580648_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580647_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580646_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580645_SHBs_P-E      QGMLPVCPLIPRSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580638_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
MH580637_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580636_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580635_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580634_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580632_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580631_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580629_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580625_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580624_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580622_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580621_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH464856_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSLFPSCCCSKPSDGNCTCI
MF772362_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MF772361_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MF772358_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623883_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623878_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623877_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623871_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623868_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623865_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623863_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623861_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCI
LT623860_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623858_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623857_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623850_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623846_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY697839_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY494098_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KX372217_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547277_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547237_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412138_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547230_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547284_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547179_SHBs_P-E      QGMLPVCPLLPGSSTTSXGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161820_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580626_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCI
LT623870_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623844_SHBs_P-E      QGMLPVCPLXPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623849_SHBs_P-E      XGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623848_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH464855_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MF772355_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MF772354_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623872_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623853_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623852_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KX372216_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623873_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN226074_SHBs_P-E      QGMLPVCPLIPGXSTTSTGPCRTCTTVAQGTSMFPSCCCSKPSDGNCTCI
JX849596_SHBs_P-E      QGMLPVCPLIPGXSTTSTGPCRTCTTVAQGTSMFPSCCCSKPSDGNCTCI
KY271381_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSRPSDKNCTCI
KY271383_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSRPSDKNCTCI
KU711631_SHBs_P-E      RGMLPVCPLIPGSSTTSMGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
AB274984_SHBs_P-E      QGMLPVCPLIPGSSNTSTGPCRTCTTLAQGTSMFPSCCCSKPLDGNCTCI
FN547258_SHBs_P-E      QGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547262_SHBs_P-E      QGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KM983583_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KM983590_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EU239221_SHBs_P-E      QGMLRVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303901_SHBs_P-E      QGMLPVCPLIPGSTTTSTGPCRTCTTLAQGTSMFPSCCCTKPTDGNCTCI
AB205327_SHBs_P-E      LRMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDRNCTCI
KU711628_SHBs_P-E      RGMLPVCPLIPGSATTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
MF772359_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAHGTSMFPSCCCSKPSDGNCTCI
KY271386_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSIFPSCCCSKPSNGNCTCI
GQ161825_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPTDGNCTCI
FN594751_SHBs_P-E      QGMLRECPQTPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB205325_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB205324_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB091266_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMFPSCCCSKPSDGNCTCI
KM983584_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMSPSCCCSKPSDGNCTCI
HM363603_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSTFPSCCCSKPSDGNCTCI
HM363572_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412148_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412145_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDRNCTCI
DQ412135_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412153_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303889_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ299407_SHBs_P-E      QGMLPVCPQIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363579_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363581_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB205328_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB091260_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB205129_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB205189_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB205191_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB091255_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB091256_SHBs_P-E      QGMLPVCPLIPGSSTTITGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623859_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY493921_SHBs_P-E      RGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDANCTCI
KU711665_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
KU711654_SHBs_P-E      QGMLRVCPLIPGSSTTSTGPCRTCTIPAQGTSMFPSCCCSKPSDGNCTCI
KU711636_SHBs_P-E      HGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCI
KM983582_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN594749_SHBs_P-E      QGMLPVCTLIPGSSTTSTGLTRACTTLAQGTSMFPSCCCSKPSDGNCTCI
AY738920_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY738147_SHBs_P-E      HGMLPVCPLIPGSPTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY738144_SHBs_P-E      HGMLPVCPLIPGSPTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY738145_SHBs_C-E      HGMLPVCPLIPGSPTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB205323_SHBs_P-E      QGMLPVCPLIPRSSTTSTGPCRTCTIPVQGTSMFPSCCCSKPSDGNCTCI
AB205190_SHBs_P-E      RGILPVCPLLPGSATTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB205188_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB274972_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB274973_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSGGNCTCI
AB106564_SHBs_C-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPADGNCTCT
KF170787_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF170751_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSTFPSCCCSKPSDGNCTCI
FN594766_SHBs_P-E      QGILPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547254_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547204_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547198_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547165_SHBs_P-E      QGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ692546_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPLDGNCTCI
DQ412166_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY738919_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY738146_SHBs_P-E      HGMLPVCPLIPGSPTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB274980_SHBs_P-E      QGILPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486240_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSEGNCTCI
JX849622_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSEGNCTCI
AM494722_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
AM494694_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
AM494700_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
FJ692551_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
HM363575_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
GQ486778_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547303_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547214_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623881_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JX849626_SHBs_P-E      QGMLPVCPMIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN604235_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486079_SHBs_P-E      QGMLPVCPMIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161834_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161833_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161822_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161803_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN594762_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLVQGTSMFPSCCCSKPSDGNCTCI
FN547226_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ692542_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN545823_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486707_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDANCTCI
GQ486131_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDANCTCI
JX849623_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDANCTCI
GQ486116_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDGNCTCI
JX849624_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDGNCTCI
KU711659_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KR139749_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KM108626_SHBs_P-E      QGILPVCPLIPGSSTTSTGLCRTCTTLAQGTSMFPSCCCSKSSDRNCTCI
KM108623_SHBs_P-E      QGMLPVCPLIPGPSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF849723_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF849720_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAHGTSMFPSCCCSKPSDGNCTCI
KF771927_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF170779_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAKGTSMFPSCCCSKPSDGNCTCI
JQ972818_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSILPSCCCLKPSDGNCTCI
HM363598_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQRTSMFPSCCCSKPSDGNCTCI
GQ161757_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMFPSCCCSKPSDGNCTCI
FN547289_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN295520_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEGNCTCI
FN295510_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMLPSCCCSKPSXGNCTCI
EU239220_SHBs_P-E      QGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCTKPSDGNCTCT
DQ412169_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMFPSCCCSKPSDGNCTCI
DQ412159_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412139_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ299402_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAHGTSMFPSCCCSKPSDGNCTCI
AY738922_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY738918_SHBs_P-E      QGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303915_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDANCTCI
AM494738_SHBs_P-E      QGILPVCPLIPGSSTTSTGPCRTCTTLAQGTSMSPSCCCLKPSDGNCTCI
AM494736_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPLDGNCTCI
AB274985_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412140_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB274982_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB194955_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGXSMFPSCCCTKPLDGNCTCI
AB194948_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
AB091257_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB091258_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB091261_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB091263_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB091265_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB201287_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB205192_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB205329_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB274969_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB274971_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB274974_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB274976_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB274977_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB274978_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161836_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547295_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMXPSCCCSKPSDGNCTCI
DQ412172_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN594756_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEGNCTCI
GQ486093_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JX849625_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT623851_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161764_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547282_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ692540_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ692545_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU711663_SHBs_P-E      HGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363576_SHBs_P-E      HGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363565_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSAGNCTCT
GQ161777_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161763_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547260_SHBs_P-E      XGMFPVCPLXPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547281_SHBs_P-E      XGMFPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU711643_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU711639_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMFPSCCCSKPSDGNCTCI
KU711630_SHBs_P-E      QGMLPVCPLIPGSSTTSAGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
KP997699_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMXPSCCCXKPSDGNCTCI
KF170741_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363611_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363597_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAHGTSMFPSCCCSKPSDGNCTCI
HM363595_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363592_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDINCTCI
GQ161786_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161759_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSIFPSCCCSKPSDGNCTCI
FN547300_SHBs_P-E      RGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSEGNCTCI
FN547286_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547278_SHBs_P-E      QGMLPVCPLXPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547276_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMFPSCCCSKPSDGNCTCI
FN547274_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMFPSCCCSKPSDGNCTCI
FN547252_SHBs_P-E      QGMLPVCPLIPGSSTTSTGTCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547246_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547231_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547184_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547182_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ349239_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSTFPSCCCSKPSDGNCTCI
EU239224_SHBs_P-E      RGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCI
EF547857_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412173_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
DQ412150_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412144_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303913_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303912_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303894_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AM494746_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB205326_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB194947_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412149_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412158_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH580633_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMFPSCCCSKPSDGNCTCI
KY498770_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU736894_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSIFPSCCCSKPSDGNCTCI
KU711658_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU711641_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMFPSCCCSKPSDGNCTCI
KU711629_SHBs_P-E      RGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSEGNCTCI
KU711612_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
KU711611_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
KM108622_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF849727_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF849724_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF849716_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF849715_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF849714_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363609_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363608_SHBs_P-E      QGMLPVCPLIPGSSTNRTGPCRTCTTLAQGTSMIPSCCCSKPSDGNCTCI
HM363602_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363588_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363583_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363582_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363577_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363573_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161810_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161808_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161804_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161778_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161770_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN594765_SHBs_P-E      QGMLPACPLTPGSSTTSTGPCRTCTTLAQGTSMCPSCCCSKPSDGNCTCI
FN594750_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLVQGTSMFPSCCCSKPSDGNCTCI
FN547310_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547175_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMLPSCCCXKPSDGNCTCI
FN547163_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547158_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN545821_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSXFPSCCCSKPSDGNCTCI
FN547220_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSXFPSCCCSKPSDGNCTCI
FN295552_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN295551_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN295509_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMIPSCCCLKPSDGNCTCI
FJ692553_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ692552_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ692547_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412174_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412171_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412170_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412164_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLVQGTSMFPSCCCSKPSDGNCTCI
DQ412143_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLXQGTSMFPSCCCSKPSDGNCTCI
DQ299410_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ060825_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ060824_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303893_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303886_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303881_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AM494735_SHBs_P-E      HGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AM494724_SHBs_P-E      QGMLPVCPLIPGSSNTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AM494703_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCI
AM494698_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AM494704_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AM494697_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AM494696_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AM494695_SHBs_P-E      QGMLPVCPLIPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPTDGNCTCI
AF208871_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB915180_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB915177_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSLFPSCCCSKPSDGNCTCI
LT623843_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDGNCTCI
KU711661_SHBs_P-E      QGMLPVCPLIPGSSTTSMGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU711657_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGPSMFPSCCCSKPSDGNCTCI
KU711635_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU711634_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCI
KU711617_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KM983581_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
KF849713_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF771930_SHBs_P-E      QGMLPVCPLIPRSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF170752_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSTYPSCCCLKPSDGNCTCI
JQ000003_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363590_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEGNCTCI
GQ486692_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDGNCTCI
GQ161798_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN594761_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN594760_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547318_SHBs_P-E      QGMLPVCPLLPGSSTTSMGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
FN547248_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547234_SHBs_P-E      QGMLPVCPXIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547233_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547207_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547190_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547160_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547155_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547154_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN295553_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ692543_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ349226_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSIFPSCCCSKPSDGNCTCI
EU239222_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412165_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412163_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412151_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412146_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ412136_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ299420_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ299419_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ299417_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ299416_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ299414_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ299413_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ299412_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ299411_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ299406_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ299405_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ299403_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ060830_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ060822_SHBs_P-E      QGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY739675_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY739674_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY738925_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303930_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303929_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303928_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303925_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
AY303924_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303923_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303922_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AY303921_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303919_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303918_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303917_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303916_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303914_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303911_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303909_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303908_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303907_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303906_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303905_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303903_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303899_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303898_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLVQGTSMFPSCCCSKPSDGNCTCI
AY303892_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303891_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303890_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303888_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303887_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303885_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303884_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303883_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY303878_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AM494753_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AM494751_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AM494747_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGSCTCI
AM494745_SHBs_P-E      QGMLPVCPLIPGSSTTVTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AM494741_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDANCTCI
AM494732_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AM494721_SHBs_P-E      QGMLPVCPLIPGSSTTVTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB274970_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486451_SHBs_P-E      HGMLPVCPXIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JX849619_SHBs_P-E      HGMLPVCPXIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FN547253_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDGNCTCI
FN547256_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ299418_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU711656_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU711640_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU711633_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
KU711632_SHBs_P-E      QGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU711609_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KT192626_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KM983589_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF922439_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF922438_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF849728_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF849726_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF849722_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF849721_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF849719_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF849717_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF771921_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF170781_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KM108625_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC885607_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JX849620_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JQ972819_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JQ000006_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JQ000005_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JQ000004_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JQ000002_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN604192_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN604168_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HQ700552_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HQ700551_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCTKPSDGNCTCI
HQ700550_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363610_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363607_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363605_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363604_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363601_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363600_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363596_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQETSMFPSCCCSKPSDGNCTCI
HM363593_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363591_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363589_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM363587_SHBs_P-E      QGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI