HBVdb

Dataset for protein LHBs of genotype F

[Download (right click)] [Edit] [Sequences] [Repertoires]

262 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KJ638664_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
AB036906_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AB036907_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AB036908_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
EF576808_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPEHQLDPLFRANSSSPDWDFNKNKD
JQ272888_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPEHQLDPLFRANSSSPDWDFNKNKD
JN688709_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
EU366132_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843225_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
AB365453_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPEHQLDPLFRANSSSPDWDFNKNKD
KJ676694_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
AB365446_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPEHQLDPLFRANSSSPDWDFNKNKD
AB166850_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFKANSSSPDWDFNKNKD
AB214516_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFKANSSSPDWDFNKNKD
KJ843185_LHBs_P-F      MGAPLSTTRRGMGQNLTVPNPLGFFPDHQLDPLFKANSSSPDWDFNKNKD
KJ843175_LHBs_P-F      MGAPLSTTRRGMGQNLTVPNPLGFFPDHQLDPLFKANSSSPDWDFNKNKD
DQ823089_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
DQ823087_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
AF223965_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPEHQLDPLFRANSSSPDWDFNKNKD
AB365450_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPEHQLDPLFRANSSSPDWDFNKNKD
AB365449_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPEHQLDPLFRANSSSPDWDFNKNKD
JN688720_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
EF576812_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPEHQLDPLFRANSSSPDWDFNKNKD
DQ823086_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPXHQLDPLFRANSSSPDWDLNKNKD
KJ843209_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFLPEHQLDPLFRANSSSPDWDFNKNKD
AF223962_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
DQ776247_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
DQ823088_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKTKD
DQ823090_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
EU366116_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843207_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
JN811655_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKTKD
KJ843226_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KY382411_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKTKD
KX264499_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843224_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKTKD
KJ843222_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKTKD
KJ843221_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKTKD
KJ843220_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843219_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKTKD
KJ843213_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843212_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKTKD
KJ843211_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKTKD
KJ843210_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843208_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843189_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KC494398_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
JX079937_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
JN688701_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKTKD
JN811656_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843223_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HE981181_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
FJ657528_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKTKD
FJ657519_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
FJ657522_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ586807_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KY476326_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNNNKD
KP995115_LHBs_P-F      MGAPHSTRRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
KJ638662_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ638656_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KP718110_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
AY090456_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNKNKD
DQ899144_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFKANSSSPDWDFNTNKD
DQ899146_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFKANSSSPDWDFNTNKD
DQ899145_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFKANSSSPDWDFNTNKD
JN792917_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
AB116654_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM585200_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
AB086397_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
FJ709457_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
FJ709462_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
JN604271_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
JN792918_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
AY090458_LHBs_C-F      MGAPLSTTRRGMGQNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNKSKD
AY090459_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
AY090461_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM585186_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM585194_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM590471_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM590472_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
AY179735_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
AB064316_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
AB116552_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
FJ709463_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
FJ709464_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKDKD
JN792920_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
JN792919_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
JN688703_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
JN688699_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
JN688691_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HQ378247_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKDKD
HM622135_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKDKD
HM590473_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM585199_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM585197_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM585196_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM585193_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM585192_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM585190_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM585189_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM585188_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM585187_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HE981183_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HE981182_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
FJ709494_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
FJ709465_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
FJ709460_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKDKD
FJ657529_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
FJ657525_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
EU670262_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
EU366133_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
EU366118_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
DQ823095_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
DQ823094_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
DQ823093_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKDKD
DQ823092_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKDKD
AF223963_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
DQ823091_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
FJ709458_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
FJ709459_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM585191_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM585195_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
HM585198_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KC494397_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
KY476328_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSNSPDWDFNKNKD
KY476325_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSNSPDWDFNKNKD
KY476324_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KP995110_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFKANSSSPDWDFNTNKD
JN604233_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
JN604225_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
AF223964_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KY476330_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KY476329_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KT896494_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
KP995120_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
KP995116_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ638660_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KC494402_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
KC494401_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
KJ843168_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
X75658_LHBs_C-F        MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KF199901_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KC494396_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
HM627320_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KY476331_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KY476327_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KP995097_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
X69798_LHBs_P-F        MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
KY458062_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKDKD
KY458061_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKDKD
KX264497_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
KP995107_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
KP718113_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKSKD
KP718107_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KP718104_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKSKD
KM998715_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKDKD
KM233681_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843203_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843202_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843191_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
KJ586808_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KC494405_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
KC494403_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
KC494395_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
KC494394_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
KY476323_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KY382415_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPBHQLDPLFRANSSSPDWDFNKXKD
KY382416_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPBHQLDPLFRANSSSPDWDFNKXKD
KY382417_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPBHQLDPLFRANSSSPDWDFNKXKD
KJ843197_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843174_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KC494404_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KC494400_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KF779236_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKDKD
MK058437_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KY476332_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KY476322_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KX264496_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KP995098_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843206_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843205_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843204_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843201_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843200_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843199_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843198_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843196_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843195_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843194_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKDKD
KJ843193_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843190_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843181_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKDKD
KJ843180_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKDKD
KJ843179_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843178_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843177_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843176_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843171_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843170_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843169_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843167_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KJ843164_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKDKD
KJ843163_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
JX079936_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
JN792921_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNXNKD
JN792922_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKD
KP995118_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFKANSSSPDWDFNTNKD
KP995114_LHBs_P-F      MGAPLSTTRRGRGQNLSVPNPLGFFPDHQLDPLFKANSSSPDWDFNTNKD
DQ899150_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFFPDHQVDPIFRANSSSSEWDFNTNKD
JN604211_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFKANSSSPDWDFNTNKD
DQ899142_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
X75663_LHBs_P-F        MGAPLSTTRRGMGQNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
KP995113_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRTNSSSPDWDFNTNKD
KC494399_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
DQ899147_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
DQ899143_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AB116550_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
KP995111_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFKANSSNPDWDFNTNKD
KP995117_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
KP995106_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFKANSSSPDWDFNTNKD
FJ589066_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
DQ899149_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPVFRANSSSPDWDFNTNKD
JF439884_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
JF439885_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AY090455_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AY311369_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
MH051987_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFKANSSSPDWDFNTNKD
FJ589067_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AB036915_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSNSPDWDFNTNKD
KP995123_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
KP995125_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
KP995119_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFKANSSSPDWDFNTNKD
MH051986_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFKANSSSPDWDFNTNKD
KP995104_LHBs_P-F      MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
KP718111_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANTSSPDWDFNTNKD
AB036913_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AB036905_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AB036909_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AB036910_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AB036911_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AB036912_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AB036914_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AB036916_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AB036917_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AB036918_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AB036919_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AB036920_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AB116549_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AB116551_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
KP995109_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
KP718106_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKX
KX264498_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
KP995101_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
KP718112_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
KP718103_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
KJ638659_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
KP718109_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
KP995126_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
KP995124_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
KP995105_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
AY311370_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
DQ899148_LHBs_P-F      MGAPLSTTRRGMGLNLSVPNPLGFLPDHQLDPLFRANSSSPDWDFNTNKD
                       **** ** *** * **:*******:* **:**:*.:*:...:**:*  * 

KJ638664_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB036906_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB036907_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB036908_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
EF576808_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGILTTLPANPPPASTNR
JQ272888_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGILTTLPADPPPASTNR
JN688709_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPANPPPASTNR
EU366132_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843225_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB365453_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ676694_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPANPPPASTNR
AB365446_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB166850_LHBs_P-F      TWPMANKVGVG-AYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB214516_LHBs_P-F      TWPMANKVGVG-AYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843185_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843175_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
DQ823089_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
DQ823087_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AF223965_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB365450_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB365449_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JN688720_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
EF576812_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
DQ823086_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843209_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AF223962_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
DQ776247_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
DQ823088_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
DQ823090_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
EU366116_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843207_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JN811655_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843226_LHBs_P-F      TWPMANKVGVG-SYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KY382411_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KX264499_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843224_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843222_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843221_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843220_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843219_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843213_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843212_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843211_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843210_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843208_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843189_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KC494398_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JX079937_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JN688701_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JN811656_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843223_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HE981181_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
FJ657528_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
FJ657519_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
FJ657522_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ586807_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPPDPPPASTNR
KY476326_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995115_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPANPPPASTNR
KJ638662_LHBs_P-F      SWPMANKVWTGEGYGPGFT-PHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ638656_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP718110_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AY090456_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
DQ899144_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGMLTTLPADPPPASTNR
DQ899146_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGMLSTVPADPPPASTNR
DQ899145_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGMLTTLPADPPPASTNR
JN792917_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB116654_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM585200_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB086397_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
FJ709457_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
FJ709462_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JN604271_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JN792918_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AY090458_LHBs_C-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AY090459_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AY090461_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM585186_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM585194_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM590471_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM590472_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AY179735_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB064316_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTVPADPPPASTNR
AB116552_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
FJ709463_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
FJ709464_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JN792920_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JN792919_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JN688703_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JN688699_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JN688691_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HQ378247_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM622135_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM590473_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM585199_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM585197_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM585196_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM585193_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM585192_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM585190_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM585189_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM585188_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM585187_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HE981183_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HE981182_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
FJ709494_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
FJ709465_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
FJ709460_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
FJ657529_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
FJ657525_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
EU670262_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPAPTNR
EU366133_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
EU366118_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
DQ823095_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
DQ823094_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
DQ823093_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
DQ823092_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AF223963_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
DQ823091_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
FJ709458_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
FJ709459_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM585191_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM585195_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM585198_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KC494397_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KY476328_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPAPTNR
KY476325_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPAPTNR
KY476324_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPAPTNR
KP995110_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JN604233_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JN604225_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AF223964_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPANPPPASTNR
KY476330_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KY476329_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPVDPPPAPTNR
KT896494_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995120_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995116_LHBs_P-F      NWPMANKVRVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ638660_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KC494402_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KC494401_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843168_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
X75658_LHBs_C-F        TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KF199901_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KC494396_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
HM627320_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KY476331_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPAPTNR
KY476327_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTWPANPPTASTNR
KP995097_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
X69798_LHBs_P-F        SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KY458062_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KY458061_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KX264497_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995107_LHBs_P-F      SWPMANKVGVG-AYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP718113_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP718107_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP718104_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KM998715_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KM233681_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843203_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843202_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843191_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ586808_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KC494405_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KC494403_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KC494395_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KC494394_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KY476323_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPAPTNR
KY382415_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KY382416_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KY382417_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843197_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPANPPPASTNR
KJ843174_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KC494404_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPANPPPASTNR
KC494400_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPANPPPASTNR
KF779236_LHBs_P-F      HWPIANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
