HBVdb

Dataset for protein HBe of genotype F

[Download (right click)] [Edit] [Sequences] [Repertoires]

234 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


AB116550_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPFKEFGASEELLSFLPL
KP995113_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPP
KP995114_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPT
KP995097_HBe_P-F      MQLFDLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPA
KJ638660_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLXGMDIDPYKEFGASLELLSFLPX
KC494399_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JN792916_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLSFLPS
FJ589065_HBe_P-F      MLLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ899150_HBe_P-F      MELFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB365446_HBe_P-F      SQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
X75663_HBe_P-F        MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELFSFLAS
EU185743_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AY090455_HBe_P-F      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
X75658_HBe_C-F        MQLFHLCLIISCLCPTVQASKLCLGWLWGMDIDPYKEFGASVELFSFLPS
KT896494_HBe_P-F      MQLFHLCLIIFCSCLTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLPS
KP995115_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM590474_HBe_P-F      MQLFHLCLIIFCSCPTAQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
FJ657519_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
FJ589067_HBe_P-F      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ899149_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AY254498_HBe_P-F      MQLFHLCLIIFCACPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP995105_HBe_P-F      MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ586805_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JN792919_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPS
HM622135_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPS
DQ899148_HBe_P-F      MQHFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
EU185744_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB036905_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB036906_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB036907_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB036909_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB036910_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB036911_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB036912_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB036913_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB036914_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB036915_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB036916_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB036917_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB036919_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB036920_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB116549_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB116551_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB116552_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AF223962_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AF223963_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AF223964_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AF223965_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AY090458_HBe_C-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AY090461_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AY179735_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AY311369_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AY311370_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ776247_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ823086_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ823088_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ823089_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ823090_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ823091_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ823092_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ823093_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ823094_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ823095_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ899142_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ899143_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ899144_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ899145_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ899146_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ899147_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
EF576812_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
EU366116_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
EU366118_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
EU670261_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
FJ657522_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
FJ657528_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
FJ657529_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
FJ709457_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
FJ709458_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
FJ709459_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
FJ709460_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
FJ709462_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
FJ709463_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
FJ709464_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
FJ709465_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
FJ709494_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HE981181_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HE981182_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM585186_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM585187_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM585188_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM585189_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM585190_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM585191_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM585192_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM585193_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM585195_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM585196_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM585197_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM585198_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM585199_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM585200_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM590471_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM590472_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM590473_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB036908_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AY090459_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP995109_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP995106_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP995104_HBe_P-F      MQLFHLCLIISCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPS
KP995101_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843225_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KC494401_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
DQ823087_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGCLWGMDIDPYKEFGASVELLSFLPS
JQ272888_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JN792920_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
EU366133_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM585194_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPS
KJ843163_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
MH051987_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KY476332_HBe_P-F      MQLFHLCLVIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KY476331_HBe_P-F      MQLFHLCLVIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843210_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843198_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843167_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KC494404_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KC494396_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JN792918_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPS
KP995120_HBe_P-F      MLLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP718106_HBe_P-F      MQLFHLCLIIFCSCPTVQAXKLCLGWLWDMDIDXYKEFGASXELLSFLPS
KC494405_HBe_P-F      MHLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JX079936_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KX757665_HBe_P-F      MQLFXLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP995111_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPI
JX079937_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JN792921_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLPX
X69798_HBe_P-F        MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
MK058437_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
MH051986_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KY476322_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KY458062_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KY458061_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KY382417_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KY382416_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KY382415_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KY382411_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KX264499_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KX264498_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KX264497_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KX264496_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP995126_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP995125_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP995124_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP995123_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP995119_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPT
KP995118_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP995117_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPS
KP995116_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP995110_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP995098_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP718113_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP718112_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP718111_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP718109_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP718104_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KP718103_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KM998715_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KM233681_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843226_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843224_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843223_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843222_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843221_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843220_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843219_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843213_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843212_HBe_P-F      MQLSHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843211_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843209_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843208_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843207_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843206_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843205_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843204_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843203_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843201_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843200_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843197_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843196_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843195_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLSFLPS
KJ843194_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843193_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843191_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843190_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843189_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843185_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843181_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843180_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843179_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843178_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843177_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843176_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843175_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843174_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGGLWGMDIDPYKEFGASVELLSFLPS
KJ843171_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843170_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843169_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843168_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPS
KJ843164_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ638659_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ586808_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ586807_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ586806_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KF199901_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KC494403_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KC494402_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KC494400_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KC494398_HBe_P-F      MQLFHLCLITFVSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KC494397_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KC494395_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KC494394_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JX899376_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPP
JN811656_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JN811655_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JN792922_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JN792914_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPS
JN688703_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JN688699_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ843199_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JN688691_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HQ420166_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HQ420165_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM627320_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HQ378247_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KJ638657_HBe_P-F      MQLFHLCLIIFCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLSFLPS
                           ***:    * *.** ***** *  **** :****** **:***. 

AB116550_HBe_P-F      DFFPNVRDLLDTASALYRDALESSEHCTPHHTALRQAILCWGELMIFAAW
KP995113_HBe_P-F      DFFPSVRDLIDTASALYRDALESPEHCTPNHTAIRQVLLCWNELMTFASW
KP995114_HBe_P-F      DFFPSVRDLLDTASALHRDALESPEHCSPHHTAIRQAVSCWGELITLASW
KP995097_HBe_P-F      DFFPSARDLFDTASALYRDALESPEHCTPHHTALRQAILCWGELTTLASW
KJ638660_HBe_P-F      DFFPSXRDLIDTASALYRDALESPEHCTPNHTALRQAIVCWGEVMTLAAW
KC494399_HBe_P-F      DFYPSVRDLIDTASALYRDALESPEHCSPHHTALRQAVGCWGEVSTLASW
JN792916_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
FJ589065_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ899150_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB365446_HBe_P-F      DFFPNVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLASW
X75663_HBe_P-F        DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
EU185743_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASL
AY090455_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
X75658_HBe_C-F        DFFPSIRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KT896494_HBe_P-F      DFFPSARDLLDTASALYRDALESPEHCTPHHTALRQAILCWVELMTLASW
KP995115_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWDELMIFASW
HM590474_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
FJ657519_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
FJ589067_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ899149_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AY254498_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCSPNHTALRQAILCWGELMTLASW
KP995105_HBe_P-F      DFFPSARDLLDTASALYRQALESPEHCTPHHTALRQAILCWGELMTLASW
KJ586805_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTAFRQAILCWGELMTLASW
JN792919_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMIFASW
HM622135_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ899148_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
EU185744_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB036905_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB036906_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB036907_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB036909_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB036910_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB036911_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB036912_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB036913_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB036914_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB036915_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB036916_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB036917_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB036919_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB036920_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB116549_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB116551_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB116552_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AF223962_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AF223963_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AF223964_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AF223965_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AY090458_HBe_C-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AY090461_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AY179735_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AY311369_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AY311370_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ776247_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ823086_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ823088_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ823089_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ823090_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ823091_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ823092_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ823093_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ823094_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ823095_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ899142_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ899143_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ899144_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ899145_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ899146_HBe_P-F      DFFPSVRDLFDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ899147_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
EF576812_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
EU366116_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
EU366118_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
EU670261_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
FJ657522_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
FJ657528_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
FJ657529_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
FJ709457_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
FJ709458_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
FJ709459_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
FJ709460_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
FJ709462_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
FJ709463_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
FJ709464_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
FJ709465_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
FJ709494_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HE981181_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HE981182_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM585186_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM585187_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM585188_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM585189_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM585190_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM585191_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM585192_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM585193_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM585195_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM585196_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM585197_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM585198_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM585199_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM585200_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM590471_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM590472_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM590473_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB036908_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AY090459_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP995109_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAIVCWGEVMTLASW
KP995106_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP995104_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP995101_HBe_P-F      DFFPSVRDLLDTAAALYRDALESPEHCSPHHTAIRQIILCWGELMSLASW
KJ843225_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KC494401_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
DQ823087_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JQ272888_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPHHTAIRQAILCWGELMVFASW
JN792920_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
EU366133_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM585194_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843163_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
MH051987_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KY476332_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KY476331_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843210_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843198_HBe_P-F      DFFPSVRDLLDTASPLYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843167_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILGWGELMTLASW
KC494404_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KC494396_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLASW
JN792918_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTHHHTALRQAILCWGELMTLASW
KP995120_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP718106_HBe_P-F      DFFPSXRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KC494405_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JX079936_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KX757665_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP995111_HBe_P-F      DFFPSVRDLLDTATALYRDALESPEHCTPHHTALRQTVLCWGELMTLASW
JX079937_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JN792921_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAXLCWGELMTLASW
X69798_HBe_P-F        DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
MK058437_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
MH051986_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KY476322_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KY458062_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KY458061_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KY382417_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KY382416_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KY382415_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KY382411_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KX264499_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KX264498_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KX264497_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KX264496_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP995126_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP995125_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP995124_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP995123_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP995119_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLASW
KP995118_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP995117_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP995116_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP995110_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP995098_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP718113_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP718112_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP718111_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP718109_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP718104_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KP718103_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KM998715_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KM233681_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843226_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843224_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843223_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843222_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843221_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843220_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843219_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843213_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843212_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843211_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843209_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843208_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843207_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843206_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843205_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843204_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843203_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843201_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843200_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843197_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843196_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843195_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWSEVMTLASW
KJ843194_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843193_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843191_HBe_P-F      DFFPSVRDLLDTASALYRDALXSPEHCTPNHTALRQAILCWGELMTLASW
KJ843190_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843189_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843185_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843181_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843180_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843179_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843178_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843177_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843176_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843175_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843174_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843171_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843170_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843169_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843168_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843164_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ638659_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWTEVMTLASW
KJ586808_HBe_P-F      DFFPSVRDLLDTASALYRDALKSPEHCTPNHTALRQAILCWGELMTLASW
KJ586807_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ586806_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KF199901_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KC494403_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KC494402_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KC494400_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KC494398_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KC494397_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KC494395_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KC494394_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JX899376_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JN811656_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JN811655_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JN792922_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JN792914_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JN688703_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JN688699_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ843199_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JN688691_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HQ420166_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HQ420165_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM627320_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQXILCWGELMTLASW
HQ378247_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KJ638657_HBe_P-F      DFFPSVRDLLDTASALYRDALESPEHCTPXHTALRQAILCWGELMTXASW
                      **:*. ***:***:.*:*:** *.***:  ***:**    * *:   *: 

AB116550_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRRLLWFHISCLTFGRQVVLEYLVS
KP995113_HBe_P-F      VGENLDDPAARNSVVNYVNTNMGLKIRQLLWFHISCLTFGTQTVVEYLVS
KP995114_HBe_P-F      VGNNLDDPAARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRQVVLEYLVS
KP995097_HBe_P-F      VGNNLDDAAARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVVQYLVS
KJ638660_HBe_P-F      VGHNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEXLVS
KC494399_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVVEYLVS
JN792916_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHLSCITFGRETVLEYLVS
FJ589065_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ899150_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB365446_HBe_P-F      VGNNLEDPAARDLVVNYVNTHMGLKIRQLLWFHISCLXFGRETVLEYLVS
X75663_HBe_P-F        VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
EU185743_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AY090455_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
X75658_HBe_C-F        VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KT896494_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995115_HBe_P-F      VGNNLDDPASRDLVVNYVNINMGLKIRRLLWFHISCIMFGRDLVLEYLVS
HM590474_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
FJ657519_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
FJ589067_HBe_P-F      VGNNLEDPAARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRDTVLEYLVS
DQ899149_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AY254498_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995105_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVS
KJ586805_HBe_P-F      GGNNLEDPAARDLVVNYVNTNMGLKIRQLLGFHISSLTFGRETVLEYLVF
JN792919_HBe_P-F      VGNNLEDPAARDLVVNYVNINMGLKIRRLLWFHISCLTFGRETVLEYLVS
HM622135_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ899148_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
EU185744_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB036905_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB036906_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB036907_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB036909_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB036910_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB036911_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB036912_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB036913_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB036914_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB036915_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB036916_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB036917_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB036919_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB036920_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB116549_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB116551_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB116552_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AF223962_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AF223963_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AF223964_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AF223965_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AY090458_HBe_C-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AY090461_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AY179735_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AY311369_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AY311370_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ776247_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ823086_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ823088_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ823089_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ823090_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ823091_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ823092_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ823093_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ823094_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ823095_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ899142_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ899143_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ899144_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ899145_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ899146_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ899147_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
EF576812_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
EU366116_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
EU366118_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
EU670261_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
FJ657522_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
FJ657528_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
FJ657529_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
FJ709457_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
FJ709458_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
FJ709459_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
FJ709460_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
FJ709462_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
FJ709463_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
FJ709464_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
FJ709465_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
FJ709494_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HE981181_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HE981182_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM585186_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM585187_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM585188_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM585189_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM585190_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM585191_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM585192_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM585193_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM585195_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM585196_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM585197_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM585198_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM585199_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM585200_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM590471_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM590472_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM590473_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB036908_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AY090459_HBe_P-F      VGNNLEDPADRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995109_HBe_P-F      VGHNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995106_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQMLWFHISCLTFGRETVLEYLVS
KP995104_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995101_HBe_P-F      VGNNLEDPAARDLVVNYVNNNMGLKIRQMLWFHISCLTFGRETVLEYLVS
KJ843225_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KC494401_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
DQ823087_HBe_P-F      VGNNLEDPAARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVS
JQ272888_HBe_P-F      VGNNLQDAAARDLVVDYVNTHMGLKIRHLLWFHLSCLMFGRDTVLEYLVS
JN792920_HBe_P-F      VGNNLEDPGARDLVVNYVNXNMGLKIRQLLWFHISCLTFGRETVLEYLVS
EU366133_HBe_P-F      VGNNLEDPAARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM585194_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843163_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
MH051987_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KY476332_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KY476331_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843210_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843198_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843167_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KC494404_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KC494396_HBe_P-F      VGNNLDDPGARDLVVNYVNTNMGLKVRQLLWFHISCLTFGRETVLEYLVS
JN792918_HBe_P-F      VGNNLDDPAARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995120_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP718106_HBe_P-F      VGXNLEBPAARDLXXNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KC494405_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JX079936_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KX757665_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995111_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JX079937_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JN792921_HBe_P-F      VGNNLEDPXARDLVVNYVNTNMGLKIRQLLWFHISCLTFGREXVLEYLVS
X69798_HBe_P-F        VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
MK058437_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
MH051986_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KY476322_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KY458062_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KY458061_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KY382417_HBe_P-F      VGNNLEDPAARDLXVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KY382416_HBe_P-F      VGNNLEDPAARDLXVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KY382415_HBe_P-F      VGNNLEDPAARDLXVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KY382411_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KX264499_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KX264498_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KX264497_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KX264496_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995126_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995125_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995124_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995123_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995119_HBe_P-F      VGNNLEDPAARDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995118_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995117_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995116_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995110_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP995098_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP718113_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP718112_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP718111_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP718109_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP718104_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KP718103_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KM998715_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KM233681_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843226_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843224_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843223_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843222_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843221_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843220_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843219_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843213_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843212_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843211_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843209_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843208_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843207_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843206_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843205_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843204_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843203_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843201_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843200_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843197_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843196_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843195_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843194_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843193_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843191_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843190_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843189_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843185_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843181_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843180_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843179_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843178_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843177_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843176_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843175_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843174_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843171_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843170_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843169_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843168_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ843164_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ638659_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ586808_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ586807_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ586806_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KF199901_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KC494403_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KC494402_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KC494400_HBe_P-F      VGNNLEDPAARDLVVKYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KC494398_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KC494397_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KC494395_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KC494394_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISSLTFGRETVLEYLVS
JX899376_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JN811656_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JN811655_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JN792922_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JN792914_HBe_P-F      VGNNLEDPAARDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVS
JN688703_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JN688699_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIXQLLWFHISCLTFGRETVLEYLVS
KJ843199_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIXQLLWFHISCLTFGRETVLEYLVS
JN688691_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HQ420166_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HQ420165_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM627320_HBe_P-F      VGNNLDDPAARDLVVNYVNTXMGLKIRQLLWFHISCLTFGREXVLEYLVS
HQ378247_HBe_P-F      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KJ638657_HBe_P-F      VGNNLEDPXARBLVVBYVNXNMGLKIRXLLWFHISCLTFGRETVLEYLVS
                       * **: .  *     ***  ****:  :* **:*.: ** : *:: ** 

AB116550_HBe_P-F      FGVWIRTPPAYRPANAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSP
KP995113_HBe_P-F      FGVWIRTPLPYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995114_HBe_P-F      FGVWIRTPAPYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995097_HBe_P-F      FGVWIRTPPAYRPPNAPILSMLPEVAVVRRRGRSPRRRTPSPRRRRSQSP
KJ638660_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRSRTPSPRRRRSQSP
KC494399_HBe_P-F      FGVWIRTPPAYRPVNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSP
JN792916_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPTPRRRRSQSP
FJ589065_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
DQ899150_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQLP
AB365446_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
X75663_HBe_P-F        FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
EU185743_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRXGRSPRRRTPSPRRQRSQSP
AY090455_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
X75658_HBe_C-F        FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KT896494_HBe_P-F      FGVWIRTPPAYRPQNAPILSTLPETTIVRRRGRSPRRRTPSPRRRRSQSP
KP995115_HBe_P-F      FGVWIRTPPNYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM590474_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
FJ657519_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
FJ589067_HBe_P-F      FGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPGRRTPSPRRRRSQSP
DQ899149_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQWP
AY254498_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995105_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ586805_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
JN792919_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM622135_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPEITVVRRRGRSPRRRTPSPRRRRSQSP
DQ899148_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
EU185744_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRXRSQSP
AB036905_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB036906_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB036907_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB036909_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB036910_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB036911_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB036912_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB036913_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB036914_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB036915_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB036916_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB036917_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB036919_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB036920_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB116549_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB116551_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB116552_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AF223962_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AF223963_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AF223964_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AF223965_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AY090458_HBe_C-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AY090461_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AY179735_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AY311369_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AY311370_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSRRRRRSQSP
DQ776247_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
DQ823086_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
DQ823088_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
DQ823089_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
DQ823090_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
DQ823091_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
DQ823092_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
DQ823093_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
DQ823094_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
DQ823095_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
DQ899142_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
DQ899143_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
DQ899144_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
DQ899145_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
DQ899146_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
DQ899147_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
EF576812_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
EU366116_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
EU366118_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
EU670261_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
FJ657522_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
FJ657528_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
FJ657529_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
FJ709457_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
FJ709458_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
FJ709459_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
FJ709460_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
FJ709462_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
FJ709463_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
FJ709464_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
FJ709465_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
FJ709494_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HE981181_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HE981182_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM585186_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM585187_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM585188_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM585189_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM585190_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM585191_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM585192_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM585193_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM585195_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM585196_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM585197_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM585198_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM585199_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM585200_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM590471_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM590472_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM590473_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AB036908_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
AY090459_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995109_HBe_P-F      FGVWIRTPPVYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995106_HBe_P-F      FGVWIRTPQAYRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSP
KP995104_HBe_P-F      FGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995101_HBe_P-F      FGVWIRTPPPYRPPNAPILSTLPETTVVRGRGRAPRRRTPSPRRRRSQSP
KJ843225_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPEITVVRQRRRSPRRRTPSPRRRRSQSP
KC494401_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRPGRSPRKRTPSPRRRRSQSP
DQ823087_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
JQ272888_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETAVIRRRGRSPRRRTPSPRRRRSQSP
JN792920_HBe_P-F      FGVWIRTPXXYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
EU366133_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM585194_HBe_P-F      FGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843163_HBe_P-F      FGVWIRTPLAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
MH051987_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPGGRRSQSP
KY476332_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KY476331_HBe_P-F      FGVWIRTPPVYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843210_HBe_P-F      FGVWIRTPPAYRRPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843198_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843167_HBe_P-F      LGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KC494404_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KC494396_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSP
JN792918_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995120_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP718106_HBe_P-F      FGVWIXTPPAYXPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KC494405_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
JX079936_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KX757665_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995111_HBe_P-F      FGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
JX079937_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSXRRRTPSPRRRRSQSP
JN792921_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTIIRRRGRSPRRRTPSPRRRRSQSP
X69798_HBe_P-F        FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
MK058437_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
MH051986_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KY476322_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KY458062_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KY458061_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KY382417_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KY382416_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KY382415_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KY382411_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KX264499_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KX264498_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KX264497_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KX264496_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995126_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995125_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995124_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995123_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995119_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRTPRRRTPSPRRRRSQSP
KP995118_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995117_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995116_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995110_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP995098_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP718113_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP718112_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP718111_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP718109_HBe_P-F      FGVWIRTPPAYCPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP718104_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KP718103_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KM998715_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KM233681_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843226_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843224_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843223_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843222_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843221_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843220_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843219_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843213_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843212_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843211_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843209_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843208_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843207_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843206_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843205_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843204_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843203_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843201_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843200_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843197_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843196_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843195_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843194_HBe_P-F      FGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843193_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843191_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRXRRSQSP
KJ843190_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843189_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843185_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843181_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843180_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843179_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843178_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843177_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843176_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843175_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843174_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843171_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843170_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843169_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSP
KJ843168_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ843164_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ638659_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ586808_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ586807_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ586806_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KF199901_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KC494403_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KC494402_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KC494400_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRSSQSP
KC494398_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KC494397_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KC494395_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KC494394_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
JX899376_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
JN811656_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
JN811655_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
JN792922_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
JN792914_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
JN688703_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
JN688699_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPXRRTPSPRRRRSQSP
KJ843199_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
JN688691_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HQ420166_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HQ420165_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HM627320_HBe_P-F      FGVWIRTPPAYRPXNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
HQ378247_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
KJ638657_HBe_P-F      FGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSP
                      :**** **  *   ****** *** :::*   *:   ***:     ** *

AB116550_HBe_P-F      RRRRSQSPASQC
KP995113_HBe_P-F      RRRRSQSPASQC
KP995114_HBe_P-F      RRRRSQSPASQC
KP995097_HBe_P-F      RRRRSQSPASQC
KJ638660_HBe_P-F      RRRRSQSPASQC
KC494399_HBe_P-F      RRRRSQSPASQC
JN792916_HBe_P-F      RRRRSQSPASQC
FJ589065_HBe_P-F      RRKRSQSPASQC
DQ899150_HBe_P-F      RRRRSQSPASQC
AB365446_HBe_P-F      RRRRSQSPASHC
X75663_HBe_P-F        RRRRSQSPASQC
EU185743_HBe_P-F      RRRRSQSPASQC
AY090455_HBe_P-F      RRRRSQSPGSQC
X75658_HBe_C-F        RRRRSQSPASQC
KT896494_HBe_P-F      RRRRSKSPSSQC
KP995115_HBe_P-F      RRRRSQSPSSRC
HM590474_HBe_P-F      RRRRSQSPASQC
FJ657519_HBe_P-F      RRKRSQSPASQC
FJ589067_HBe_P-F      RRRRSQSPASRC
DQ899149_HBe_P-F      RRRRSQSPASQC
AY254498_HBe_P-F      RRRRSQSPASQC
KP995105_HBe_P-F      RRRRSQSPASQC
KJ586805_HBe_P-F      RRRRSQSPASQC
JN792919_HBe_P-F      RRRRSQSPASQC
HM622135_HBe_P-F      RRRRSQSPASQC
DQ899148_HBe_P-F      RRRRSQSPASQC
EU185744_HBe_P-F      RRRRSQSPASQC
AB036905_HBe_P-F      RRRRSQSPASQC
AB036906_HBe_P-F      RRRRSQSPASQC
AB036907_HBe_P-F      RRRRSQSPASQC
AB036909_HBe_P-F      RRRRSQSPASQC
AB036910_HBe_P-F      RRRRSQSPASQC
AB036911_HBe_P-F      RRRRSQSPASQC
AB036912_HBe_P-F      RRRRSQSPASQC
AB036913_HBe_P-F      RRRRSQSPASQC
AB036914_HBe_P-F      RRRRSQSPASQC
AB036915_HBe_P-F      RRRRSQSPASQC
AB036916_HBe_P-F      RRRRSQSPASQC
AB036917_HBe_P-F      RRRRSQSPASQC
AB036919_HBe_P-F      RRRRSQSPASQC
AB036920_HBe_P-F      RRRRSQSPASQC
AB116549_HBe_P-F      RRRRSQSPASQC
AB116551_HBe_P-F      RRRRSQSPASQC
AB116552_HBe_P-F      RRRRSQSPASQC
AF223962_HBe_P-F      RRRRSQSPASQC
AF223963_HBe_P-F      RRRRSQSPASQC
AF223964_HBe_P-F      RRRRSQSPASQC
AF223965_HBe_P-F      RRRRSQSPASQC
AY090458_HBe_C-F      RRRRSQSPASQC
AY090461_HBe_P-F      RRRRSQSPASQC
AY179735_HBe_P-F      RRRRSQSPASQC
AY311369_HBe_P-F      RRRRSQSPASQC
AY311370_HBe_P-F      RRRRSQSPASQC
DQ776247_HBe_P-F      RRRRSQSPASQC
DQ823086_HBe_P-F      RRRRSQSPASQC
DQ823088_HBe_P-F      RRRRSQSPASQC
DQ823089_HBe_P-F      RRRRSQSPASQC
DQ823090_HBe_P-F      RRRRSQSPASQC
DQ823091_HBe_P-F      RRRRSQSPASQC
DQ823092_HBe_P-F      RRRRSQSPASQC
DQ823093_HBe_P-F      RRRRSQSPASQC
DQ823094_HBe_P-F      RRRRSQSPASQC
DQ823095_HBe_P-F      RRRRSQSPASQC
DQ899142_HBe_P-F      RRRRSQSPASQC
DQ899143_HBe_P-F      RRRRSQSPASQC
DQ899144_HBe_P-F      RRRRSQSPASQC
DQ899145_HBe_P-F      RRRRSQSPASQC
DQ899146_HBe_P-F      RRRRSQSPASQC
DQ899147_HBe_P-F      RRRRSQSPASQC
EF576812_HBe_P-F      RRRRSQSPASQC
EU366116_HBe_P-F      RRRRSQSPASQC
EU366118_HBe_P-F      RRRRSQSPASQC
EU670261_HBe_P-F      RRRRSQSPASQC
FJ657522_HBe_P-F      RRRRSQSPASQC
FJ657528_HBe_P-F      RRRRSQSPASQC
FJ657529_HBe_P-F      RRRRSQSPASQC
FJ709457_HBe_P-F      RRRRSQSPASQC
FJ709458_HBe_P-F      RRRRSQSPASQC
FJ709459_HBe_P-F      RRRRSQSPASQC
FJ709460_HBe_P-F      RRRRSQSPASQC
FJ709462_HBe_P-F      RRRRSQSPASQC
FJ709463_HBe_P-F      RRRRSQSPASQC
FJ709464_HBe_P-F      RRRRSQSPASQC
FJ709465_HBe_P-F      RRRRSQSPASQC
FJ709494_HBe_P-F      RRRRSQSPASQC
HE981181_HBe_P-F      RRRRSQSPASQC
HE981182_HBe_P-F      RRRRSQSPASQC
HM585186_HBe_P-F      RRRRSQSPASQC
HM585187_HBe_P-F      RRRRSQSPASQC
HM585188_HBe_P-F      RRRRSQSPASQC
HM585189_HBe_P-F      RRRRSQSPASQC
HM585190_HBe_P-F      RRRRSQSPASQC
HM585191_HBe_P-F      RRRRSQSPASQC
HM585192_HBe_P-F      RRRRSQSPASQC
HM585193_HBe_P-F      RRRRSQSPASQC
HM585195_HBe_P-F      RRRRSQSPASQC
HM585196_HBe_P-F      RRRRSQSPASQC
HM585197_HBe_P-F      RRRRSQSPASQC
HM585198_HBe_P-F      RRRRSQSPASQC
HM585199_HBe_P-F      RRRRSQSPASQC
HM585200_HBe_P-F      RRRRSQSPASQC
HM590471_HBe_P-F      RRRRSQSPASQC
HM590472_HBe_P-F      RRRRSQSPASQC
HM590473_HBe_P-F      RRRRSQSPASQC
AB036908_HBe_P-F      RRRRSQSPASKC
AY090459_HBe_P-F      RRRRSQSPASPC
KP995109_HBe_P-F      RRRRSQSPASQC
KP995106_HBe_P-F      RRRRSQSPASQC
KP995104_HBe_P-F      RRRRSQSPASQC
KP995101_HBe_P-F      RGRRSQSPSSRC
KJ843225_HBe_P-F      RRRRSQSPSSQC
KC494401_HBe_P-F      RRRRSQSPASQC
DQ823087_HBe_P-F      RRRRSQSPASRC
JQ272888_HBe_P-F      RRRRSQSPSSRC
JN792920_HBe_P-F      RRRRSQSPASQC
EU366133_HBe_P-F      RRRRSQSPASQC
HM585194_HBe_P-F      RRRRSQSPASQC
KJ843163_HBe_P-F      RRRRSQSPASQC
MH051987_HBe_P-F      RRRRSQSPASQC
KY476332_HBe_P-F      RRRRSQSPASQC
KY476331_HBe_P-F      RRRRSQSPASQC
KJ843210_HBe_P-F      RRRRSQSPASQC
KJ843198_HBe_P-F      RRRRSQSPASQC
KJ843167_HBe_P-F      RRRRSQSPASQC
KC494404_HBe_P-F      RRKRSQSPASQC
KC494396_HBe_P-F      RRRRSQSPASQC
JN792918_HBe_P-F      RRRRSQSPASQC
KP995120_HBe_P-F      RRRRSQSPASQC
KP718106_HBe_P-F      RRRRSQSPASXC
KC494405_HBe_P-F      RRRRSQSPASQC
JX079936_HBe_P-F      RRRRSQSPPSHC
KX757665_HBe_P-F      RRRRSQSPASQC
KP995111_HBe_P-F      RRRRSQSPASRC
JX079937_HBe_P-F      RRRRSQSPASQC
JN792921_HBe_P-F      RRRRSQSPASRC
X69798_HBe_P-F        RRRRSQSPASQC
MK058437_HBe_P-F      RRRRSQSPASQC
MH051986_HBe_P-F      RRRRSQSPASQC
KY476322_HBe_P-F      RRRRSQSPASQC
KY458062_HBe_P-F      RRRRSQSPASQC
KY458061_HBe_P-F      RRRRSQSPASQC
KY382417_HBe_P-F      RRRRSQSPASQC
KY382416_HBe_P-F      RRRRSQSPASQC
KY382415_HBe_P-F      RRRRSQSPASQC
KY382411_HBe_P-F      RRRRSQSPASQC
KX264499_HBe_P-F      RRRRSQSPASQC
KX264498_HBe_P-F      RRRRSQSPASQC
KX264497_HBe_P-F      RRRRSQSPASQC
KX264496_HBe_P-F      RRRRSQSPASQC
KP995126_HBe_P-F      RRRRSQSPASQC
KP995125_HBe_P-F      RRRRSQSPASQC
KP995124_HBe_P-F      RRRRSQSPASQC
KP995123_HBe_P-F      RRRRSQSPASQC
KP995119_HBe_P-F      RRRRSQSPASQC
KP995118_HBe_P-F      RRRRSQSPASQC
KP995117_HBe_P-F      RRRRSQSPASQC
KP995116_HBe_P-F      RRRRSQSPASQC
KP995110_HBe_P-F      RRRRSQSPASQC
KP995098_HBe_P-F      RRRRSQSPASQC
KP718113_HBe_P-F      RRRRSQSPAPQC
KP718112_HBe_P-F      RRRRSQSPASQC
KP718111_HBe_P-F      RRRRSQSPASQC
KP718109_HBe_P-F      RRRRSQSPASQC
KP718104_HBe_P-F      RRRRSQSPAPQC
KP718103_HBe_P-F      RRRRSQSPASQC
KM998715_HBe_P-F      RRRRSQSPASQC
KM233681_HBe_P-F      RRRRSQSPASQC
KJ843226_HBe_P-F      RRRRSQSPASQC
KJ843224_HBe_P-F      RRRRSQSPASQC
KJ843223_HBe_P-F      RRRRSQSPASQC
KJ843222_HBe_P-F      RRRRSQSPASQC
KJ843221_HBe_P-F      RRRRSQSPASQC
KJ843220_HBe_P-F      RRRRSQSPASQC
KJ843219_HBe_P-F      RRRRSQSPASQC
KJ843213_HBe_P-F      RRRRSQSPASQC
KJ843212_HBe_P-F      RRRRSQSPASQC
KJ843211_HBe_P-F      RRRRSQSPASQC
KJ843209_HBe_P-F      RRRRSQSPASQC
KJ843208_HBe_P-F      RRRRSQSPASQC
KJ843207_HBe_P-F      RRRRSQSPASQC
KJ843206_HBe_P-F      RRRRSQSPASQC
KJ843205_HBe_P-F      RRRRSQSPASQC
KJ843204_HBe_P-F      RRRRSQSPASQC
KJ843203_HBe_P-F      RRRRSQSPASQC
KJ843201_HBe_P-F      RRRRSQSPASQC
KJ843200_HBe_P-F      RRRRSQSPASQC
KJ843197_HBe_P-F      RRRRSQSPASQC
KJ843196_HBe_P-F      RRRRSQSPASQC
KJ843195_HBe_P-F      RRRRSQSPASQC
KJ843194_HBe_P-F      RRRRSQSPASQC
KJ843193_HBe_P-F      RRRRSQSPASQC
KJ843191_HBe_P-F      RRRXSQSPASQC
KJ843190_HBe_P-F      RRRRSQSPASQC
KJ843189_HBe_P-F      RRRRSQSPASQC
KJ843185_HBe_P-F      RRRRSQSPASQC
KJ843181_HBe_P-F      RRRRSQSPASQC
KJ843180_HBe_P-F      RRRRSQSPASQC
KJ843179_HBe_P-F      RRRRSQSPASQC
KJ843178_HBe_P-F      RRRRSQSPASQC
KJ843177_HBe_P-F      RRRRSQSPASQC
KJ843176_HBe_P-F      RRRRSQSPASQC
KJ843175_HBe_P-F      RRRRSQSPASQC
KJ843174_HBe_P-F      RRRRSQSPASQC
KJ843171_HBe_P-F      RRRRSQSPASQC
KJ843170_HBe_P-F      RRRRSQSPASQC
KJ843169_HBe_P-F      RRRRSQSPASQC
KJ843168_HBe_P-F      RRRRSQSPASQC
KJ843164_HBe_P-F      RRRRSQSPASQC
KJ638659_HBe_P-F      RRRRSQSPASQC
KJ586808_HBe_P-F      RRRRSQSPASQC
KJ586807_HBe_P-F      RRRRSQSPASQC
KJ586806_HBe_P-F      RRRRSQSPASQC
KF199901_HBe_P-F      RRRRSQSPASQC
KC494403_HBe_P-F      RRRRSQSPASQC
KC494402_HBe_P-F      RRRRSQSPASQC
KC494400_HBe_P-F      RRRRSQSPASQC
KC494398_HBe_P-F      RRRRSQSPASQC
KC494397_HBe_P-F      RRRRSQSPASQC
KC494395_HBe_P-F      RRRRSQSPASQC
KC494394_HBe_P-F      RRRRSQSPASQC
JX899376_HBe_P-F      RRRRSQSPASQC
JN811656_HBe_P-F      RRRRSQSPASQC
JN811655_HBe_P-F      RRRRSQSPASQC
JN792922_HBe_P-F      RRRRSQSPASQC
JN792914_HBe_P-F      RRRRSQSPASQC
JN688703_HBe_P-F      RRRRSQSPASQC
JN688699_HBe_P-F      RRRRSQSPASQC
KJ843199_HBe_P-F      RRRRSQSPASQC
JN688691_HBe_P-F      RRRRSQSPASQC
HQ420166_HBe_P-F      RRRRSQSPASQC
HQ420165_HBe_P-F      RRRRSQSPASQC
HM627320_HBe_P-F      RRRRSQSPASQC
HQ378247_HBe_P-F      RRRRSQSPASQC
KJ638657_HBe_P-F      RRRRSQSPASQC
                      * . *:** . *

© 1998-2019