HBVdb

Dataset for protein HBx of genotype F

[Download (right click)] [Edit] [Sequences] [Repertoires]

374 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


DQ629946_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAYPPSSPSAVPADDG
JN688720_HBx_P-F      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ638660_HBx_P-F      MAARLCCKLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSPSPVPADDG
AB214516_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
KJ638662_HBx_P-F      MAARLCCKLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSPSPVPADNG
JQ272888_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPANHG
AB166850_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPSSASAVPADHG
AB365446_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
JF911694_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KY476326_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPPSLASAVPADNG
KJ843185_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPSSASAVPADHG
JF911695_HBx_P-F      MGARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSPSAVPSDDG
JF911678_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
DQ823087_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ823089_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EF026746_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EF026748_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EU366132_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JF911692_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JF911696_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGDLPPSSASAVPADHG
KJ843223_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPPGGLPTSSASAVPADHG
EF576812_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLTGPLGALPPSSASAVPANHG
DQ629986_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ776247_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EU366116_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
FJ657519_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
FJ657522_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JF911679_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JF911680_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843207_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843208_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843210_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843213_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
X75658_HBx_C-F        MAARMCCQLDPARDVLCLRPVGAESSGRTLPGPLGALPPSSASAVPADHG
KJ843225_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JQ272900_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
JF911693_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLTPSSPSAVPSDNG
KJ843212_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ676694_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSPSAVPXBDG
MG001259_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
KY382411_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KX264499_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
KJ843226_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
KJ843224_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843222_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843221_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843220_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843219_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843211_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
KJ843209_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
KJ843189_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPSSASAVPADHG
KJ843175_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPFGALPPSSASAVPADHG
KC494398_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPSSASAVPADHG
JX079937_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
JQ272906_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
JN811656_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
JN688709_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADXG
JN811655_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
AB365449_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
AB365450_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
AF223962_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
AF223965_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
DQ629958_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ823086_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
DQ823090_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EF026745_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
EF026749_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
EF576808_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPSSASAVPADHG
FJ657528_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
HE981181_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGSLPPSSASAVPADHG
JN688701_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGGLPPSSASAVPADHG
DQ823088_HBx_P-F      MAARXCCQLDPARDVLCLRPVGAESRGRPLPGPLGAXPPSTASAVPADHG
EF026747_HBx_P-F      MAARXCCQLDPARDVLCLRPVGAESRGRPLPGPLGAXPPSTASAVPADHG
DQ899144_HBx_P-F      MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNG
DQ899146_HBx_P-F      MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNG
DQ899147_HBx_P-F      MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNG
DQ899145_HBx_P-F      MAARVCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADNG
KP995104_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPFFPSTVPADDG
DQ629996_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRPLSRSLGAVPPPLPSATPADDG
DQ629991_HBx_P-F      MAARLCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629941_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVSPHLPSAVPADDG
DQ629937_HBx_P-F      MAARLCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
KC494401_HBx_P-F      MAARLCCKLDPARDVLCLRPLGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494396_HBx_P-F      MAARMCCKLDTARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494394_HBx_P-F      MAARMCCKLDPERDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494399_HBx_P-F      MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KP995120_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494405_HBx_P-F      MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KJ843191_HBx_P-F      MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494395_HBx_P-F      MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494397_HBx_P-F      MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
X69798_HBx_P-F        MAARMCCKLDPARDVLCLRPIGAESRGRPLPGPLGAVPPSSPSAVPADDG
KP995110_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494402_HBx_P-F      MAARMCCKLDPARDVLCLRPLGAESRGRPLPGPLGAVPPSSPSAVPADDG
KC494403_HBx_P-F      MAARMCCKLDPARDVLCLRPLGAESRGRPLPGPLGAVPPSSPSAVPADDG
DQ629995_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629967_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPRPLGAIPPSSPSAVPANDG
DQ629965_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629934_HBx_P-F      MAARMCCQLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629956_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPPSPSAVPANDG
AY090455_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPADDG
DQ629933_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629940_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629950_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629953_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629954_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPANDG
DQ629997_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAIPPSSPSAVPADDG
AY311369_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSTVQAYDG
KX264497_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
DQ899142_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
DQ899143_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
DQ629936_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRPLRGPLGAIPPSSPSAVPANDG
DQ629985_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629930_HBx_P-F      MAARLCCQLGPPRDGLYLHPVGADSRGRSLSGSLGVVPHPSQSAVPADDG
KP995107_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
KP995114_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPPGAVPPSSPSAVPADDG
KP995115_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPIGAVPPSSPSAVPADDG
KP995113_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGDVPPSSPSAVPADDG
KP995105_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995097_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGSLGAVPPSSPSAVPADDG
DQ629947_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
KJ638664_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPPDDG
DQ629993_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
KP995101_HBx_P-F      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP718107_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSSSAVPADDG
KJ843196_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843199_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843195_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843163_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272894_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAISPPSPSAVPADDG
JF911673_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
HM622135_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ629944_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRFLSGSLGVVPPPSPSAVPADDG
DQ629935_HBx_P-F      MAARLCCQMDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
AB116552_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
AF223964_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
AY179735_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ823092_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ823093_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ823094_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ823095_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
EF026751_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
EF026752_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
EF026753_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
EF026754_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
EU366118_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ657529_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ709457_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESCGRSLSGSLGAVSPPSPSAVPADDG
FJ709458_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
FJ709459_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
FJ709460_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ709462_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ709463_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ709464_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ709465_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
FJ709494_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HE981182_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HE981183_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585187_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585188_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585189_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585190_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585191_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585192_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585193_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585195_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585196_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM585197_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585198_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSTVPADDG
HM585199_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HM590473_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
HQ378247_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JF911674_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JF911675_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JF911676_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JF911677_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN688691_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDG
JN688699_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDG
JN688703_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDG
JQ272889_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272890_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272891_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272893_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272895_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272898_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
JQ272899_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272901_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
JQ272904_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
JQ272905_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
JQ272907_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
JQ272908_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
JQ272909_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272910_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272913_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JQ272914_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KC494400_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KC494404_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ586805_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ586806_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ586807_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ586808_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843167_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843171_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGTVSPPSPSTVPADDG
KJ843174_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843176_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
KJ843179_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843180_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843190_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843197_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843198_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843200_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843201_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843203_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843206_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KM998715_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KP995116_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
KX264496_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY382415_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY458061_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY458062_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESCGRSLSGSLGAVSPPSPSAVPANDG
MF593354_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593367_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MK058437_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
KT896494_HBx_P-F      MAARMCCKLDPARDVLCLRPVGAESRGRPLPGPLGAVPPSSPSAVPADDG
FJ589065_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSFGAVSPPSPSAVPANDG
AB064316_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
AF223963_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ823091_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
EF026750_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
EU366133_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843164_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPANDG
KJ843168_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843169_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843170_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843181_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843193_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KJ843194_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843204_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY382416_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593356_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593360_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593376_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MF593380_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KP995118_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLQGSLGAVPPPSSSAVPADNG
KP995098_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDG
KP718110_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KM233681_HBx_P-F      MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
KJ843202_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792920_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585200_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDG
FJ657525_HBx_P-F      MAARLRCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
FJ589067_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
EU670261_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
EF397982_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
DQ899148_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSPGAVPPPSSSAVPADHG
DQ629989_HBx_P-F      MAARLCFQLDPTRDVLCLRPVGAKSRGRSLSGSLGAVPPPSPSAVPADDG
DQ629978_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629960_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSSSAVPADDG
DQ629959_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGVVPPPSPSAVPADDG
DQ629943_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629932_HBx_P-F      MAAGMCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
AB036910_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADHG
MH051986_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
MH051987_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
KJ843205_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY382417_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
MG001258_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585194_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDG
HM627320_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLRAVSPPSPSAVPADDG
DQ629951_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629955_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629981_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629994_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
AB116654_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPSSPSAVPADDG
DQ629977_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629988_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVPPPSTSAVPADDG
AB116551_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
DQ899149_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
KP718109_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
KP718112_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
AB036914_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036915_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036916_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036917_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036918_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036919_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAIPPPSSSAVPADDG
AB036911_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGALPPPSSSAVPADDG
AB036920_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGALPPPSSSAVPADDG
KP718103_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPPSSSAVPADDG
KJ638663_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
AB036905_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036906_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036907_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036908_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036909_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036912_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB036913_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
AB116549_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
AB116550_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
AY311370_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSPGAVPPPSSSAVPADDG
DQ899150_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
AB086397_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
AY090456_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629962_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629968_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629972_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPANDG
DQ629974_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629979_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629990_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629992_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
EU670260_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792914_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792916_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792917_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792918_HBx_P-F      MAARLCCQLDPTRDVLCLRPVRAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792919_HBx_P-F      MAARLCCQLDPTRDVLCLRTVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JN792922_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
JX079936_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ638656_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ638657_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPABDG
KY476324_HBx_P-F      MAARLYCQLDPTRDVLCLRPVGAESCGRSLSGSLGAVSPPSPSAVPADDG
KY476325_HBx_P-F      MAARLCCQLDPTRDVVCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY476327_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY476328_HBx_P-F      MAARLCCQLDPTRDVVCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY476330_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KY476331_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
X75663_HBx_P-F        MAARLCCQLDPARDVLCLRPVGAESSGRTLPGSLGAVPPPSSSAVPADNG
KY476329_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
DQ629938_HBx_P-F      MAARLRCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
AY090458_HBx_C-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPANDG
AY090459_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
AY090461_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPANDG
DQ629931_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629945_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629948_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629949_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629961_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629963_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629964_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629966_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629969_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629971_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAKSRGRSLSGSLGAVPPPSPSAVPADDG
DQ629973_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVPPPSPSAVPADDG
DQ629987_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGVVPPPSPSAVPADDG
EU670262_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
HM585186_HBx_P-F      MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
HM590471_HBx_P-F      MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
HM590472_HBx_P-F      MAARLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
HM590474_HBx_P-F      MAAWLCCQLDPARDVLCLRPVSAESCGRSLSGSLGAVSPPSPSAVPADDG
JQ272892_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843177_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KJ843178_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KP718104_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KP718113_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KP995126_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLQGSPGAVPPPSSSAVPADDG
KP995109_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADNG
MF593371_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRPLSGSLGAVSPPSPSAVPADDG
KY476332_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KY476323_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESSGRSLSGSLGAVSPPSPSAVPADDG
KY476322_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRSLSGSLGAVSPPSPSAVPADDG
KP995111_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995106_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KX264498_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGAVPPPSSSAVPADDG
KP995125_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995124_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSPGAVPPPSSSAVPADDG
KP995123_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP995119_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVSPPSSSAVPADDG
KM659861_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
FJ589066_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KJ638659_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KX757665_HBx_P-F      MAARLCCQLDPTRDVLCLRPVGAESRGRPLSGSFGAVSPPSPSAVPANDG
KP995117_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
KP718106_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGAVPPPSSSAVPADDG
KP718111_HBx_P-F      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGAVPPPSSSAVPADDG
                      *.*    ::.. ** : *..: *.* ** :  .    .    *..    *

DQ629946_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTLSPPRGLPTVFHKRTLGL
JN688720_HBx_P-F      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KJ638660_HBx_P-F      SHLSFRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTALHKRTLGL
AB214516_HBx_P-F      SHLSLRGLACCSFSCAASCALRFTSARRMETTVNARQILPKVLHKRTLGL
KJ638662_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
JQ272888_HBx_P-F      SHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQFLPKVLHKRTLGL
AB166850_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPIVLHNRTIGL
AB365446_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRLETTVNAPWSLPIVLHKRTIGL
JF911694_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
KY476326_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
KJ843185_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
JF911695_HBx_P-F      SHLSLRGLPICAFSPAGPCALRFTSARRMETTVNAHWSLPTVLHKRTLGL
JF911678_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
DQ823087_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
DQ823089_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTXGL
EF026746_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
EF026748_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTXGL
EU366132_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
JF911692_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTALYKRTIGL
JF911696_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLYKRTIGL
KJ843223_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHNRTIGL
EF576812_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
DQ629986_HBx_P-F      SHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPWSLPKVLHKRTVGL
DQ776247_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
EU366116_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
FJ657519_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
FJ657522_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
JF911679_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
JF911680_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
KJ843207_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KJ843208_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KJ843210_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KJ843213_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
X75658_HBx_C-F        SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
KJ843225_HBx_P-F      SHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPWCLPTVLYNRTIGL
JQ272900_HBx_P-F      SYLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHWSLPTVLHKRTIGL
JF911693_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KJ843212_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KJ676694_HBx_P-F      SHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHXSLPTVLHKRTLGL
MG001259_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
KY382411_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
KX264499_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
KJ843226_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
KJ843224_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
KJ843222_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
KJ843221_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
KJ843220_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
KJ843219_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
KJ843211_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KJ843209_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KJ843189_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KJ843175_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
KC494398_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
JX079937_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
JQ272906_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
JN811656_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
JN688709_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
JN811655_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
AB365449_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
AB365450_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTXLHKRTIGL
AF223962_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
AF223965_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
DQ629958_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTVGL
DQ823086_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
DQ823090_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
EF026745_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
EF026749_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
EF576808_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
FJ657528_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
HE981181_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTIGL
JN688701_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTTGL
DQ823088_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTXGL
EF026747_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTXGL
DQ899144_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
DQ899146_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
DQ899147_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
DQ899145_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPLSLPTVLHKRTLGL
KP995104_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTALHKRTLGL
DQ629996_HBx_P-F      SHLSLRGLPVFSFSSALPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629991_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629941_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRSLGL
DQ629937_HBx_P-F      SHLYLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KC494401_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KC494396_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTALHKRTLGL
KC494394_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KC494399_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAXWSLPTALHKRTLGL
KP995120_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KC494405_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KJ843191_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGF
KC494395_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KC494397_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTALHKRTLGL
X69798_HBx_P-F        SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KP995110_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTALHKRTLGL
KC494402_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KC494403_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
DQ629995_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
DQ629967_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
DQ629965_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
DQ629934_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPGSLPTVLHKRTLGL
DQ629956_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPGSLPTVLHKRTLGL
AY090455_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTALHKRTLGL
DQ629933_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
DQ629940_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
DQ629950_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
DQ629953_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
DQ629954_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
DQ629997_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
AY311369_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KX264497_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
DQ899142_HBx_P-F      SHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
DQ899143_HBx_P-F      SHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
DQ629936_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
DQ629985_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTANAPRSLPTVLHKRTLGL
DQ629930_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KP995107_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTALYKRTLGL
KP995114_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTALHKRTLGL
KP995115_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTALHKRTLGL
KP995113_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTALHKRTLGL
KP995105_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRLETTVNTPWNLPTVLHKRTLGL
KP995097_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTALYKRTLGL
DQ629947_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRLTSARRMETTVNAPRSLPTVLHQRTLGL
KJ638664_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629993_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRYTSARRMETTVNAPRSLPTVLHKRTLGL
KP995101_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARHMETTVNAPWNLPTVLHKRTLGL
KP718107_HBx_P-F      SHLSLRGLPVCSFSPAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843196_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNTPRSLPTVLHKRTLGL
KJ843199_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNTPRSLPTVLHKRTLGL
KJ843195_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843163_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JQ272894_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JF911673_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARSMETPVNAPRSLPTVLHKRTLGL
HM622135_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629944_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629935_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
AB116552_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
AF223964_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
AY179735_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ823092_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ823093_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ823094_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ823095_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
EF026751_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
EF026752_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
EF026753_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
EF026754_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
EU366118_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
FJ657529_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
FJ709457_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
FJ709458_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
FJ709459_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
FJ709460_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
FJ709462_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
FJ709463_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
FJ709464_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
FJ709465_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
FJ709494_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HE981182_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HE981183_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM585187_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM585188_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM585189_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM585190_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM585191_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM585192_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM585193_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM585195_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM585196_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM585197_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM585198_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM585199_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM590473_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HQ378247_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JF911674_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JF911675_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JF911676_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JF911677_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JN688691_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JN688699_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JN688703_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JQ272889_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JQ272890_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFPSARRMETTVNAPRSLPTVLHKRTLGL
JQ272891_HBx_P-F      SHLSLRGLPVCSFSSAGPCALLFISARRMETTVNAPRSLPTVLHKRTLGL
JQ272893_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JQ272895_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JQ272898_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JQ272899_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JQ272901_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JQ272904_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JQ272905_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JQ272907_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JQ272908_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JQ272909_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JQ272910_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JQ272913_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JQ272914_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KC494400_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KC494404_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ586805_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ586806_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ586807_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ586808_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843167_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843171_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843174_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843176_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843179_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843180_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843190_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843197_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843198_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843200_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843201_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843203_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843206_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KM998715_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KP995116_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KX264496_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KY382415_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KY458061_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KY458062_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
MF593354_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTALHKRTLGL
MF593367_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
MK058437_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KT896494_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
FJ589065_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
AB064316_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
AF223963_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ823091_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
EF026750_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
EU366133_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843164_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843168_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843169_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLYKRTLGL
KJ843170_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843181_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843193_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843194_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843204_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KY382416_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
MF593356_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLYKRTLGL
MF593360_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLYKRTLGL
MF593376_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
MF593380_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KP995118_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNMPTVLYKRTLGL
KP995098_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KP718110_HBx_P-F      SHLSLRGLPVCSYSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KM233681_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843202_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JN792920_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM585200_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
FJ657525_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
FJ589067_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARHMETTVNAPWNLPTVLHKRTLGL
EU670261_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
EF397982_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
DQ899148_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
DQ629989_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629978_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629960_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMEATVNAPRSLPTVLHKRTIGL
DQ629959_HBx_P-F      SHLSLRGLPVCSFSSAGPCALHFTSVGPLGTTVNAPRSLPTVLHKRTLGL
DQ629943_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629932_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
AB036910_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
MH051986_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTMNAPWSLPTVLHKRTLGL
MH051987_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTMNAPWSLPTVLHKRTLGL
KJ843205_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KY382417_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
MG001258_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM585194_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM627320_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629951_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629955_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629981_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629994_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
AB116654_HBx_P-F      SYLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629977_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629988_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
AB116551_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
DQ899149_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
KP718109_HBx_P-F      SYLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
KP718112_HBx_P-F      SYLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB036914_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB036915_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB036916_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB036917_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB036918_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB036919_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB036911_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB036920_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
KP718103_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
KJ638663_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARHMETTVNAPRSLPTVLYKRTLGL
AB036905_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB036906_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB036907_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB036908_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB036909_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB036912_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB036913_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB116549_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB116550_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AY311370_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
DQ899150_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
AB086397_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
AY090456_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629962_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629968_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629972_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629974_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629979_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629990_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629992_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
EU670260_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JN792914_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTILHKRTLGL
JN792916_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JN792917_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JN792918_HBx_P-F      SHLSLRGLPVCSFSSAGPCALLFTSARLMETTVNAPRSLPTVLHKRTLGL
JN792919_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JN792922_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
JX079936_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ638656_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ638657_HBx_P-F      SPLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KY476324_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KY476325_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KY476327_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KY476328_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KY476330_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARHMETTVNAPRSLPTVLYKRTLGL
KY476331_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
X75663_HBx_P-F        SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWSLPTVLHKRTLGL
KY476329_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLYKRTLGL
DQ629938_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
AY090458_HBx_C-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
AY090459_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
AY090461_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629931_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629945_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKGTLGL
DQ629948_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629949_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629961_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629963_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629964_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629966_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629969_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629971_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629973_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
DQ629987_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
EU670262_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM585186_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM590471_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM590472_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
HM590474_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTALHKRTLGL
JQ272892_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843177_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KJ843178_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KP718104_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KP718113_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KP995126_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
KP995109_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
MF593371_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KY476332_HBx_P-F      SHLSLRGLPVCSFTSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTIGL
KY476323_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KY476322_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTIGL
KP995111_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
KP995106_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARHMETTVNAPWNLPTVLHKRTLGL
KX264498_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
KP995125_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
KP995124_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
KP995123_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARPMETTVNAPWNLPTVLHKRTLGL
KP995119_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
KM659861_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
FJ589066_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
KJ638659_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
KX757665_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPRSLPTVLHKRTLGL
KP995117_HBx_P-F      SHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
KP718106_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
KP718111_HBx_P-F      SHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAPWNLPTVLHKRTLGL
                      : * :***.  ::: * .***   *.  : :. ..   :*  ::: : *:

DQ629946_HBx_P-F      SGWSMPWIEEYIKDCVLRTWEELGEEIRVKVFVLGGCRHKLVCSPAPCNF
JN688720_HBx_P-F      SGRFMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ638660_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPCNF
AB214516_HBx_P-F      SAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ638662_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEESGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272888_HBx_P-F      SVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB166850_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEETRLMIYVLGGCRHKLVCSPAPCNF
AB365446_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPVNF
JF911694_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEESRLKVFVLGGCRHKLVCSPAPCIF
KY476326_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843185_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRAKVFVLGGCRHKKVCSPAPCNF
JF911695_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPCNF
JF911678_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVLLLRGCRHKLVCSPAPCNF
DQ823087_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPVPCNF
DQ823089_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
EF026746_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPVPCNF
EF026748_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
EU366132_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
JF911692_HBx_P-F      SGRSMTWIEEYIKDCVFTDWEELGEESRLMIFVLGGCRHKLVCSPAPCNF
JF911696_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNF
KJ843223_HBx_P-F      SGRSMTWIEEYIKDCVFXDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
EF576812_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629986_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ776247_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNF
EU366116_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNF
FJ657519_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNF
FJ657522_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNF
JF911679_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNF
JF911680_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNF
KJ843207_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNF
KJ843208_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNF
KJ843210_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNF
KJ843213_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNF
X75658_HBx_C-F        SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KJ843225_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272900_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCTF
JF911693_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843212_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ676694_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVXXPVPCNF
MG001259_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KY382411_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KX264499_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843226_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843224_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843222_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843221_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843220_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVXGGCRHKLVCSPAPCNF
KJ843219_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843211_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843209_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843189_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843175_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KC494398_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JX079937_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272906_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JN811656_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JN688709_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEXIRLKVFVLGGCXHKLVCAPAPCNF
JN811655_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB365449_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB365450_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AF223962_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AF223965_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629958_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ823086_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ823090_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
EF026745_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
EF026749_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
EF576808_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
FJ657528_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HE981181_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JN688701_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ823088_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
EF026747_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ899144_HBx_P-F      SGGSMTWIAEYIKDCVFKDWEELGEETKLKVFVLGGCRHKLVCSPAPCNF
DQ899146_HBx_P-F      SGGSMTWIAEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNF
DQ899147_HBx_P-F      SGGSMTWIAEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNF
DQ899145_HBx_P-F      SGGSMTWIEEYIKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPCNF
KP995104_HBx_P-F      SGWSMTRIDEYIKDCVFKDWEELGQESRLMVYVLGGCRHKLVCSPAPCNF
DQ629996_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEAMGEEIRLKVFVLGSCRHKLVCSPAPCNF
DQ629991_HBx_P-F      SGWSMPWIEEYIKDCVFTDWEELGEEIRFKILVLGGCRHKLVCSPAPCNF
DQ629941_HBx_P-F      SGWSMPWIEDYIKDCVFKDWEEVGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629937_HBx_P-F      SGWSMPWIEEYIKDCVFKNWEELGEEIRLKVFVLGGCRHKMVCSPAPCNF
KC494401_HBx_P-F      SGWSMTWIEEYIKDCVFKDWEELGEEIRLKVFLLRGCRHKLVCSPAPCNF
KC494396_HBx_P-F      SGWSMTWIEEYIKDCVFKDWEELGEESRLMVYVLGGCRHKLVCSPAPCNF
KC494394_HBx_P-F      SGWSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSTAPCNF
KC494399_HBx_P-F      SGWSMTWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNF
KP995120_HBx_P-F      SGGSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCYF
KC494405_HBx_P-F      SGWSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCQPAPCTF
KJ843191_HBx_P-F      SGRSQTWIEEYIKDCVFKDWEELGXEIRLKVFVLGGCRXKLVCSPAPCNF
KC494395_HBx_P-F      SGWSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KC494397_HBx_P-F      SGWSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
X69798_HBx_P-F        SGWSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KP995110_HBx_P-F      SGWSMTWIEEYIKDCVFTDWEELGEETRLMVYVLGGCRHKLVCSPAPCNF
KC494402_HBx_P-F      SGWSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KC494403_HBx_P-F      SGWSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629995_HBx_P-F      SGWSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
DQ629967_HBx_P-F      SGWSMPWIEEYIKDCVFKDWEELGEEIRFKVFVLGGCRHKLVCSPAPCNF
DQ629965_HBx_P-F      SGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGSCRHKLVCSTAPCNF
DQ629934_HBx_P-F      SGWSMPWIEEYIKDCVFKDWEELGEEIRLQVFVLGGCRHKLVCSPAPCNF
DQ629956_HBx_P-F      SGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AY090455_HBx_P-F      SGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629933_HBx_P-F      SGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629940_HBx_P-F      SGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629950_HBx_P-F      SGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629953_HBx_P-F      SGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629954_HBx_P-F      SGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPTPCNF
DQ629997_HBx_P-F      SGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AY311369_HBx_P-F      SGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KX264497_HBx_P-F      SGWSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ899142_HBx_P-F      SGRSMTWIEEYIKDCVFKDWKELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ899143_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629936_HBx_P-F      SGWSMPWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629985_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEITLKIIDLGGCMDKLVCSPAPCNF
DQ629930_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCKHKLVCSPAPCNF
KP995107_HBx_P-F      SGGSMPWIEDYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNF
KP995114_HBx_P-F      SGGSMPWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNF
KP995115_HBx_P-F      SGGSMPWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNF
KP995113_HBx_P-F      SGGSMPWIEEYIKDCVFKDWEESGEETRLMIFVLGGCRHKLVCSPAPCNF
KP995105_HBx_P-F      SGRSMTRIEEYIKDCVFKDWEELGEEIRLMIFGLGGWRHKLVCSPAPCNF
KP995097_HBx_P-F      SGGSMPWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNF
DQ629947_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCWHKLGCSPPPCNF
KJ638664_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPCNF
DQ629993_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKWVCSPAPCNF
KP995101_HBx_P-F      LGRSMTWIEDYIKDCVFKDWEELGEETRLKIFVLGGCRHKLVCSPAPCNF
KP718107_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KJ843196_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843199_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843195_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEFRLKVFVLGGCRHKLVCSPAPCNF
KJ843163_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPASCNF
JQ272894_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JF911673_HBx_P-F      SGRSITWIEEYIKDCVFKDWEEVGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM622135_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKAYVLGGCRHKLVCSPAPCNF
DQ629944_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLLGCRHKLVCSPPPCNF
DQ629935_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB116552_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AF223964_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AY179735_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ823092_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ823093_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ823094_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ823095_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
EF026751_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
EF026752_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
EF026753_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
EF026754_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
EU366118_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
FJ657529_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
FJ709457_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
FJ709458_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
FJ709459_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
FJ709460_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
FJ709462_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
FJ709463_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
FJ709464_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
FJ709465_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
FJ709494_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HE981182_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HE981183_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM585187_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM585188_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM585189_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM585190_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM585191_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM585192_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM585193_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM585195_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM585196_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM585197_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM585198_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM585199_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM590473_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HQ378247_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JF911674_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JF911675_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JF911676_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCKHKLGCSPTPCNF
JF911677_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JN688691_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JN688699_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCXHKLVCSPAPCNF
JN688703_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272889_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272890_HBx_P-F      SGRSIAWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272891_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272893_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272895_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIGLKVFVLGGCRHKLVCSPAPCNF
JQ272898_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272899_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272901_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272904_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272905_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272907_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272908_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272909_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272910_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272913_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272914_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KC494400_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KC494404_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ586805_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ586806_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ586807_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ586808_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843167_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843171_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843174_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843176_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843179_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843180_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843190_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843197_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843198_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843200_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843201_HBx_P-F      SGRVITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843203_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843206_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KM998715_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KP995116_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KX264496_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KY382415_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KY458061_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KY458062_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
MF593354_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPXPCNF
MF593367_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
MK058437_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KT896494_HBx_P-F      SGWSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
FJ589065_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAACFF
AB064316_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
AF223963_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
DQ823091_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
EF026750_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
EU366133_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KJ843164_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KJ843168_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KJ843169_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KJ843170_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KJ843181_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPCNF
KJ843193_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KJ843194_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KJ843204_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KY382416_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
MF593356_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
MF593360_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPXPCNF
MF593376_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
MF593380_HBx_P-F      SGRSITWIEXYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KP995118_HBx_P-F      SGRSMTWIEEYIKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KP995098_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KP718110_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKIYVIGGCRHKLVCSPAPCNF
KM233681_HBx_P-F      SGRSMTWIKEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843202_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEENRLMIFVLGGCRHKLVCSPAPCNF
JN792920_HBx_P-F      SGRSLTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
HM585200_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
FJ657525_HBx_P-F      AGRSMTWIEEYIKDCVFADWEELGEETRLMIFVLGGCRHKLVCSPAPCNF
FJ589067_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEETRLMIYVLGGCRHKLVCSPAPCNF
EU670261_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMTFVLGGCRHKLVCSPAPCNF
EF397982_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRYKLVCSPAPCNF
DQ899148_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEMRLKVFVLGGCRHKLVCSPAPCNI
DQ629989_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
DQ629978_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEENRLMIYVLGGCRHKLVCSPAPCNF
DQ629960_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
DQ629959_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629943_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEDIRLKVFVLGGCRHKLVCSPAPCHL
DQ629932_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLNIFVLGGCRHKLVCSPAPCNF
AB036910_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
MH051986_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
MH051987_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843205_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNF
KY382417_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNF
MG001258_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNF
HM585194_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
HM627320_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
DQ629951_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLNVFLLGGCRHKLVCSPVPCNF
DQ629955_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLNVFLLGGCRHKLVCSPVPCNF
DQ629981_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVKLLGGCRHKLVCSPAPCNF
DQ629994_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLNVFLLGGCRHKLVCSPVPCNF
AB116654_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNF
DQ629977_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNF
DQ629988_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNF
AB116551_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ899149_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KP718109_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KP718112_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEITLKVFVLGGCRHKLVCAPAPCNF
AB036914_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB036915_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB036916_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB036917_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB036918_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB036919_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB036911_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB036920_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KP718103_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ638663_HBx_P-F      SGRSMTWIEGYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVRSPAPCNF
AB036905_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB036906_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB036907_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB036908_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB036909_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB036912_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB036913_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB116549_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AB116550_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AY311370_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ899150_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPTPWNF
AB086397_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
AY090456_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
DQ629962_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
DQ629968_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLMISVLGGCRHKLVCSPAPCNF
DQ629972_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
DQ629974_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
DQ629979_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
DQ629990_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
DQ629992_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
EU670260_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
JN792914_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
JN792916_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
JN792917_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
JN792918_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
JN792919_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
JN792922_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
JX079936_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KJ638656_HBx_P-F      SGRSMTWIEEYFKDCVFNDWEELGEEIWLKIYVLGGCRHKLVCSPAPCNF
KJ638657_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCPPAPCNF
KY476324_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KY476325_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KY476327_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KY476328_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KY476330_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KY476331_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
X75663_HBx_P-F        SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KY476329_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVGSPAPCNF
DQ629938_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AY090458_HBx_C-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
AY090459_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCKHKLVCSPAPCNF
AY090461_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629931_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629945_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629948_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629949_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLTVFVLGGCRHKLVCSPAPCNF
DQ629961_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629963_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629964_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629966_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629969_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629971_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
DQ629973_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCMHMLACSPEPCNF
DQ629987_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
EU670262_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM585186_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM590471_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM590472_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
HM590474_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
JQ272892_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843177_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KJ843178_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KP718104_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KP718113_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KP995126_HBx_P-F      SGRSMTWIEEYIKDCVFKEWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KP995109_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
MF593371_HBx_P-F      SGRSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KY476332_HBx_P-F      SGRSMTWIEGYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KY476323_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KY476322_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KP995111_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPCNF
KP995106_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEETRLMTFVLGGCRHKLVCSPAPCNF
KX264498_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KP995125_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KP995124_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KP995123_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KP995119_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KM659861_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
FJ589066_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSXXXXXF
KJ638659_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KX757665_HBx_P-F      SGRSMTWIEDYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPCNF
KP995117_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
KP718106_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLXXFVLGGCRXKLVCSPAPCNF
KP718111_HBx_P-F      SGRSMTWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
                           . :  *:***::  *:  *           .             :

DQ629946_HBx_P-F      FTSA
JN688720_HBx_P-F      FTSA
KJ638660_HBx_P-F      FTSA
AB214516_HBx_P-F      FTSA
KJ638662_HBx_P-F      FTSA
JQ272888_HBx_P-F      FTSA
AB166850_HBx_P-F      FTSA
AB365446_HBx_P-F      FTSA
JF911694_HBx_P-F      FTSA
KY476326_HBx_P-F      FTSA
KJ843185_HBx_P-F      FTSA
JF911695_HBx_P-F      FTSA
JF911678_HBx_P-F      FTSA
DQ823087_HBx_P-F      FTSA
DQ823089_HBx_P-F      FTSA
EF026746_HBx_P-F      FTSA
EF026748_HBx_P-F      FTSA
EU366132_HBx_P-F      FTSA
JF911692_HBx_P-F      FTSA
JF911696_HBx_P-F      FTSA
KJ843223_HBx_P-F      FTSA
EF576812_HBx_P-F      FTSA
DQ629986_HBx_P-F      FTSA
DQ776247_HBx_P-F      FTSA
EU366116_HBx_P-F      FTSA
FJ657519_HBx_P-F      FTSA
FJ657522_HBx_P-F      FTSA
JF911679_HBx_P-F      FTSA
JF911680_HBx_P-F      FTSA
KJ843207_HBx_P-F      FTSA
KJ843208_HBx_P-F      FTSA
KJ843210_HBx_P-F      FTSA
KJ843213_HBx_P-F      FTSA
X75658_HBx_C-F        FTSA
KJ843225_HBx_P-F      FTSA
JQ272900_HBx_P-F      FTSA
JF911693_HBx_P-F      FTSA
KJ843212_HBx_P-F      LTSA
KJ676694_HBx_P-F      FTSA
MG001259_HBx_P-F      FSSA
KY382411_HBx_P-F      FTSA
KX264499_HBx_P-F      FTSA
KJ843226_HBx_P-F      FTSA
KJ843224_HBx_P-F      FTSA
KJ843222_HBx_P-F      FTSA
KJ843221_HBx_P-F      FTSA
KJ843220_HBx_P-F      FTSA
KJ843219_HBx_P-F      FTSA
KJ843211_HBx_P-F      FTSA
KJ843209_HBx_P-F      FTSA
KJ843189_HBx_P-F      FTSA
KJ843175_HBx_P-F      FTSA
KC494398_HBx_P-F      FTSA
JX079937_HBx_P-F      FTSA
JQ272906_HBx_P-F      FTSA
JN811656_HBx_P-F      FTSA
JN688709_HBx_P-F      FTSA
JN811655_HBx_P-F      FTSA
AB365449_HBx_P-F      FTSA
AB365450_HBx_P-F      FTSA
AF223962_HBx_P-F      FTSA
AF223965_HBx_P-F      FTSA
DQ629958_HBx_P-F      FTSA
DQ823086_HBx_P-F      FTSA
DQ823090_HBx_P-F      FTSA
EF026745_HBx_P-F      FTSA
EF026749_HBx_P-F      FTSA
EF576808_HBx_P-F      FTSA
FJ657528_HBx_P-F      FTSA
HE981181_HBx_P-F      FTSA
JN688701_HBx_P-F      FTSA
DQ823088_HBx_P-F      FTSA
EF026747_HBx_P-F      FTSA
DQ899144_HBx_P-F      FTSA
DQ899146_HBx_P-F      FTSA
DQ899147_HBx_P-F      FTSA
DQ899145_HBx_P-F      FTSA
KP995104_HBx_P-F      FTSA
DQ629996_HBx_P-F      FTSA
DQ629991_HBx_P-F      FTSA
DQ629941_HBx_P-F      FTSA
DQ629937_HBx_P-F      FTSP
KC494401_HBx_P-F      FTSA
KC494396_HBx_P-F      FTSA
KC494394_HBx_P-F      FTSA
KC494399_HBx_P-F      FTSA
KP995120_HBx_P-F      FTSA
KC494405_HBx_P-F      FTSA
KJ843191_HBx_P-F      FTSA
KC494395_HBx_P-F      FTSA
KC494397_HBx_P-F      FTSA
X69798_HBx_P-F        FTSA
KP995110_HBx_P-F      FTSA
KC494402_HBx_P-F      FTSA
KC494403_HBx_P-F      FTSA
DQ629995_HBx_P-F      FTSA
DQ629967_HBx_P-F      FTSA
DQ629965_HBx_P-F      FTSA
DQ629934_HBx_P-F      FTSA
DQ629956_HBx_P-F      FTSA
AY090455_HBx_P-F      FTSA
DQ629933_HBx_P-F      FNSA
DQ629940_HBx_P-F      FTSA
DQ629950_HBx_P-F      FTSA
DQ629953_HBx_P-F      FTSA
DQ629954_HBx_P-F      FTSA
DQ629997_HBx_P-F      FTSA
AY311369_HBx_P-F      FTSA
KX264497_HBx_P-F      FTSA
DQ899142_HBx_P-F      FTSA
DQ899143_HBx_P-F      FTSA
DQ629936_HBx_P-F      FT--
DQ629985_HBx_P-F      FTSA
DQ629930_HBx_P-F      FTSA
KP995107_HBx_P-F      FTSA
KP995114_HBx_P-F      FTSA
KP995115_HBx_P-F      FTSA
KP995113_HBx_P-F      FTSA
KP995105_HBx_P-F      FTSA
KP995097_HBx_P-F      LTSA
DQ629947_HBx_P-F      FTPS
KJ638664_HBx_P-F      FTSA
DQ629993_HBx_P-F      FTSA
KP995101_HBx_P-F      FTSA
KP718107_HBx_P-F      LTSA
KJ843196_HBx_P-F      FTSA
KJ843199_HBx_P-F      FTSA
KJ843195_HBx_P-F      FTSA
KJ843163_HBx_P-F      FTSA
JQ272894_HBx_P-F      FTSA
JF911673_HBx_P-F      FTSA
HM622135_HBx_P-F      FTSA
DQ629944_HBx_P-F      FTSA
DQ629935_HBx_P-F      STSA
AB116552_HBx_P-F      FTSA
AF223964_HBx_P-F      FTSA
AY179735_HBx_P-F      FTSA
DQ823092_HBx_P-F      FTSA
DQ823093_HBx_P-F      FTSA
DQ823094_HBx_P-F      FTSA
DQ823095_HBx_P-F      FTSA
EF026751_HBx_P-F      FTSA
EF026752_HBx_P-F      FTSA
EF026753_HBx_P-F      FTSA
EF026754_HBx_P-F      FTSA
EU366118_HBx_P-F      FTSA
FJ657529_HBx_P-F      FTSA
FJ709457_HBx_P-F      FTSA
FJ709458_HBx_P-F      FTSA
FJ709459_HBx_P-F      FTSA
FJ709460_HBx_P-F      FTSA
FJ709462_HBx_P-F      FTSA
FJ709463_HBx_P-F      FTSA
FJ709464_HBx_P-F      FTSA
FJ709465_HBx_P-F      FTSA
FJ709494_HBx_P-F      FTSA
HE981182_HBx_P-F      FTSA
HE981183_HBx_P-F      FTSA
HM585187_HBx_P-F      FTSA
HM585188_HBx_P-F      FTSA
HM585189_HBx_P-F      FTSA
HM585190_HBx_P-F      FTSA
HM585191_HBx_P-F      FTSA
HM585192_HBx_P-F      FTSA
HM585193_HBx_P-F      FTSA
HM585195_HBx_P-F      FTSA
HM585196_HBx_P-F      FTSA
HM585197_HBx_P-F      FTSA
HM585198_HBx_P-F      FTSA
HM585199_HBx_P-F      FTSA
HM590473_HBx_P-F      FTSA
HQ378247_HBx_P-F      FTSA
JF911674_HBx_P-F      FTSA
JF911675_HBx_P-F      FTSA
JF911676_HBx_P-F      FTSA
JF911677_HBx_P-F      FTSA
JN688691_HBx_P-F      FTSA
JN688699_HBx_P-F      FTSA
JN688703_HBx_P-F      FTSA
JQ272889_HBx_P-F      FTSA
JQ272890_HBx_P-F      FTSA
JQ272891_HBx_P-F      FTSA
JQ272893_HBx_P-F      FTSA
JQ272895_HBx_P-F      FTSA
JQ272898_HBx_P-F      FTSA
JQ272899_HBx_P-F      FTSA
JQ272901_HBx_P-F      FTSA
JQ272904_HBx_P-F      FTSA
JQ272905_HBx_P-F      FTSA
JQ272907_HBx_P-F      FTSA
JQ272908_HBx_P-F      FTSA
JQ272909_HBx_P-F      FTSA
JQ272910_HBx_P-F      FTSA
JQ272913_HBx_P-F      FTSA
JQ272914_HBx_P-F      FTSA
KC494400_HBx_P-F      FTSA
KC494404_HBx_P-F      FTSA
KJ586805_HBx_P-F      FTSA
KJ586806_HBx_P-F      FTSA
KJ586807_HBx_P-F      FTSA
KJ586808_HBx_P-F      FTSA
KJ843167_HBx_P-F      FTSA
KJ843171_HBx_P-F      FTSA
KJ843174_HBx_P-F      FTSA
KJ843176_HBx_P-F      FTSA
KJ843179_HBx_P-F      FTSA
KJ843180_HBx_P-F      FTSA
KJ843190_HBx_P-F      FTSA
KJ843197_HBx_P-F      FTSA
KJ843198_HBx_P-F      FTSA
KJ843200_HBx_P-F      FTSA
KJ843201_HBx_P-F      FTSA
KJ843203_HBx_P-F      FTSA
KJ843206_HBx_P-F      FTSA
KM998715_HBx_P-F      FTSA
KP995116_HBx_P-F      FTSA
KX264496_HBx_P-F      FTSA
KY382415_HBx_P-F      FTSA
KY458061_HBx_P-F      FTSA
KY458062_HBx_P-F      FTSA
MF593354_HBx_P-F      FTSA
MF593367_HBx_P-F      FTSA
MK058437_HBx_P-F      FTSA
KT896494_HBx_P-F      FTSA
FJ589065_HBx_P-F      FTSA
AB064316_HBx_P-F      FTSA
AF223963_HBx_P-F      FTSA
DQ823091_HBx_P-F      FTSA
EF026750_HBx_P-F      FTSA
EU366133_HBx_P-F      FTSA
KJ843164_HBx_P-F      FTSA
KJ843168_HBx_P-F      FTSA
KJ843169_HBx_P-F      FTSA
KJ843170_HBx_P-F      FTSA
KJ843181_HBx_P-F      FTSA
KJ843193_HBx_P-F      FTSA
KJ843194_HBx_P-F      FTSA
KJ843204_HBx_P-F      FTSA
KY382416_HBx_P-F      FTSA
MF593356_HBx_P-F      FTSA
MF593360_HBx_P-F      FTSA
MF593376_HBx_P-F      FTSA
MF593380_HBx_P-F      FTSA
KP995118_HBx_P-F      FTSA
KP995098_HBx_P-F      FTSA
KP718110_HBx_P-F      FTSA
KM233681_HBx_P-F      FTSA
KJ843202_HBx_P-F      FTSA
JN792920_HBx_P-F      FTSA
HM585200_HBx_P-F      FTSA
FJ657525_HBx_P-F      FTSA
FJ589067_HBx_P-F      FTSA
EU670261_HBx_P-F      FTSA
EF397982_HBx_P-F      FTSA
DQ899148_HBx_P-F      FTSA
DQ629989_HBx_P-F      FTSA
DQ629978_HBx_P-F      FTSA
DQ629960_HBx_P-F      FTSA
DQ629959_HBx_P-F      FTSA
DQ629943_HBx_P-F      FTSA
DQ629932_HBx_P-F      FTSA
AB036910_HBx_P-F      FTSA
MH051986_HBx_P-F      FTSA
MH051987_HBx_P-F      FTSA
KJ843205_HBx_P-F      FTSA
KY382417_HBx_P-F      FTSA
MG001258_HBx_P-F      FTSA
HM585194_HBx_P-F      FTSA
HM627320_HBx_P-F      FTSA
DQ629951_HBx_P-F      FTSA
DQ629955_HBx_P-F      FTSA
DQ629981_HBx_P-F      FTSA
DQ629994_HBx_P-F      FTSA
AB116654_HBx_P-F      FTSA
DQ629977_HBx_P-F      FTSA
DQ629988_HBx_P-F      FTSA
AB116551_HBx_P-F      FTSA
DQ899149_HBx_P-F      FTSA
KP718109_HBx_P-F      FTSA
KP718112_HBx_P-F      FTSA
AB036914_HBx_P-F      FTSA
AB036915_HBx_P-F      FTSA
AB036916_HBx_P-F      FTSA
AB036917_HBx_P-F      FTSA
AB036918_HBx_P-F      FTSA
AB036919_HBx_P-F      FTSA
AB036911_HBx_P-F      FTSA
AB036920_HBx_P-F      FTSA
KP718103_HBx_P-F      FTSA
KJ638663_HBx_P-F      FTSA
AB036905_HBx_P-F      FTSA
AB036906_HBx_P-F      FTSA
AB036907_HBx_P-F      FTSA
AB036908_HBx_P-F      FTSA
AB036909_HBx_P-F      FTSA
AB036912_HBx_P-F      FTSA
AB036913_HBx_P-F      FTSA
AB116549_HBx_P-F      FTSA
AB116550_HBx_P-F      FTSA
AY311370_HBx_P-F      FTSA
DQ899150_HBx_P-F      FTSA
AB086397_HBx_P-F      FTSA
AY090456_HBx_P-F      FTSA
DQ629962_HBx_P-F      FTSA
DQ629968_HBx_P-F      FTSA
DQ629972_HBx_P-F      FTSG
DQ629974_HBx_P-F      FTSA
DQ629979_HBx_P-F      FTSA
DQ629990_HBx_P-F      FTSA
DQ629992_HBx_P-F      FTSA
EU670260_HBx_P-F      FTSA
JN792914_HBx_P-F      FTSA
JN792916_HBx_P-F      FTSA
JN792917_HBx_P-F      FTSA
JN792918_HBx_P-F      FTSA
JN792919_HBx_P-F      FTSA
JN792922_HBx_P-F      FTSA
JX079936_HBx_P-F      FTSA
KJ638656_HBx_P-F      FTSA
KJ638657_HBx_P-F      FTSA
KY476324_HBx_P-F      FTSA
KY476325_HBx_P-F      FTSA
KY476327_HBx_P-F      FTSA
KY476328_HBx_P-F      FTSA
KY476330_HBx_P-F      FTSA
KY476331_HBx_P-F      FTSA
X75663_HBx_P-F        FTSA
KY476329_HBx_P-F      FTSA
DQ629938_HBx_P-F      FPCA
AY090458_HBx_C-F      FTSA
AY090459_HBx_P-F      FTSA
AY090461_HBx_P-F      FTSA
DQ629931_HBx_P-F      FTSA
DQ629945_HBx_P-F      FTSA
DQ629948_HBx_P-F      FTSA
DQ629949_HBx_P-F      FTSA
DQ629961_HBx_P-F      FTSA
DQ629963_HBx_P-F      FTSA
DQ629964_HBx_P-F      FTSA
DQ629966_HBx_P-F      FTSA
DQ629969_HBx_P-F      FSSA
DQ629971_HBx_P-F      FTSA
DQ629973_HBx_P-F      FTSA
DQ629987_HBx_P-F      FTSA
EU670262_HBx_P-F      FTSA
HM585186_HBx_P-F      FTSA
HM590471_HBx_P-F      FTSA
HM590472_HBx_P-F      FTSA
HM590474_HBx_P-F      FTSA
JQ272892_HBx_P-F      FTSA
KJ843177_HBx_P-F      FTSA
KJ843178_HBx_P-F      FTSA
KP718104_HBx_P-F      FTSA
KP718113_HBx_P-F      FTSA
KP995126_HBx_P-F      FTSA
KP995109_HBx_P-F      FTSA
MF593371_HBx_P-F      FTSA
KY476332_HBx_P-F      FTSA
KY476323_HBx_P-F      FTSA
KY476322_HBx_P-F      FTSA
KP995111_HBx_P-F      FTSA
KP995106_HBx_P-F      FTSA
KX264498_HBx_P-F      FTSA
KP995125_HBx_P-F      FTSA
KP995124_HBx_P-F      FTSA
KP995123_HBx_P-F      FTSA
KP995119_HBx_P-F      FTSA
KM659861_HBx_P-F      FTSA
FJ589066_HBx_P-F      FTSA
KJ638659_HBx_P-F      FTSA
KX757665_HBx_P-F      XTSA
KP995117_HBx_P-F      FTSA
KP718106_HBx_P-F      FTSA
KP718111_HBx_P-F      FTSA
                          

© 1998-2019