MK058437_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KY476332_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KY476322_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KX264496_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995098_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843206_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843205_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843204_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843201_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843200_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843199_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843198_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843196_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843195_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843194_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843193_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843190_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843181_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843180_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843179_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843178_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPAPTNR
KJ843177_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPAPTNR
KJ843176_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843171_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843170_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843169_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843167_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843164_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ843163_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JX079936_LHBs_P-F      NWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPAPTNR
JN792921_LHBs_P-F      XWPMANKVGVG-XYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JN792922_LHBs_P-F      NWPMANKVGVG-AYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995118_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995114_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
DQ899150_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLMGWSPQAQGVLTTLPADPPPASTNR
JN604211_LHBs_P-F      KWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
DQ899142_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLSADPPPASTNR
X75663_LHBs_P-F        SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995113_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KC494399_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPAEPPPASTNR
DQ899147_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGMLTTLPADPPRASTNR
DQ899143_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLSADPPPASTNR
AB116550_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995111_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995117_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995106_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
FJ589066_LHBs_P-F      SWPMANKVGVG-GFGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
DQ899149_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLVGWSPQAQGVLTTLPADPPPASTNR
JF439884_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
JF439885_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AY090455_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AY311369_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
MH051987_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
FJ589067_LHBs_P-F      TWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB036915_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995123_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995125_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995119_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
MH051986_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995104_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP718111_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPTSTNR
AB036913_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB036905_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB036909_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB036910_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB036911_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB036912_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB036914_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB036916_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTSPADPPPASTNR
AB036917_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTSPADPPPASTNR
AB036918_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTSPADPPPASTNR
AB036919_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB036920_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
AB116549_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGALTTLPADPPPASTNR
AB116551_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995109_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP718106_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPVDPPPASTNR
KX264498_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995101_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP718112_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP718103_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KJ638659_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGALTTLPADPPPASTNR
KP718109_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995126_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995124_LHBs_P-F      SWPMANKVGVG-SYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
KP995105_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPTDPPPASTNR
AY311370_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
DQ899148_LHBs_P-F      SWPMANKVGVG-GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNR
                        **:**** .*  :***** *****:******** *:* . :** :.***

KJ638664_LHBs_P-F      RSGXQPL-VSPPLRDTHPQAIKWKWNTFHQALLDPKVRALYFPAGGSSSE
AB036906_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB036907_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB036908_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
EF576808_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYLPAGGSSSE
JQ272888_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAVKWNSAKFHQALLDPRVRALYLPAGGSSSE
JN688709_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHSTQLDPRVRALYXPAGGSSSE
EU366132_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWTSTQFHQALLDPRVRALYLXAGGSSSE
KJ843225_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSIQFHQALLDQRVRTLCLPAGGSSSE
AB365453_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSSQFHQALLDPRVRALYLPAGGSSSE
KJ676694_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAXQNNSTQFHQALLDPRVRALYFPAGGSSSE
AB365446_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYLPAGGSSSE
AB166850_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALSPPAGGSSSE
AB214516_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALSPPAGGSSSE
KJ843185_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYLPAGGSSSE
KJ843175_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
DQ823089_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQVLLDPRVKALYYPAGGSSSE
DQ823087_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSAKFHQALLDPRVRALYFPAGGSSSE
AF223965_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
AB365450_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
AB365449_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYLPAGGSSSE
JN688720_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSD
EF576812_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
DQ823086_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843209_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
AF223962_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
DQ776247_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
DQ823088_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
DQ823090_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
EU366116_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843207_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
JN811655_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843226_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KY382411_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KX264499_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843224_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843222_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843221_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843220_LHBs_P-F      RSGRKPTPVSPPLRDTHPHAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843219_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843213_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843212_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843211_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843210_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843208_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843189_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KC494398_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
JX079937_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
JN688701_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
JN811656_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843223_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVKALYFPAGGSSSE
HE981181_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
FJ657528_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
FJ657519_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVXALYFPAGGSSSE
FJ657522_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ586807_LHBs_P-F      RSGRKPTPISPPLKDTHPQGMAWNSPQFHQGLLIPRVKGLLLVAGGSSSK
KY476326_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSSQFHQALLDPRVRALYXPAGGSSSE
KP995115_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KJ638662_LHBs_P-F      RSGRKPTPXSPPLRDTHPQAMQWNTTQFHQALLDPXVRALYFPAGGSSSE
KJ638656_LHBs_P-F      RSGRKPTPVSLPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KP718110_LHBs_P-F      RWGRKPTPVSPPLRDTHPQAMQWNSNQFHQALLDPRVRALYLPAGGSSSE
AY090456_LHBs_P-F      RSGRKPTPASPPLRDTHPQAMQWNSSQFHQALLDPRVR----PAGGSSSE
DQ899144_LHBs_P-F      RSGRKPTPVSPPVRDTHPQAMQWNSTQFHQALLDPRVKALYFPAGGSSSG
DQ899146_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVKALYFPAGGSSSG
DQ899145_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
JN792917_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQTLLDPRVRDLYLPAGGSSSE
AB116654_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM585200_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTLFHQALLDPRVRALYFPAGGSSSE
AB086397_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQXLLDPRVRALYFPAGGSSSE
FJ709457_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQTLLDPRVRALYFPAGGSSSE
FJ709462_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
JN604271_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
JN792918_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRDLYFPAGGSSSE
AY090458_LHBs_C-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
AY090459_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
AY090461_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM585186_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM585194_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM590471_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM590472_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
AY179735_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
AB064316_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQTLLDPRVRALYFPAGGSSSE
AB116552_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
FJ709463_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
FJ709464_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
JN792920_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
JN792919_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
JN688703_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
JN688699_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
JN688691_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HQ378247_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM622135_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM590473_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM585199_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM585197_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM585196_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM585193_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM585192_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM585190_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM585189_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM585188_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM585187_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HE981183_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HE981182_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
FJ709494_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
FJ709465_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRTLYFPAGGSSSE
FJ709460_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQTLLDPRVRALYFPAGGSSSE
FJ657529_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
FJ657525_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
EU670262_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPASGSSSE
EU366133_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
EU366118_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
DQ823095_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
DQ823094_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
DQ823093_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
DQ823092_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
AF223963_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
DQ823091_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
FJ709458_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
FJ709459_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM585191_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
HM585195_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNATQFHQALLDPRVRALYFPAGGSSSE
HM585198_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KC494397_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KY476328_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KY476325_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KY476324_LHBs_P-F      RXGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KP995110_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
JN604233_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
JN604225_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
AF223964_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFHAGGSSSG
KY476330_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KY476329_LHBs_P-F      RSGRKPTPVSPPLRDTHPQATQWNTPQFHQALLDPRVRALCFPAGGSSSE
KT896494_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQLLLDPRVRALCFPAGGSSSG
KP995120_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KP995116_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ638660_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNTTQFHQALQDPRVRALLSPAGGSSSE
KC494402_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KC494401_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KJ843168_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQTLLDPRVRA----AGGSSSE
X75658_LHBs_C-F        LSGRKPTPVSPPLRDTHPQAMQWNSTHFHQALLDPRVRALYFPAGGSSSG
KF199901_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGCSSSE
KC494396_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVWALYFPAGGSSSG
HM627320_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALXDPRVRXLYXPAGGSSSE
KY476331_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KY476327_LHBs_P-F      QSGRQPTPVSPPLRDTHPQAVQWNSTQFHQALLDPRVRALYFPAGGSSSE
KP995097_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
X69798_LHBs_P-F        RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KY458062_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KY458061_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KX264497_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KP995107_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KP718113_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KP718107_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KP718104_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KM998715_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KM233681_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843203_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843202_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQTLLDPRVRALYFPAGGSSSE
KJ843191_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KJ586808_LHBs_P-F      RSGKKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KC494405_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KC494403_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KC494395_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KC494394_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KY476323_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLAPRVRALYFPAGGSSSE
KY382415_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KY382416_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KY382417_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843197_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843174_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHHALLDPRVRALYFPAGGSSSE
KC494404_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KC494400_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KF779236_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
MK058437_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KY476332_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KY476322_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KX264496_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KP995098_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843206_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843205_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843204_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843201_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843200_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843199_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843198_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843196_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843195_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843194_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQTLLDPRVRALYFPAGGSSSE
KJ843193_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843190_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843181_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843180_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843179_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843178_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843177_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843176_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843171_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843170_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843169_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQTLLDPRVRALYFPAGGSSSE
KJ843167_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843164_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
KJ843163_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
JX079936_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
JN792921_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQXLLBPRVRALYFPAGGSSSX
JN792922_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAVQWNSTQFHQTLLDPRVRALYFPAGGSSSE
KP995118_LHBs_P-F      RTGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KP995114_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSSKFHQHLLEPGVRALCLPAGGSSSG
DQ899150_LHBs_P-F      RTGRKPTPVSPPLRDTHPQAVQWNSTQFHQALLDPRVRALYFPAGGSSSG
JN604211_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
DQ899142_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPMVRALYFPAGGSSSG
X75663_LHBs_P-F        LSGRKPTQVSPPLRDTHPQAMQWNSTHFHQALLDPRVRALYFPAGGSSSG
KP995113_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KC494399_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
DQ899147_LHBs_P-F      RSGRKPTPVSPPVRDTHPQAMQWNSTQFHQALLDPRVRALYLPAGGSSSR
DQ899143_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSE
AB116550_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPKGKALYFPAGGSSSG
KP995111_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPKVTALYFPAGGSSSG
KP995117_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLNPRVRALYFPAGGSSSG
KP995106_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYLPAGGSSSG
FJ589066_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
DQ899149_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
JF439884_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
JF439885_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AY090455_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AY311369_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
MH051987_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
FJ589067_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB036915_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KP995123_LHBs_P-F      RTGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KP995125_LHBs_P-F      RTGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KP995119_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
MH051986_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KP995104_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYLPAGGSSSG
KP718111_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB036913_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB036905_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB036909_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB036910_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB036911_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB036912_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB036914_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB036916_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB036917_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB036918_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB036919_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB036920_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB116549_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
AB116551_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KP995109_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALSFPAGGSSSG
KP718106_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAXQWNSTQFHQALLDPRVRALYFPAGGSSSG
KX264498_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KP995101_LHBs_P-F      RSGRKPTPISPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSPG
KP718112_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KP718103_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSSSG
KJ638659_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAXQWNSTQFHQALLDPRVRALYFPAGGSSSG
KP718109_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYSPAGGSSSG
KP995126_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYLPAGGSSSG
KP995124_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYLPAGGSSSG
KP995105_LHBs_P-F      RSERKPTPVSPPLRDTHPQAIQWNSTQFHQALLDPRVRALYLPAGGSSSG
AY311370_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYLPAGGSSSG
DQ899148_LHBs_P-F      RSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALSDPRVRALYLPAGGSSSG
                           :*   * *:.****:.  ..   **              *. **. 

KJ638664_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVSFLLTKI
AB036906_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AB036907_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AB036908_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
EF576808_LHBs_P-F      TQNPAPTIASLISSISLTTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
JQ272888_LHBs_P-F      TQNPAPTIASLTSSIFSTTGDLAMNMDNITSGLLGPLLVLQAVCFLLIKI
JN688709_LHBs_P-F      TQNLAQTIASLXSSIFSKTGGXAMNMDNITSGLLGPLLVLQGVFFLLTKI
EU366132_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLRPLLVLQAVFFSLTKI
KJ843225_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVYFLLIKI
AB365453_LHBs_P-F      TQNPAPTIASLTSSIFSTTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ676694_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVSFLLIKI
AB365446_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVFFLLTKI
AB166850_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
AB214516_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843185_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843175_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
DQ823089_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
DQ823087_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
AF223965_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDSITSGLLGPLLVLQAVCFLLTKI
AB365450_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
AB365449_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLXGPLLVLQAVCFLWTKI
JN688720_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVFFSLIKI
EF576812_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
DQ823086_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843209_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
AF223962_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
DQ776247_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
DQ823088_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
DQ823090_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
EU366116_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843207_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
JN811655_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843226_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KY382411_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KX264499_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843224_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843222_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843221_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843220_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843219_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843213_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843212_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843211_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843210_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843208_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843189_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KC494398_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
JX079937_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
JN688701_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVXFLLTKI
JN811656_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843223_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
HE981181_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
FJ657528_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMTMDNITSGLLGPLLVLQAVCFLLTKI
FJ657519_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
FJ657522_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ586807_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KY476326_LHBs_P-F      TQNPAPTIASLTSSISSKTGGPAMNMDNITSGLLGPLLVLXAVCFWLTKI
KP995115_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLIKI
KJ638662_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPVMNMDNITSGLLGPLLVLQAVCFLLIKI
KJ638656_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPAMNMDNTTSGHLGLLLVLQAVCFLLTKI
KP718110_LHBs_P-F      TQNPAPTIASLTSSTFLXTGGPAMNMDNITSGLLGPLLVLQAVCFLLIKI
AY090456_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
DQ899144_LHBs_P-F      TQNPAPTIASLTSSIYSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
DQ899146_LHBs_P-F      TQNPAPTIASLTSSIYSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
DQ899145_LHBs_P-F      TQNPAPTIASLTSSIYSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
JN792917_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTSF
AB116654_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVFSLLTKI
HM585200_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
AB086397_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAAFFLLIKI
FJ709457_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
FJ709462_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
JN604271_LHBs_P-F      TQNPAPTIASLTSSSFSTTGGPATNMDNITSGLLGPLLVLQAVCFLLIKI
JN792918_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLIKI
AY090458_LHBs_C-F      TQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
AY090459_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
AY090461_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
HM585186_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
HM585194_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
HM590471_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
HM590472_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
AY179735_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
AB064316_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
AB116552_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
FJ709463_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
FJ709464_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
JN792920_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
JN792919_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
JN688703_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
JN688699_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
JN688691_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
HQ378247_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
HM622135_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGHLGPLLVLQAVCSLLTKI
HM590473_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
HM585199_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
HM585197_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
HM585196_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
HM585193_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
HM585192_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
HM585190_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
HM585189_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
HM585188_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
HM585187_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
HE981183_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
HE981182_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
FJ709494_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
FJ709465_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
FJ709460_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
FJ657529_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
FJ657525_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
EU670262_LHBs_P-F      TQNPAPTIASLTSSIFLKTGAPATNMDNITSGLLGPLLVLQAVCFLLTKI
EU366133_LHBs_P-F      TQNPAPTIASLTSSIFWKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
EU366118_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
DQ823095_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
DQ823094_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
DQ823093_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
DQ823092_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
AF223963_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
DQ823091_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
FJ709458_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGLATNMDNITSGLLGPLLVLQAVCFLLTKI
FJ709459_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGLATNMDNITSGLLGPLLVLQAVCFLLTKI
HM585191_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGLATNMDNITSGLLGPLLVLQAVCFLLTKI
HM585195_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGLATNMDNITSGLLGPLLVLQAVCFLLTKI
HM585198_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGLATNMDNITSGLLGPLLVLQAVCFLLTKI
KC494397_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNTYSGLLRPLLVSQAVCSLLTKI
KY476328_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDSITSGLLGPLLVLQAVCFLLTKI
KY476325_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDSITSGLLGPLLVLQAVCFLLTKI
KY476324_LHBs_P-F      TQNPAPTIASLTSSIFLTTGAPATNMDNITSGLLGPLLVLQAVFFLLTKI
KP995110_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
JN604233_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
JN604225_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
AF223964_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KY476330_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFSLTKI
KY476329_LHBs_P-F      TQNPAPTIASLTSSIFLKTGAPATNMDNISSGLLGPLLVLQAVCFLLTKI
KT896494_LHBs_P-F      TQNPAPTIASLTSSIFSTTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KP995120_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KP995116_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ638660_LHBs_P-F      TQNPAPTIASLTSSIFXKTGGPVMNMDNITSGLLGPLLVLQAVCFLLTKI
KC494402_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KC494401_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843168_LHBs_P-F      TQNPAPTIVSLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
X75658_LHBs_C-F        TQNPAPTIASLTSSISSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KF199901_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KC494396_LHBs_P-F      TQNPAPTIASLTSSIFPKTGGPAMNMDNITSGLLGPLLVLHAVCFLLTKI
HM627320_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KY476331_LHBs_P-F      TQNPAPTIASLTSSIFLKTGAPATNMDSITSGLLGPLLVLQAVCFLLTKI
KY476327_LHBs_P-F      TQHPAPIIASLTSSIFLKTGAPATNMDNITSGLLGPLLVLQAVCFLLTKI
KP995097_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
X69798_LHBs_P-F        TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KY458062_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNISSGLLGPLLVLQAVCFLLTKI
KY458061_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNISSGLLGPLLVLQAVCFLLTKI
KX264497_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KP995107_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNTTSGLLGPLLVLQAVCFLLTKI
KP718113_LHBs_P-F      TQNPAPTIASLTSSIFLKTGAPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KP718107_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KP718104_LHBs_P-F      TQNPAPTIASLTSSIFLKTGAPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KM998715_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNISSGLLGPLLVLQAVCFLLTKI
KM233681_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPAVNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843203_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843202_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843191_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ586808_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KC494405_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KC494403_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KC494395_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KC494394_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KY476323_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDSITSGLLGPLLVLQAVCFLLTKI
KY382415_LHBs_P-F      TQNPAPTIAXLTSSIFXKTGGPAXNMDNITSGLLGPLLVLQAVCFLLTKI
KY382416_LHBs_P-F      TQNPAPTIAXLTSSIFXKTGGPAXNMDNITSGLLGPLLVLQAVCFLLTKI
KY382417_LHBs_P-F      TQNPAPTIAXLTSSIFXKTGGPAXNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843197_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843174_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KC494404_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KC494400_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KF779236_LHBs_P-F      TVNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
MK058437_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KY476332_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KY476322_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KX264496_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KP995098_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843206_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843205_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843204_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843201_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843200_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843199_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843198_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843196_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843195_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843194_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843193_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843190_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843181_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843180_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843179_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843178_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843177_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843176_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843171_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843170_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843169_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843167_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843164_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KJ843163_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
JX079936_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
JN792921_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
JN792922_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPATNMDNITSGLLGPLLVLQAVCFLLTKI
KP995118_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
KP995114_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLRPLLVLQAVSFLLTKI
DQ899150_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
JN604211_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPALNMENITSGLLGPLLVLQAVFFLLTKI
DQ899142_LHBs_P-F      TQNPAPTIASLTSSISSKTGGPAMSMDNITSGLLGPLLVLQAVCFLLTKI
X75663_LHBs_P-F        TQNPAPTIASLTSSISSKTGGPAMNMENITSGLLGPLRVLQAVCFLLTKI
KP995113_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSKLLGPLLVLQGVFFSLTKI
KC494399_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVYFLLIKI
DQ899147_LHBs_P-F      TQNPAPTIASLTSSIYSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
DQ899143_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMSMDNITSGLLGPLLVLQAVCFLLTKI
AB116550_LHBs_P-F      TQNPAPTIASLTSSTFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
KP995111_LHBs_P-F      TQNPAPTIASLTSSIFSTTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
KP995117_LHBs_P-F      TQNPAPTIASLTSSTFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
KP995106_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
FJ589066_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
DQ899149_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
JF439884_LHBs_P-F      TQNPAPTIASLTSSISSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
JF439885_LHBs_P-F      TQNPAPTIASLTSSISSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AY090455_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
AY311369_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
MH051987_LHBs_P-F      TQNPAPTIASLTSSIFSRTGDPAMNMENITSGLLGPLLVLQAVCFLLTKI
FJ589067_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AB036915_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
KP995123_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
KP995125_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
KP995119_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
MH051986_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
KP995104_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KP718111_LHBs_P-F      TQNPAPTIASLTSSIFLKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AB036913_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLXGPLLVLQAVCFLLTKI
AB036905_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AB036909_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AB036910_LHBs_P-F      TQNPAPTIASLTSSTFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AB036911_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AB036912_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AB036914_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AB036916_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AB036917_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AB036918_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AB036919_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AB036920_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AB116549_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AB116551_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
KP995109_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLIKI
KP718106_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
KX264498_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
KP995101_LHBs_P-F      TQNPVPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
KP718112_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
KP718103_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLTKI
KJ638659_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLXKI
KP718109_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
KP995126_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
KP995124_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
KP995105_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
AY311370_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAGGFLLTKI
DQ899148_LHBs_P-F      TQNPAPTIASLTSSIFSKTGGPAMNMENITSGLLGPLLVLQAVCFLLTKI
                       * : .  *. * **    **  . .*:.  *     * *  .      .:

KJ638664_LHBs_P-F      LTIPQSLDSWWTSLNFLGGPPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB036906_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB036907_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB036908_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
EF576808_LHBs_P-F      LTIPQSLDSWWTSLNFLEGLPRCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JQ272888_LHBs_P-F      LTIPQSLDSWWTSLNFLGELPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN688709_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
EU366132_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPLTCPGYRWM
KJ843225_LHBs_P-F      LTIPQNLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB365453_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ676694_LHBs_P-F      LTIPQSLDSWWTSLNFLGELPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB365446_LHBs_P-F      LTIPQSLDSWWTSLNFLGALPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB166850_LHBs_P-F      RTIPQSLDLWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB214516_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843185_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843175_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ823089_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ823087_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AF223965_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB365450_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB365449_LHBs_P-F      LKTPQSLDSWWTSLNFLGALPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN688720_LHBs_P-F      RTIPQSLDSWWTSLNFLGELPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
EF576812_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ823086_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843209_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AF223962_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ776247_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ823088_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ823090_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
EU366116_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843207_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN811655_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843226_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KY382411_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KX264499_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843224_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843222_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843221_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843220_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843219_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843213_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843212_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843211_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843210_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843208_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843189_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KC494398_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JX079937_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN688701_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN811656_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843223_LHBs_P-F      XTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HE981181_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
FJ657528_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
FJ657519_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
FJ657522_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ586807_LHBs_P-F      LTIPQSLNSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KY476326_LHBs_P-F      RKIPQSLDSWWTSLNFLGGPPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995115_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPVCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ638662_LHBs_P-F      LTIPQSLDSWWTSRNFLGEIPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ638656_LHBs_P-F      LKIPQNLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP718110_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLLTSCPPTCPGYRWM
AY090456_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ899144_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ899146_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ899145_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN792917_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTFCPPTCPGYRWM
AB116654_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTTGCPGQNSLSPTSNHLPTSCPPTCPGYRSM
HM585200_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB086397_LHBs_P-F      LTIPRSLDSWWTSLNFLGETPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
FJ709457_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
FJ709462_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN604271_LHBs_P-F      LTIPRSLDSWWTSLNFLGETPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN792918_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AY090458_LHBs_C-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AY090459_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AY090461_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM585186_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM585194_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM590471_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM590472_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AY179735_LHBs_P-F      LTIPQSLDSWWTSLNFLEGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB064316_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB116552_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
FJ709463_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
FJ709464_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN792920_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN792919_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN688703_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN688699_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN688691_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HQ378247_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM622135_LHBs_P-F      RTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM590473_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM585199_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM585197_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM585196_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM585193_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM585192_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM585190_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM585189_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM585188_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM585187_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HE981183_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HE981182_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
FJ709494_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
FJ709465_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
FJ709460_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
FJ657529_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
FJ657525_LHBs_P-F      LTIPRSLDSWWTSLSFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
EU670262_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
EU366133_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
EU366118_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ823095_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ823094_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ823093_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ823092_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AF223963_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ823091_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
FJ709458_LHBs_P-F      LTIPQSLDSWWTSLNFLEGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
FJ709459_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM585191_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM585195_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM585198_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KC494397_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KY476328_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KY476325_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTFCPPTCPGYRWM
KY476324_LHBs_P-F      LTIPKSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995110_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCLGQNSQSPTSNHLPTSCPPTCPGYRWM
JN604233_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN604225_LHBs_P-F      LTIPQSLDSWWTSLSFLGETPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AF223964_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KY476330_LHBs_P-F      LTIPQSLDSWWTSRNFLGETPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KY476329_LHBs_P-F      LTIPRSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KT896494_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995120_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995116_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ638660_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KC494402_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KC494401_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843168_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
X75658_LHBs_C-F        LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KF199901_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KC494396_LHBs_P-F      LTMPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
HM627320_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KY476331_LHBs_P-F      LTIPRSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KY476327_LHBs_P-F      LTIPQNLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995097_LHBs_P-F      LTMPQSLDLWWTSLSFLEGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
X69798_LHBs_P-F        LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KY458062_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KY458061_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KX264497_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995107_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP718113_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP718107_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLXTSCPPTCPGYRWM
KP718104_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KM998715_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KM233681_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843203_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843202_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843191_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ586808_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KC494405_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KC494403_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KC494395_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KC494394_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KY476323_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KY382415_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KY382416_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KY382417_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843197_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843174_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KC494404_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KC494400_LHBs_P-F      LTIPQSLDSWWTSLNFLGRTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KF779236_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
MK058437_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KY476332_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KY476322_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KX264496_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995098_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843206_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843205_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843204_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843201_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843200_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843199_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843198_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843196_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843195_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843194_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843193_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843190_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843181_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843180_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843179_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843178_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843177_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843176_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843171_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843170_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843169_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843167_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843164_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ843163_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JX079936_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN792921_LHBs_P-F      LTIPQSLDSWWTSLNFLGGXPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN792922_LHBs_P-F      LTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995118_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995114_LHBs_P-F      RTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWT
DQ899150_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JN604211_LHBs_P-F      LTIPXXLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ899142_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
X75663_LHBs_P-F        LTIPQSLDSWWTSLNFLGGLPRCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995113_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KC494399_LHBs_P-F      LIMPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ899147_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ899143_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB116550_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995111_LHBs_P-F      LTIPKSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995117_LHBs_P-F      LKIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995106_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCLGQNSQSPTSNHLPTSCPPTCPGYRWM
FJ589066_LHBs_P-F      LTIPQSLDSWWTSLSFLEGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ899149_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JF439884_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
JF439885_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AY090455_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AY311369_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
MH051987_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
FJ589067_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB036915_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995123_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995125_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995119_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
MH051986_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995104_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP718111_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB036913_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB036905_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB036909_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB036910_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB036911_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB036912_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB036914_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB036916_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB036917_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB036918_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB036919_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB036920_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB116549_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AB116551_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995109_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP718106_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KX264498_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995101_LHBs_P-F      LTIPQSLDSWWTSLNFLGELPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP718112_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP718103_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KJ638659_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP718109_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995126_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995124_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
KP995105_LHBs_P-F      LTIPQSLDSWWTSLNFLGALPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
AY311370_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
DQ899148_LHBs_P-F      LTIPQSLDSWWTSLNFLGGLPGCPGQNSQSPTSNHLPTSCPPTCPGYRWM
                          *  *: **** .**   . * **** ******* * ** ******  

KJ638664_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPG----STTTSTGPC
AB036906_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLTNG-------TSTGPC
AB036907_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLTNG-------TSTGPC
AB036908_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLTNG-------TSTGPC
EF576808_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
JQ272888_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
JN688709_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
EU366132_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843225_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
AB365453_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGQC
KJ676694_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB365446_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
AB166850_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
AB214516_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843185_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLIPG----SSTTSTGPC
KJ843175_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
DQ823089_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
DQ823087_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
AF223965_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
AB365450_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
AB365449_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
JN688720_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
EF576812_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
DQ823086_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843209_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
AF223962_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
DQ776247_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
DQ823088_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
DQ823090_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
EU366116_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843207_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
JN811655_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843226_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KY382411_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KX264499_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843224_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843222_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843221_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843220_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843219_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843213_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843212_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843211_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843210_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843208_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843189_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KC494398_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
JX079937_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
JN688701_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
JN811656_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ843223_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
HE981181_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
FJ657528_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
FJ657519_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
FJ657522_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KJ586807_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KY476326_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KP995115_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ638662_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ638656_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPG----STTTSTGPC
KP718110_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AY090456_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
DQ899144_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
DQ899146_LHBs_P-F      CLPRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
DQ899145_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
JN792917_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB116654_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM585200_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB086397_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
FJ709457_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
FJ709462_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
JN604271_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
JN792918_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AY090458_LHBs_C-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AY090459_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AY090461_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM585186_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM585194_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM590471_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM590472_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AY179735_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB064316_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB116552_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
FJ709463_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
FJ709464_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
JN792920_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
JN792919_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
JN688703_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
JN688699_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
JN688691_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HQ378247_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM622135_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM590473_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM585199_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM585197_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM585196_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM585193_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM585192_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM585190_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM585189_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM585188_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM585187_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HE981183_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HE981182_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
FJ709494_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
FJ709465_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
FJ709460_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
FJ657529_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
FJ657525_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
EU670262_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
EU366133_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
EU366118_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
DQ823095_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
DQ823094_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
DQ823093_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
DQ823092_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AF223963_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPPLPG----STTTSTGPC
DQ823091_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
FJ709458_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
FJ709459_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM585191_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM585195_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM585198_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KC494397_LHBs_P-F      CRRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KY476328_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KY476325_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KY476324_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995110_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
JN604233_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTTTGPC
JN604225_LHBs_P-F      SLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AF223964_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KY476330_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KY476329_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KT896494_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995120_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995116_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPG----STTTSTGPC
KJ638660_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KC494402_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KC494401_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843168_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPG----STTTSTGPC
X75658_LHBs_C-F        CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG----STTTSTGPC
KF199901_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----TTTTSTGPC
KC494396_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
HM627320_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KY476331_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTTTSTGPC
KY476327_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995097_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
X69798_LHBs_P-F        CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KY458062_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KY458061_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KX264497_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995107_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP718113_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP718107_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP718104_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KM998715_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KM233681_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843203_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843202_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843191_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ586808_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KC494405_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KC494403_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KC494395_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KC494394_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KY476323_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KY382415_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KY382416_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KY382417_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843197_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843174_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KC494404_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KC494400_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPG----STTTSTGPC
KF779236_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
MK058437_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KY476332_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KY476322_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KX264496_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995098_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843206_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843205_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPG----STTTSTGPC
KJ843204_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843201_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843200_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843199_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843198_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843196_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843195_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843194_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843193_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843190_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843181_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843180_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843179_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843178_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843177_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843176_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843171_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843170_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPG----STTTSTGPC
KJ843169_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPG----STTTSTGPC
KJ843167_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----SMTTSTGPC
KJ843164_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ843163_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
JX079936_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
JN792921_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLXPG----STTTSTGPC
JN792922_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995118_LHBs_P-F      CLRRFIIFLFILLLCLTFLLVLLDYHGILPVCPLIPG----STTTSTGPC
KP995114_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
DQ899150_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPG----STTTSTGPC
JN604211_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
DQ899142_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
X75663_LHBs_P-F        CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995113_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KC494399_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
DQ899147_LHBs_P-F      CLRRFIIFLFILLQCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
DQ899143_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB116550_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995111_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLVDSQGMLPVCPLLPG----SMTTSTGPC
KP995117_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995106_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
FJ589066_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
DQ899149_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
JF439884_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
JF439885_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AY090455_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AY311369_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
MH051987_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
FJ589067_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB036915_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995123_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995125_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995119_LHBs_P-F      CLRRSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
MH051986_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995104_LHBs_P-F      CLRRFIIFLCILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP718111_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB036913_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLVDYRGMLPVCPLLPG----STTTSTGPC
AB036905_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB036909_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB036910_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB036911_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB036912_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB036914_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB036916_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB036917_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB036918_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB036919_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB036920_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB116549_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AB116551_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995109_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP718106_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KX264498_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995101_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP718112_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP718103_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KJ638659_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP718109_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995126_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995124_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
KP995105_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
AY311370_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPG----STTTSTGPC
DQ899148_LHBs_P-F      CLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPLLPG----STTTSTGPC
                       .  * **** *** ** *****:* .*:*****   *       *:** *

KJ638664_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AB036906_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AB036907_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AB036908_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
EF576808_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JQ272888_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JN688709_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
EU366132_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843225_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AB365453_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGKYLWEWASARFS
KJ676694_LHBs_P-F      KTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AB365446_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AB166850_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AB214516_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843185_LHBs_P-F      KTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843175_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
DQ823089_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
DQ823087_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AF223965_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AB365450_LHBs_P-F      KTCTTLAQGTXMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AB365449_LHBs_P-F      NTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JN688720_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
EF576812_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
DQ823086_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843209_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AF223962_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
DQ776247_LHBs_P-F      KTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFS
DQ823088_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
DQ823090_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
EU366116_LHBs_P-F      KTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843207_LHBs_P-F      KTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JN811655_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843226_LHBs_P-F      KXCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KY382411_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KX264499_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843224_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843222_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843221_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843220_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843219_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843213_LHBs_P-F      KTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843212_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843211_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843210_LHBs_P-F      KTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843208_LHBs_P-F      KTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843189_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KC494398_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JX079937_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JN688701_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JN811656_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843223_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HE981181_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
FJ657528_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
FJ657519_LHBs_P-F      KTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFS
FJ657522_LHBs_P-F      KTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ586807_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KY476326_LHBs_P-F      KTCTTLAQETSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KP995115_LHBs_P-F      KTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ638662_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ638656_LHBs_P-F      KTCTTLAQGTSMFPSCCCSRPSDGNCTCIPIPSSWALGKYLWEWASARFS
KP718110_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AY090456_LHBs_P-F      RTCTTLAQGTSMLPSCCCTKPSDGNCTCIPIPSSWALGKYLWEWASARFS
DQ899144_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
DQ899146_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
DQ899145_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JN792917_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AB116654_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM585200_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWDWASARFS
AB086397_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
FJ709457_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
FJ709462_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JN604271_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JN792918_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AY090458_LHBs_C-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AY090459_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AY090461_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM585186_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM585194_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM590471_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM590472_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AY179735_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AB064316_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AB116552_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
FJ709463_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
FJ709464_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JN792920_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JN792919_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JN688703_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JN688699_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JN688691_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HQ378247_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM622135_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM590473_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM585199_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM585197_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM585196_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM585193_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM585192_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM585190_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM585189_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM585188_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM585187_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HE981183_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HE981182_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
FJ709494_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
FJ709465_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
FJ709460_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
FJ657529_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
FJ657525_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
EU670262_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
EU366133_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
EU366118_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
DQ823095_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
DQ823094_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
DQ823093_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
DQ823092_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AF223963_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
DQ823091_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
FJ709458_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
FJ709459_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM585191_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM585195_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM585198_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KC494397_LHBs_P-F      KTCTTLAQGTSMVPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KY476328_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KY476325_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KY476324_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KP995110_LHBs_P-F      KTCTALAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JN604233_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
JN604225_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
AF223964_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KY476330_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KY476329_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KT896494_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KP995120_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KP995116_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ638660_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KC494402_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKFLWEWASARFS
KC494401_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843168_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
X75658_LHBs_C-F        KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KF199901_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASVRFS
KC494396_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
HM627320_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KY476331_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KY476327_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KP995097_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
X69798_LHBs_P-F        KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KY458062_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KY458061_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KX264497_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KP995107_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KP718113_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KP718107_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KP718104_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KM998715_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KM233681_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843203_LHBs_P-F      KTCTTLALGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843202_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843191_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ586808_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KC494405_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KC494403_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KC494395_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KC494394_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KY476323_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KY382415_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASXRFS
KY382416_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASXRFS
KY382417_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASXRFS
KJ843197_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843174_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KC494404_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KC494400_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KF779236_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
MK058437_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSEGNCTCIPIPSSWALGKYLWEWASARFS
KY476332_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KY476322_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KX264496_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KP995098_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843206_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFS
KJ843205_LHBs_P-F      KTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWA