HBVdb

Dataset for protein Pol of genotype F

[Download (right click)] [Edit] [Sequences] [Repertoires]

253 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KJ638664_Pol_P-F      MPLSYPHFRKQGLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
EF576808_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLRLPNV
DQ899150_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNCRVAEDLNLQLPNV
DQ899147_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
DQ899145_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
DQ899144_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
DQ899146_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FJ589066_Pol_P-F      MPLSYPHFRKLLLLDH--EAGPLEEELPRLADEDLNRRVAEDLNLHLPNV
DQ899149_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNGRVAEDLNLQLPNV
AB036915_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036905_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036909_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036911_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036912_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036913_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036914_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036916_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036917_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036918_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036919_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036920_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FJ589067_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPDV
AB365453_Pol_P-F      MPLSYPHFLKLLLLDH--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB166850_Pol_P-F      MPLSYPYFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ899142_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
DQ899143_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
DQ899148_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AY090455_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQVPNV
DQ823087_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPDV
AF223962_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ823089_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ657522_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ823090_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ657519_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAKDLNLQLPNV
DQ776247_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
EU366116_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ657528_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HE981181_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AY090458_Pol_C-F      MPLSYPHFRKLLLLDE--EAGLLEEELPRLADEGLNRRVAEDLNLQLPNV
EU366132_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB214516_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB116654_Pol_P-F      MPLSYPHFRRLLLLED--DAGPLEEELPRLADEGLNRRVAEDLNLQLPDV
JN688720_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AY311370_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRVADEGLNRRVAEDLNLQLPNV
AY311369_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
AY090459_Pol_P-F      MPLSYPHFRKLLLLDD--EAGLLEEELPRLADEGLNRRVAEDLNLQLPHV
AY090461_Pol_P-F      MPLSYPHFRKLLLLDD--EAGLLEEELPRLADEGLNRRVAEDLNLQLPNV
AB365450_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB365449_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB116551_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB036910_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ676694_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLQLPDV
FJ657525_Pol_P-F      MPLSYPHFRKLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLQLPDV
DQ823086_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB365446_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPTV
JN688709_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLHLPNV
AB116549_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AF223965_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
EF576812_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ638660_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEVELPRLADEGLNRRVAEDLNLQLPNV
HM590474_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585194_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN792918_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ823092_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ823093_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
EU366133_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585197_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN792920_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585196_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ709494_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585190_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585199_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ709462_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ709460_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ709459_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ709457_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ823095_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ823094_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
EU366118_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ657529_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ709458_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ709464_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ709465_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HE981182_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HE981183_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585186_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585187_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585188_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585189_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585191_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585195_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585198_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM590471_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM590472_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM590473_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM622135_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HQ378247_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN792919_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ823091_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
JN688691_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN688699_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN688703_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ709463_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB064316_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB116552_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AF223963_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AY179735_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585192_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585193_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
X75663_Pol_P-F        MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN792917_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN688701_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ638663_Pol_P-F      MPLSYPHFRKLLLLDD--ESGPLEEELPRLADEGLNRRVAEDLNLQIPDV
KJ638662_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585200_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ823088_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
X75658_Pol_C-F        MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476326_Pol_P-F      MPLSYPHFRKLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995118_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KP995117_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995111_Pol_P-F      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPDV
KJ843225_Pol_P-F      MPLSYPHFRKLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLHLPNV
KP995097_Pol_P-F      MPLSYQCFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KJ843220_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AF223964_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995123_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KP995101_Pol_P-F      MPLSYPHFRKLLLLED--EAGPLEEELPRLADEDLNRRVAEDLNLRLPDV
HM627320_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB086397_Pol_P-F      MPLSYPHFRKLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLHLPNV
KP995126_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995125_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KP995124_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995119_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP718111_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MH051987_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MH051986_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY382411_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ843226_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843224_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ843222_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ843221_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ843219_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ843213_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843212_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ843210_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843208_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843185_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KC494398_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843211_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ843207_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843175_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KC494394_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAADLNLQLPNV
JX079937_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPXEEELPRLADEGLNRRVAEDLNLQLPNV
KX264498_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KP718106_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPBV
KJ843209_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JQ272888_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLHLPDV
KP995109_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995106_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KP718103_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843223_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN811655_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KP995114_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KP995105_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ843189_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KX264499_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995113_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KP718112_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP718109_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ638656_Pol_P-F      MPLSYPHFRKRLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN811656_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ638659_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KP995120_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KC494401_Pol_P-F      MPLSYPHFRKLLLLDD--QAGPLEKELPRLADEDLNRRVAADLNLQLPNV
KY476329_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KT896494_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLHLPNV
KP995104_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KJ586807_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KC494396_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KC494395_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLQLPNV
KY476330_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQVPDV
KC494405_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAADLNLQLPNV
KC494400_Pol_P-F      MPLSYPHFRKLLLLDD--EAGLLEEELPRLADEVLNRRVAEDLNLQLPNV
KY476327_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995116_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843177_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ638657_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KC494399_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KY382416_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY382415_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY382417_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995110_Pol_P-F      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KP718107_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLQLPNV
KF779236_Pol_P-F      MPLSYPHFRKLLLLDDGTEAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KC494404_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAKDLNLQLPNV
KC494403_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAADLNLQLPNV
KC494397_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAADLNLQLPNV
KP995115_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLHLPDV
KP995107_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KJ843178_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
X69798_Pol_P-F        MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KX264497_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KC494402_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
JX079936_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLHLPTV
KY476324_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLQLPDV
KP718110_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843197_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843191_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLABEDLNRRVAABLNLQLPNV
KF199901_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476331_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KM233681_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ586808_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476332_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995098_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843163_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476328_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476325_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476323_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476322_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY458061_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KM998715_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843202_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843193_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843180_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MK058437_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KX264496_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP718113_Pol_P-F      MPLSYPHFRKLLLLDD--EAGLLEEELPRLADEGLNRRVAEDLNLQLPNV
KP718104_Pol_P-F      MPLSYPHFRKLLLLDD--EAGLLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843206_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843205_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843204_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843203_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843201_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843200_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843199_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843198_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843196_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843195_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843190_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843179_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843176_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843174_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843171_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843170_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843169_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843167_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY458062_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843181_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN792922_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KX757665_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843194_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN792921_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLRLPDV
KJ843164_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
                      *****  * .  **:   ::*  * ****:* * ** ***  ***.:* *

KJ638664_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNADWLTPSFPDIHLHQDLIHKCEQCVGP
EF576808_Pol_P-F      SIPWTHRVGNFTGLYSSTVPTFNPHWLTPSFPDIHLHQDLISKCEQFVGP
DQ899150_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPNIHLHQDLISKCEQLVGP
DQ899147_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
DQ899145_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
DQ899144_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
DQ899146_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
FJ589066_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPNWLTPSFPDIHLHQDLISKCEQFVGP
DQ899149_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036915_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036905_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036909_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036911_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036912_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036913_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036914_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036916_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036917_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036918_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036919_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036920_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
FJ589067_Pol_P-F      SIPYPXLMGXCTGLYSSTVPAFNPNWLTPSFPDIHLHQDMISKCEQFVGP
AB365453_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AB166850_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
DQ899142_Pol_P-F      SIPWTHKVGNFTGLYSSTGPAFNPNWSTPSFPDIHWHQNLISKCEQFVGP
DQ899143_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQNLISKCEQFVGP
DQ899148_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISRCEQFVGP
AY090455_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQNLISKCEQFVGP
DQ823087_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAYNPHWLTPSFPDIHLHQDLISKCEQFVGP
AF223962_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
DQ823089_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWVTPSFPDIHLHQDLISKCERFVGP
FJ657522_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCERFVGP
DQ823090_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWVTPSFPDIHLHQDLISKCEQFVGP
FJ657519_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
DQ776247_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
EU366116_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
FJ657528_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
HE981181_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AY090458_Pol_C-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPNIHLHQDLINKCEQFVGP
EU366132_Pol_P-F      SIPWTHKVGNFTGLYSSTVPSFNPHWLTPHFPDIHLHQDLISKCEQFVGP
AB214516_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AB116654_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
JN688720_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AY311370_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AY311369_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQNLISKCEQFVGP
AY090459_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPNWLTPSFPDIHLHQDLIHKCEQFVGP
AY090461_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
AB365450_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AB365449_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AB116551_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036910_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KJ676694_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
FJ657525_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
DQ823086_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AB365446_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
JN688709_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWETPSFPDIHLHQDLISKCEQFVGP
AB116549_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AF223965_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
EF576812_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ638660_Pol_P-F      SIPWTHKVGNFTGLYSATVPTFNPNWLTPSFPDIHLHQDLISKCEQFVGP
HM590474_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585194_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
JN792918_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHEDLIHKCEQFVGP
DQ823092_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
DQ823093_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
EU366133_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585197_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
JN792920_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585196_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ709494_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPNWLTPSFPDIHLHQDLIHKCEQFVGP
HM585190_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPNWLTPSFPDIHLHQDLIHKCEQFVGP
HM585199_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPNWLTPSFPDIHLHQDLIHKCEQFVGP
FJ709462_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHZDLIHKCEQFVGP
FJ709460_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWVTPSFPDIHLHQDLIHKCEQFVGP
FJ709459_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ709457_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
DQ823095_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
DQ823094_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
EU366118_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ657529_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ709458_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ709464_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ709465_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HE981182_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HE981183_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585186_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585187_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585188_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585189_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585191_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585195_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585198_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM590471_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM590472_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM590473_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM622135_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HQ378247_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
JN792919_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
DQ823091_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
JN688691_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIQKCEQFVGP
JN688699_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIQKCEQFVGP
JN688703_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIQKCEQFVGP
FJ709463_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
AB064316_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHEDLIHKCEQFVGP
AB116552_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
AF223963_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
AY179735_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585192_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585193_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
X75663_Pol_P-F        SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDMISKCEQFVGP
JN792917_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHEDLIHKCEQFVGP
JN688701_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ638663_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNSDWLTPSFPDIHLHEDLIHKCEQFVGP
KJ638662_Pol_P-F      SIPWTHKVGNFTGLYSATVPTFNPNWLTPSFPDIHLHQDLISKCEQFVGP
HM585200_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
DQ823088_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
X75658_Pol_C-F        SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KY476326_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP995118_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP995117_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP995111_Pol_P-F      NIPWTHKVGNFTGLYSSTVPVFNPNWVTPCFPNIHLHQDLISKCEQFVGP
KJ843225_Pol_P-F      SIPWTHKVGDFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KP995097_Pol_P-F      SIPWTHKVGSFTGLYSSTVPAFNPDWSIPSFPNIHLHQNLISKCEQFVGP
KJ843220_Pol_P-F      SIPWTHKXGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AF223964_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KP995123_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPNIHLHQDLISKCEQFVGP
KP995101_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWVTPSFPDIHLHQDLISKCEQFVGP
HM627320_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
AB086397_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KP995126_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP995125_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPNIHLHQDLISKCEQFVGP
KP995124_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP995119_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP718111_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
MH051987_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
MH051986_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KY382411_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843226_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843224_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843222_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843221_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843219_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843213_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCERFVGP
KJ843212_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843210_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843208_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843185_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KC494398_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843211_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843207_Pol_P-F      SIPWTHKXGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCERFVGP
KJ843175_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KC494394_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPFFPDIHLHQDLISNCEQFVGP
JX079937_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPNIHLHQDLISKCEQFVGP
KX264498_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP718106_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQELISKCEQFVGP
KJ843209_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWVTPSFPDIHLHQDLISKCEQFVGP
JQ272888_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KP995109_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLIAKCEQFVGP
KP995106_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP718103_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KJ843223_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
JN811655_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KP995114_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWATPSFPDIHLHQNLISKCEQFVGP
KP995105_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWVTPSFPDIHLHQDLISKCEQFVGP
KJ843189_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KX264499_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KP995113_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQNLISKCEQFVGP
KP718112_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP718109_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KJ638656_Pol_P-F      SIPRTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
JN811656_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ638659_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP995120_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQNLISKCEQFVGP
KC494401_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KY476329_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPEWLTPSFPDIHLHEDLIHKCEQFVGP
KT896494_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KP995104_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KJ586807_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KC494396_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KC494395_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KY476330_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KC494405_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KC494400_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIQKCEQFVGP
KY476327_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KP995116_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843177_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ638657_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNSDWLTPSFPDIHLHZDLIHKCEQFVGP
KC494399_Pol_P-F      SIPWTHKVGNFTGLYSSTVPVFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KY382416_Pol_P-F      SIPWTHKXGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY382415_Pol_P-F      SIPWTHKXGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY382417_Pol_P-F      SIPWTHKXGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KP995110_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQNLISKCEQFVGP
KP718107_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNSDWVTPSFPDIHLHEDLIHKCEQFVGP
KF779236_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KC494404_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQNLIQKCEQFVGP
KC494403_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KC494397_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KP995115_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQNLISKCEQFVGP
KP995107_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPNWSTPSFPDIHLHQNLISKCEQFVGP
KJ843178_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
X69798_Pol_P-F        SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KX264497_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KC494402_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
JX079936_Pol_P-F      SIPWTHKEGXFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY476324_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPEWLTPSFPDIHLHQDLIHKCEQFVGP
KP718110_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNSDWLTPSFPDIHLHEDLIQKCEQFVGP
KJ843197_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843191_Pol_P-F      SIPWTHKXGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KF199901_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY476331_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KM233681_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ586808_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY476332_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KP995098_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843163_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY476328_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY476325_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY476323_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY476322_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY458061_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KM998715_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843202_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843193_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843180_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MK058437_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KX264496_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KP718113_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KP718104_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDCLTPSFPDIHLHQDLIHKCEQFVGP
KJ843206_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843205_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843204_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843203_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843201_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843200_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843199_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843198_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843196_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843195_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843190_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843179_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843176_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843174_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843171_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843170_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIQKCEQFVGP
KJ843169_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843167_Pol_P-F      SIPWTHKXGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY458062_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843181_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
JN792922_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KX757665_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843194_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIQKCEQFVGP
JN792921_Pol_P-F      SIPWTHXVGNFTGLYSSTVPXFNPBWXTPSFPDIHLHQDLXXKCEQFVGP
KJ843164_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPAFPDIHLHQDLIHKCEQFVGP
                      .** .   *  *****:* * :*.    * **:** * ::  .**. ***

KJ638664_Pol_P-F      LTKNEMRRLKLVMPARFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
EF576808_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
DQ899150_Pol_P-F      FTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYLEHAVNHYFKTRHYL
DQ899147_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
DQ899145_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
DQ899144_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYREHAVNHYFKTRHYL
DQ899146_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
FJ589066_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHVVNHYFKTRHYL
DQ899149_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
AB036915_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPIEKGIKPYYPEHSVNHYFKTRHYL
AB036905_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036909_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036911_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036912_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036913_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036914_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036916_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036917_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036918_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036919_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036920_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
FJ589067_Pol_P-F      LTKNELRRLKLVMPARFYPKLTKYFLLEKGIKPYYPEQAVNHYFKTRHYL
AB365453_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AB166850_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
DQ899142_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPTDKGIKPYYPEHAVNHYFKTRHYL
DQ899143_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPTDKGIKPYYPEHAVNHYFKTRHYL
DQ899148_Pol_P-F      LTKNELRRLKLIMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
AY090455_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
DQ823087_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AF223962_Pol_P-F      LTKNELRRLKLIMPSRFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
DQ823089_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
FJ657522_Pol_P-F      LTKNELRRLKLIMPPKFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
DQ823090_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
FJ657519_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
DQ776247_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
EU366116_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
FJ657528_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
HE981181_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AY090458_Pol_C-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
EU366132_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AB214516_Pol_P-F      LTKNELRRLKLIMPARIFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AB116654_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN688720_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFQTRHYL
AY311370_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AY311369_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
AY090459_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
AY090461_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
AB365450_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AB365449_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AB116551_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
AB036910_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KJ676694_Pol_P-F      LTKNELRRLKLVMPARFFPKHTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
FJ657525_Pol_P-F      LTKNELRRLKLVMPSRFFPRVTKYFPLEKGIKPYYPDNVVNHYFKTRHYL
DQ823086_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AB365446_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
JN688709_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AB116549_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
AF223965_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
EF576812_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ638660_Pol_P-F      LTKNELRRLKLVMPARFFPKVTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
HM590474_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HM585194_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN792918_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
DQ823092_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
DQ823093_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
EU366133_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HM585197_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN792920_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HM585196_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
FJ709494_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM585190_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM585199_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
FJ709462_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
FJ709460_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
FJ709459_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
FJ709457_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
DQ823095_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
DQ823094_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
EU366118_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
FJ657529_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
FJ709458_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
FJ709464_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
FJ709465_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HE981182_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HE981183_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM585186_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HM585187_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM585188_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM585189_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM585191_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM585195_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM585198_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM590471_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HM590472_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HM590473_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM622135_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HQ378247_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN792919_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
DQ823091_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN688691_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN688699_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN688703_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
FJ709463_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
AB064316_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
AB116552_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
AF223963_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
AY179735_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HM585192_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HM585193_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
X75663_Pol_P-F        LTKNELRRLKLVMPARFYPKHTKYFLLEKGIKPYYPDQAVNHYFQTRHYL
JN792917_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN688701_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ638663_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPLEKGIKPYYPDNVVNHYFKTRHYL
KJ638662_Pol_P-F      LTXNELRRLKLVMPARFFPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
HM585200_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
DQ823088_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
X75658_Pol_C-F        LTKNELRRLKLIMPARFFPKLTKYFPLEKDIKPYYPEHAVNHYFQTRHYL
KY476326_Pol_P-F      LTKNELRRLKLXMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KP995118_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP995117_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP995111_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEQAVNHYFKTRHYL
KJ843225_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KP995097_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPIDKGIKPYYPEHAVNHYFKTRHYL
KJ843220_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AF223964_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP995123_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP995101_Pol_P-F      LTKNELRKFKLIMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKARHYL
HM627320_Pol_P-F      LTKNELRRLKLVMPSRFXPKXTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
AB086397_Pol_P-F      LTKHELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP995126_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KP995125_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP995124_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KP995119_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KP718111_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
MH051987_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
MH051986_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KY382411_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843226_Pol_P-F      LTKNEFRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843224_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843222_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843221_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843219_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843213_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843212_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843210_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843208_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843185_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KC494398_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843211_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843207_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843175_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KC494394_Pol_P-F      LTKNELQRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
JX079937_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KX264498_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
KP718106_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KJ843209_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
JQ272888_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPHYPEHAVNHYFKTRHYL
KP995109_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP995106_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP718103_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KJ843223_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
JN811655_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KP995114_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KP995105_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPHYPEHVVNHYFKTRHYL
KJ843189_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KX264499_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KP995113_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KP718112_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP718109_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KJ638656_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPLEKGIKPYYPDNVVNHYFKTRHYL
JN811656_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ638659_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP995120_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KC494401_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KY476329_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KT896494_Pol_P-F      LTKNELRRLKLVMPSRFYPKVTKYFPLDKGIKPYYPEHAVNHYFKTRHYL
KP995104_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KJ586807_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KC494396_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KC494395_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KY476330_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPLEKGIKPYYPDNVVNHYFKTRHYL
KC494405_Pol_P-F      LTKNEVRRLKLVMPARLYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KC494400_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY476327_Pol_P-F      LTKNELRRLKLVMPSRFFPKATKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP995116_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843177_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPIEKGIKPYYPDNVVNHYFKTRHYL
KJ638657_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KC494399_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KY382416_Pol_P-F      LTKNELRRLKLVMPSXFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTXHYL
KY382415_Pol_P-F      LTKNELXXLKLVMPSXFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTXHYL
KY382417_Pol_P-F      LTKNELXXLKLVMPSXFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTXHYL
KP995110_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KP718107_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KF779236_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KC494404_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KC494403_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KC494397_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KP995115_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KP995107_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KJ843178_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPIEKGIKPYYPDNVVNHYFKTRHYL
X69798_Pol_P-F        LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KX264497_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KC494402_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
JX079936_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPIEKGIKPYYPDNVVNHYFKTRHYL
KY476324_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP718110_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843197_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843191_Pol_P-F      LTKNELRXLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KF199901_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY476331_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KM233681_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ586808_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY476332_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP995098_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843163_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY476328_Pol_P-F      LTKXELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY476325_Pol_P-F      LTKNEMRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY476323_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY476322_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY458061_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KM998715_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843202_Pol_P-F      LTKNELRRLKLIMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843193_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843180_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MK058437_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KX264496_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP718113_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP718104_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843206_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843205_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843204_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843203_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843201_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843200_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843199_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843198_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843196_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843195_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843190_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843179_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843176_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843174_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843171_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
KJ843170_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843169_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843167_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY458062_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843181_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN792922_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KX757665_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843194_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN792921_Pol_P-F      LTKNELRRLKLVMPXRFXPKVTKYFPMXKGIKPYYPXXXVNHYFKTRHYL
KJ843164_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
                      :*  *.  :** **  : *. ****   *.***:*    *****:: ***

KJ638664_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
EF576808_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDEKGHGTESLC
DQ899150_Pol_P-F      HTLWKAGILYKRESTGSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
DQ899147_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKRHGTESLC
DQ899145_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKRHGTESLC
DQ899144_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQEVQHGSTSLNDKKRHGTESLC
DQ899146_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKRHGTESLC
FJ589066_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
DQ899149_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNHKKGHGTESFC
AB036915_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036905_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036909_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036911_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036912_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036913_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036914_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036916_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036917_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036918_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036919_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036920_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
FJ589067_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB365453_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AB166850_Pol_P-F      HTLWKAGILYKRESSRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
DQ899142_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
DQ899143_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
DQ899148_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AY090455_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYTWEQELQHGSTSLNDTKRHGTESLC
DQ823087_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AF223962_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
DQ823089_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
FJ657522_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
DQ823090_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
FJ657519_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
DQ776247_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
EU366116_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
FJ657528_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
HE981181_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AY090458_Pol_C-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDTKGHGTESLC
EU366132_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AB214516_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AB116654_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKRHGTESLC
JN688720_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AY311370_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AY311369_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYTWEQELQHGSTSLNDTKRHGTESLC
AY090459_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDTKGHGTESLC
AY090461_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDTKGHGTESLC
AB365450_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AB365449_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGYGTESLC
AB116551_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036910_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KJ676694_Pol_P-F      HTLWKAGILYKRESTLSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
FJ657525_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
DQ823086_Pol_P-F      HTLWKAGILYKRESTRSESFCGSPYSWEQELQHGSTSLNDEKGHGTESLC
AB365446_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
JN688709_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AB116549_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AF223965_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
EF576812_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ638660_Pol_P-F      HTLWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNDKKRHGTESFC
HM590474_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHVTESLC
HM585194_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN792918_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
DQ823092_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
DQ823093_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
EU366133_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585197_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN792920_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585196_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ709494_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585190_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585199_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ709462_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ709460_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ709459_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSIYDSKGHGTESLC
FJ709457_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
DQ823095_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
DQ823094_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
EU366118_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ657529_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ709458_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ709464_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ709465_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HE981182_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HE981183_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585186_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585187_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585188_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585189_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585191_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585195_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585198_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM590471_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM590472_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM590473_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM622135_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HQ378247_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN792919_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
DQ823091_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN688691_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN688699_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN688703_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ709463_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
AB064316_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
AB116552_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
AF223963_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
AY179735_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585192_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585193_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
X75663_Pol_P-F        HTLWKAGILYKRETTRSASFCGSQYSWEQELQHGSTSLNDKKGHGTESFC
JN792917_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN688701_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ638663_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ638662_Pol_P-F      HTLWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNDKKRHGTESFC
HM585200_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
DQ823088_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
X75658_Pol_C-F        HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KY476326_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KP995118_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDSKGHGTESFC
KP995117_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP995111_Pol_P-F      HTLWKAGVLYKRESTRSASFCGSPYSWEQKLQHGSTSLNDKKGHGTESFC
KJ843225_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KP995097_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KJ843220_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AF223964_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KP995123_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP995101_Pol_P-F      HTLWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
HM627320_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
AB086397_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KP995126_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP995125_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP995124_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP995119_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP718111_Pol_P-F      HTLWKAGILYKRDSTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
MH051987_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
MH051986_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KY382411_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843226_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843224_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843222_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843221_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843219_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843213_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843212_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843210_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843208_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843185_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESHC
KC494398_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKGHGTESLC
KJ843211_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843207_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843175_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESHC
KC494394_Pol_P-F      HTLWKAGILYKRDNTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
JX079937_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KX264498_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP718106_Pol_P-F      HTLWKXGILYKXESTRXASFCGSPYSWEQKLQHGSTSLNDKKGHGTESFC
KJ843209_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDEKGHGTESLC
JQ272888_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KP995109_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFR
KP995106_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQEIQHGSTSLNDKKGHGTESFC
KP718103_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLHDKKGHGTESFC
KJ843223_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
JN811655_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KP995114_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQKLQHGSTSLNDTKRQGTKSLC
KP995105_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDEKGHGTESFC
KJ843189_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KX264499_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KP995113_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KP718112_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP718109_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KJ638656_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN811656_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ638659_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP995120_Pol_P-F      HTLWKAGILYRRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KC494401_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KY476329_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KT896494_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESXC
KP995104_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KJ586807_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KC494396_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KC494395_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KY476330_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQKLQHGSTSINDSKGHGTESLC
KC494405_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KC494400_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY476327_Pol_P-F      HTLWKAGILYKRESTHSASFCGSPYSWEQEPQHGSTSINDSKGHGTESLC
KP995116_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843177_Pol_P-F      HTLWKAGILYERESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ638657_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KC494399_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KY382416_Pol_P-F      HTLWKAGILYKXXSTRXASFXGSPYSWEQELQHGSTSINDSKGHGTESLC
KY382415_Pol_P-F      HTLWKAGILYKXXSTRXASFXGSPYSWEQELQHGSTSINDSKGHGTESLC
KY382417_Pol_P-F      HTLWKAGILYKXXSTRXASFXGSPYSWEQELQHGSTSINDSKGHGTESLC
KP995110_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYTWEQELQHGSTSLNDTKRHGTESLC
KP718107_Pol_P-F      HTLWKSGILYKRESTRSASFCGSPYSWEQKLQHGSTSIHDSKGHGTESLC
KF779236_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KC494404_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KC494403_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KC494397_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KP995115_Pol_P-F      HTLWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNETKRHGTESLC
KP995107_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KJ843178_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
X69798_Pol_P-F        HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KX264497_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KC494402_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
JX079936_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY476324_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KP718110_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843197_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843191_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KF199901_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY476331_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KM233681_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ586808_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY476332_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KP995098_Pol_P-F      HTLWKAGILYKRESARSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843163_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY476328_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY476325_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY476323_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY476322_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY458061_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KM998715_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843202_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843193_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843180_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MK058437_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KX264496_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KP718113_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDTKGHGTESLC
KP718104_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDTKGHGAESLC
KJ843206_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843205_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843204_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843203_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843201_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843200_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843199_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843198_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843196_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843195_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843190_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843179_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843176_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843174_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843171_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843170_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843169_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843167_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY458062_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843181_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN792922_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KX757665_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDTKGHGTESLC
KJ843194_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN792921_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSXNDXKXHGTESLC
KJ843164_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
                      ***** *:**   .:   ** ** *:***: ******    *   ::*  

KJ638664_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRTWV
EF576808_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLWSRV
DQ899150_Pol_P-F      AQSSGLLSRPSGGSDIQSKFQQFRVGLQHKQGQLANGKQGRS-GRLRSRV
DQ899147_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRIRSRV
DQ899145_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRIRSRV
DQ899144_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRIRSRV
DQ899146_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRIRSRV
FJ589066_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRPRV
DQ899149_Pol_P-F      AQSSGLLARPSAGSGIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
AB036915_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGRS-GRLRPRV
AB036905_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGRS-GRLRPRV
AB036909_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGRS-GRLRPRV
AB036911_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGRS-GRLRPRV
AB036912_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGRS-GRLRPRV
AB036913_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGRS-GRLRPRV
AB036914_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGRS-GRLRPRV
AB036916_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGRS-GRLRPRV
AB036917_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGRS-GRLRPRV
AB036918_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGRS-GRLRPRV
AB036919_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGRS-GRLRPRV
AB036920_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGRS-GRLRPRV
FJ589067_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGHLANGKQGRS-GRLRSRV
AB365453_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
AB166850_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GSIRSRV
DQ899142_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
DQ899143_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
DQ899148_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
AY090455_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
DQ823087_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
AF223962_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
DQ823089_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
FJ657522_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
DQ823090_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
FJ657519_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
DQ776247_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
EU366116_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
FJ657528_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGRS-GRLRSRV
HE981181_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
AY090458_Pol_C-F      TQSSGILARPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWF
EU366132_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
AB214516_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GSIRSRV
AB116654_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
JN688720_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
AY311370_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
AY311369_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
AY090459_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
AY090461_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
AB365450_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
AB365449_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
AB116551_Pol_P-F      AQSPGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
AB036910_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KJ676694_Pol_P-F      TQSSGILSRPSAGSSIQSKFQQSRLGLQQKQGQLANGKQGRS-GGLRSRV
FJ657525_Pol_P-F      AQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
DQ823086_Pol_P-F      AQSTGILSRXSAGSSFQSKFQQSRLGPQQKQGHLANGKQGRS-GRLRSRV
AB365446_Pol_P-F      AQSAGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
JN688709_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
AB116549_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
AF223965_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
EF576812_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
KJ638660_Pol_P-F      AQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRLRSRV
HM590474_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM585194_Pol_P-F      TQSSGILSRPSAGSSIQSKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
JN792918_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
DQ823092_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGRS-GRIRSWV
DQ823093_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGRS-GRIRSWV
EU366133_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM585197_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
JN792920_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM585196_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
FJ709494_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM585190_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM585199_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
FJ709462_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
FJ709460_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGRS-GRIRSWV
FJ709459_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
FJ709457_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
DQ823095_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
DQ823094_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
EU366118_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
FJ657529_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
FJ709458_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
FJ709464_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGRS-GRIRSWV
FJ709465_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HE981182_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HE981183_Pol_P-F      TQSSGILSRPSVGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM585186_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM585187_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM585188_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM585189_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM585191_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM585195_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM585198_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM590471_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM590472_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM590473_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM622135_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGRS-GRIRSWV
HQ378247_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGRS-GRIRSWV
JN792919_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
DQ823091_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
JN688691_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
JN688699_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
JN688703_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
FJ709463_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
AB064316_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
AB116552_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
AF223963_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
AY179735_Pol_P-F      TQSSGILSRPSAGSSFQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM585192_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
HM585193_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
X75663_Pol_P-F        AQSTGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
JN792917_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
JN688701_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGRS-GRLRSRV
KJ638663_Pol_P-F      TQSAGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGQQGRS-GRIRSWV
KJ638662_Pol_P-F      AQSSGILSRXSAGSSIQGKFQQSRLGLQQKQGQLANGKQGMDRGRLRSRV
HM585200_Pol_P-F      TQSSGILSRPSAGSSIQSKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
DQ823088_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGRS-GRLRSRV
X75658_Pol_C-F        AQSTGILSRPSTGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
KY476326_Pol_P-F      AQSSGIPSRPSAGSSFQSKFQQSRLGLQQQQGHLANGKQGRS-GRLRSRV
KP995118_Pol_P-F      AQSSGLLARPSAGSVIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KP995117_Pol_P-F      AQSSGLLARPSVGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KP995111_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KJ843225_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQPRLGLQQKQGHLANGKQGRS-GRLRSRV
KP995097_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KJ843220_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
AF223964_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KP995123_Pol_P-F      AQSSGLLARPSAGSTIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KP995101_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
HM627320_Pol_P-F      TQSSGILSRPSAGSSIQSKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
AB086397_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSRV
KP995126_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KP995125_Pol_P-F      AQSSGLLARPSAGSTIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KP995124_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GKLRSRV
KP995119_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KP718111_Pol_P-F      AQSSGLLARPSAGSFIQSKYQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
MH051987_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
MH051986_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KY382411_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGRS-GRLRSRV
KJ843226_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GKLRSRV
KJ843224_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGRS-GRLRSRV
KJ843222_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGRS-GRLRSRV
KJ843221_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGRS-GRLRSRV
KJ843219_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGRS-GRLRSRV
KJ843213_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
KJ843212_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGRS-GRLRSRV
KJ843210_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
KJ843208_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
KJ843185_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
KC494398_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
KJ843211_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGRS-GRLRSRV
KJ843207_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
KJ843175_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
KC494394_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
JX079937_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
KX264498_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGRS-GRLRPRV
KP718106_Pol_P-F      AQSSGLPARPSAGSAIQSKFQQSRLGLQHKQGZLANGKQGRS-GRLRSRV
KJ843209_Pol_P-F      AQSTGILARTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
JQ272888_Pol_P-F      AQSAGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
KP995109_Pol_P-F      AQSPGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KP995106_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRARV
KP718103_Pol_P-F      AQSSGLLARPSAGSAVQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KJ843223_Pol_P-F      AQSTGILSRPSAGSAFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
JN811655_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGRS-GRLRSRV
KP995114_Pol_P-F      AQSSGILSGPSAGSAIQSKFQQSRLGLQHEQGQLANGKQGRS-GRLRSRV
KP995105_Pol_P-F      AQSSGLLTRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRPRV
KJ843189_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
KX264499_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
KP995113_Pol_P-F      AQPSGILSRPSAGSAIQNKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KP718112_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KP718109_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KJ638656_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
JN811656_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGRS-GRLRSRV
KJ638659_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KP995120_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KC494401_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KY476329_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KT896494_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KP995104_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KJ586807_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KC494396_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KC494395_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KY476330_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KC494405_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KC494400_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KY476327_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KP995116_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGKS-GRLRSWV
KJ843177_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ638657_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KC494399_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHQQGQLANGKQGRS-GRLRSRV
KY382416_Pol_P-F      TQSSGILSXPSAGSSIQGKFQQSRLGLQQXQGHLANGKQGRS-GRIRSWV
KY382415_Pol_P-F      TQSSGILSXPSAGSSIQGKFQQSRLGLQQXQGHLANGKQGRS-GRIRSWV
KY382417_Pol_P-F      TQSSGILSXPSAGSSIQGKFQQSRLGLQQXQGHLANGKQGRS-GRIRSWV
KP995110_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KP718107_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGEQGRS-GRIRSWV
KF779236_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGPLANSKQGRS-GRIRSWV
KC494404_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KC494403_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KC494397_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KP995115_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KP995107_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GSLRSRV
KJ843178_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
X69798_Pol_P-F        AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KX264497_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KC494402_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
JX079936_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KY476324_Pol_P-F      TQSSGILSRPSTGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KP718110_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843197_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843191_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGRS-GRLRSRV
KF199901_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KY476331_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KM233681_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ586808_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KY476332_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KP995098_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843163_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KY476328_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIWSRV
KY476325_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIWSRV
KY476323_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KY476322_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KY458061_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGRS-GRIRSWV
KM998715_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGRS-GRIRSWV
KJ843202_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843193_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843180_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGRS-GRIRSWV
MK058437_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KX264496_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KP718113_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KP718104_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843206_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843205_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843204_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843203_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843201_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843200_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843199_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843198_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843196_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843195_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843190_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843179_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843176_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843174_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843171_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843170_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843169_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843167_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KY458062_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGRS-GRIRSWV
KJ843181_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGRS-GRIRSWV
JN792922_Pol_P-F      TQSSGILSRPSAGSSXQGKFQQSRLGLQQKQGQLANGKQGRS-GSIRSWV
KX757665_Pol_P-F      TQSSGILSRPSAGSSIQGRFQQSRLGLQQKQGQLANGKQGRS-GRIRSWV
KJ843194_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGRS-GRIRSWV
JN792921_Pol_P-F      XQSSGILSRPSAGSXXQXKFQQSRLGLQXKQGQLANGKQGRS-GXXRSXV
KJ843164_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGRS-GRIRSWV
                       *..*: :  * **  * .:** *:* *  ** ***.:** . *  .. .

KJ638664_Pol_P-F      HTPSRWPVGVEPTGTGCAYNIASRSASCFHQSAV-GKXTPSLSTSERHSS
EF576808_Pol_P-F      HTPTRWPVGVEPSGTRYPNNLASESASCFHQSAVREEANPSLSTSKRHTS
DQ899150_Pol_P-F      HTPTRWPDGVEPSGTGCFNNLASRSASCFHQSADREKANPSLSTSKRHTS
DQ899147_Pol_P-F      HTPTRWPAGVEPSGTRYVNNLASRSASCFHQSAVREKANPSLSTCKRHSS
DQ899145_Pol_P-F      HTPTRWPAGVEPSGTRYVNNLASRSASCFHQSAVREKANPSLSTSKRHSS
DQ899144_Pol_P-F      HTPTRWPAGVEPSGTRYVNNLASRSASCFHQSAVREKANPSLSTCKRHSS
DQ899146_Pol_P-F      HTPTRWLARVEPSGTRYVVNRASRSASCFHQSAVREKANPSLSTSKRHSS
FJ589066_Pol_P-F      HTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
DQ899149_Pol_P-F      HTPTRWPGGVEPSGTRCSNYLASRSASCFHQSAVREKANPSLSTSKRHTS
AB036915_Pol_P-F      YTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
AB036905_Pol_P-F      YTPTRWPAGVEPSGTGCFBNLASRSASCFHQSAVREKANPSLSTSKRHTS
AB036909_Pol_P-F      YTPTRWPAGVEPSGTGCFBNLASRSASCFHQSAVREKANPSLSTSKRHTS
AB036911_Pol_P-F      YTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
AB036912_Pol_P-F      YTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
AB036913_Pol_P-F      YTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
AB036914_Pol_P-F      YTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
AB036916_Pol_P-F      YTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
AB036917_Pol_P-F      YTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
AB036918_Pol_P-F      YTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
AB036919_Pol_P-F      YTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
AB036920_Pol_P-F      YTPTRWPAGVEPSGTGCFNNLASRSASCLHQSAVREKANPSLSTSKRHTS
FJ589067_Pol_P-F      HTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
AB365453_Pol_P-F      HTPTRGPVGVEPSGTRCSNNLASRSASCFHQSAVREEAHPSLSTSKRHTS
AB166850_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCLHQSAVREEANPSLSTSKRHTS
DQ899142_Pol_P-F      HTPTRWPAGVEPSSTRCANNLVSRSASCFHQSAVREKANPSLSTSKRHTS
DQ899143_Pol_P-F      HTPTRWPAGVEPSSTRCANNLVSRSASCFHQSAVREKANPSLSTSKRHTS
DQ899148_Pol_P-F      HTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTP
AY090455_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
DQ823087_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSVSTSKRHTS
AF223962_Pol_P-F      HTTTRWPVGMEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
DQ823089_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
FJ657522_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
DQ823090_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
FJ657519_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
DQ776247_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
EU366116_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
FJ657528_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
HE981181_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
AY090458_Pol_C-F      HTPTRWPAGVEPTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKGHSS
EU366132_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
AB214516_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCLHQSAVREEANPSLSTSKRHTS
AB116654_Pol_P-F      HTPTRWPVGVEPTGTGCAYNIASRSASCFHQSEVREKTNPSLSTSKRHSS
JN688720_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
AY311370_Pol_P-F      HTPTRWPAGVEPSGTGCFDNLASRSTSCFHQSAVREKANPSLSTSKRHTS
AY311369_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
AY090459_Pol_P-F      HTPTRWPAGVEPTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
AY090461_Pol_P-F      HTPTRWPAGVEPTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
AB365450_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
AB365449_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
AB116551_Pol_P-F      HTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
AB036910_Pol_P-F      HTPSRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KJ676694_Pol_P-F      HTPTRWLAGMEPSGTRCSNNLASKSASCFHQSAVREEANPSLSTSKRHTS
FJ657525_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAIREKTNPSLSTSKRHSS
DQ823086_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSTSCFHQSAVREEANPSLSTSKRHTS
AB365446_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
JN688709_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASKSASCLHQSAVREEANPSLSTSKRHTS
AB116549_Pol_P-F      HTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
AF223965_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
EF576812_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHXS
KJ638660_Pol_P-F      HAPARWPAGVEPSSTRCFNHLASGSASCFHQSAVREEANPSLSTSKRHTP
HM590474_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM585194_Pol_P-F      HTPTRWPVGMEPTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
JN792918_Pol_P-F      HTPTRWPVGVESTGTGCAHNIASRSASCFHQSAVREKTNPSLSTSKRHSS
DQ823092_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
DQ823093_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
EU366133_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM585197_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
JN792920_Pol_P-F      HTPTRWPVGVESTGTGCAHNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM585196_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
FJ709494_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM585190_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM585199_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
FJ709462_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
FJ709460_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
FJ709459_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
FJ709457_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
DQ823095_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
DQ823094_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
EU366118_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
FJ657529_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
FJ709458_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
FJ709464_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
FJ709465_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HE981182_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HE981183_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM585186_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM585187_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM585188_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM585189_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM585191_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM585195_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM585198_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM590471_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM590472_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM590473_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM622135_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HQ378247_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
JN792919_Pol_P-F      HTPTRWPVGVESTGTGCAHNIASRSASCFHQSAVREKTNPSLSTSKRHSS
DQ823091_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
JN688691_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
JN688699_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
JN688703_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
FJ709463_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
AB064316_Pol_P-F      HTPTRWPVGVESTGTGCAYNSASRSASCFHQSAVREKTNPSLSTSKRHSS
AB116552_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
AF223963_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
AY179735_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM585192_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
HM585193_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
X75663_Pol_P-F        HTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREEANPSLSTSKRHTS
JN792917_Pol_P-F      HTPTRWPVGVESTGTGCAHNIASRSASCFHQSAVREKTNPSLSTSKRHSS
JN688701_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KJ638663_Pol_P-F      HTPSRWPVGVEPTGTGCAYYIASRSASCFHQSEVGKKTNPRLSTSKRHSS
KJ638662_Pol_P-F      HAP-RWPAGVEPSSTRCFNHLASGSASCFHQSAVREEANTXLSTPKRHTS
HM585200_Pol_P-F      HTPTRWPVGVEPTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
DQ823088_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
X75658_Pol_C-F        HTPTRWPVGVEPSGTRCSNNLASRSASCLHQSAVREEANPSLSTSKRHTS
KY476326_Pol_P-F      HTPTRWPVGVEPTSTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KP995118_Pol_P-F      HTPTRWPVGVEPSGTGCFDNLASRSASCFHQSADREKANPSLSTSKRHTS
KP995117_Pol_P-F      HTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KP995111_Pol_P-F      HTPTRWPAGMEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KJ843225_Pol_P-F      HTPTRWPVGVEPSGTGCSNNLASRSASCFHQSAVREEANPSLSTSKRHAS
KP995097_Pol_P-F      HTPTRWPAGVEPSSTGCVNNLASRSASCFHQSAVREKADPSLSTSKRHTS
KJ843220_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
AF223964_Pol_P-F      HTPSRWPVGVESTGTGCAYNIASKSASCFHQSAVREKTNPSLSTSKRHSS
KP995123_Pol_P-F      HTPTRWPAGVEPSGTGCFNNLASRSASCFHQSADREKANPSLSTSKRHTS
KP995101_Pol_P-F      HTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPNLSTSKRHPS
HM627320_Pol_P-F      HTPTRWPVGVEPTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
AB086397_Pol_P-F      HTPTRWPVGVEPTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KP995126_Pol_P-F      HTPTRWPAGVEPSGTGCFDNLASRSTSCFHQSAVREKANPSLSTSKRHTS
KP995125_Pol_P-F      HTPTRWPAGVEPSGTGCFNNLASRSASCFHQSADREKANPSLSTSKRHTS
KP995124_Pol_P-F      HTPTRWPAGVEPSGTGCFDNLASRSTSCFHQSAVREKANPSLSTSKRHTS
KP995119_Pol_P-F      HTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KP718111_Pol_P-F      HTPTRWPAGVEPSGTGCFNNLASRSASYFHQSAVREKANPSLSTSKRHTS
MH051987_Pol_P-F      HTPTRWPAGVEPSGPGCFNNFASRSASCFHQSAVREKANPCLSTSKRHTS
MH051986_Pol_P-F      HTPTRWPAGVEPSGPGCFNNFASRSASCFHQSAVREKANPCLSTSKRHTS
KY382411_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KJ843226_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KJ843224_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KJ843222_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KJ843221_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KJ843219_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KJ843213_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KJ843212_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KJ843210_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KJ843208_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KJ843185_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KC494398_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KJ843211_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KJ843207_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KJ843175_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KC494394_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
JX079937_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KX264498_Pol_P-F      YTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KP718106_Pol_P-F      HTPTRWPAGMEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KJ843209_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSTSCFHQSAVREEANPSLSTSKRHTS
JQ272888_Pol_P-F      HTPTRWPVGVEPSGTRYSNNLASRSTSCFHQSAVREEANPSLSTSKRHTS
KP995109_Pol_P-F      HTPTRWPAGVEPSGTGGFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KP995106_Pol_P-F      HTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KP718103_Pol_P-F      HTPTRWPTGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KJ843223_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEADPSLSTSKRHTS
JN811655_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KP995114_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KP995105_Pol_P-F      HTPTRWPAGVEPSGTGCFNNLANRSASCFHQSAVREKANPSLSTSKRHTS
KJ843189_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KX264499_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KP995113_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KP718112_Pol_P-F      HTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KP718109_Pol_P-F      HTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KJ638656_Pol_P-F      HTPSRWPVGVEPTGTGCAYNIASRSASCFHQSAVGEKTNPSLSTSKRHSS
JN811656_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEANPSLSTSKRHTS
KJ638659_Pol_P-F      HTPTRWPAGVEPSGTGCFNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KP995120_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KC494401_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KY476329_Pol_P-F      HTPTRWPVGVEPTGTGCAYNIASRSASCSHQSAVREKTNPSLSTSKRHSS
KT896494_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KP995104_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KJ586807_Pol_P-F      HTPTRWPVGVESTGTGCAYNIATRSASCFHQSAVREKTNPNFSTSKRHSS
KC494396_Pol_P-F      HTPTRWPAGVEPSSTGCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KC494395_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KY476330_Pol_P-F      HTPTRWPVGVEPTGTGCAYNIASRSTSCFHQSAVGEKTNPSLSTSKRHSS
KC494405_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KC494400_Pol_P-F      HTPSRWPVGVESTGTGCAYNIASKSASCFHQSAVREKTNPSLSTSKRHSS
KY476327_Pol_P-F      HTPTRWPVGVEPTGTGCAYNMASKSAYCFHQSAVRETTNPSLSTSKRHSS
KP995116_Pol_P-F      HTTARWPFGVESTGSGCTYNFASRSASCFHQSAVREKAHPSLSTSKRHSS
KJ843177_Pol_P-F      HTPTRWPVGVEPTGTRCAYNIASRSASCSHQSAVREKTNPSLSTSKRHSS
KJ638657_Pol_P-F      HTPSRWPVGVEPTGTGCAYNIASRSASCFHQSAVGKETPTLNSKSKRHSS
KC494399_Pol_P-F      HTPTRWPAGMEPSSTRCVNNLASRTASCFHQSEVREKANPGLSTSKRHTS
KY382416_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASGSASCFHQSAVREXTNPSLSTSKRHSS
KY382415_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASGSASCFHQSAVREXTNPSLSTSKRHSS
KY382417_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASGSASCFHQSAVREXTNPSLSTSKRHSS
KP995110_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KP718107_Pol_P-F      HTPSRWPVGVEPTGTGCAYNIASRSASCFHQSAVGKKTNPSLSTSKRHPS
KF779236_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KC494404_Pol_P-F      HTPSRWPVGVESTGTGCAYNIASKSASCFHQSAVREKTNPSLSTSKRHSS
KC494403_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KC494397_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KP995115_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASKSASCFHQSAVREKANPSLSTSKRHTS
KP995107_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KJ843178_Pol_P-F      HTPTRWPVGVEPTGTRCAYNIASRSASCSHQSAVREKTNPSLSTSKRHSS
X69798_Pol_P-F        HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KX264497_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KC494402_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
JX079936_Pol_P-F      HTPTRWPVGVEPTGTRCAYNIASRSASCSHQSAVREKTNPSLSTSKRHSS
KY476324_Pol_P-F      HTPTRWPVGVEPTGTGCAYNVASRSASCSHQSAXREKTNPSLSTSKRHSS
KP718110_Pol_P-F      HTPSRWPVGVEPTGTGCAYNIASRSASCFHQSAVGKKTNPSLSTSKRHSS
KJ843197_Pol_P-F      HTPSRWPVGVESTGTGCAYNIASKSASCFHQSAVREKTNPSLSTSKRHSS
KJ843191_Pol_P-F      HTPTRWPAGVEPPSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
KF199901_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KY476331_Pol_P-F      HTPTRWPVGVEPTGTGCAYNIASRSASCSHQSAVREKTNPSLSTSKRHSS
KM233681_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ586808_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KY476332_Pol_P-F      HTPTRWPVGVEPTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KP995098_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843163_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAIREKTNPSLSTSKRHSS
KY476328_Pol_P-F      HTPTRWPVGVEPTGTGCAYNIASRSASCSHQSEVREKTNPSLSTSKRHAS
KY476325_Pol_P-F      HTPTRWPVGVEPTGTGCAYNIASRSASCSHQSEVREKTNPSLSTSKRHSS
KY476323_Pol_P-F      HTPTRWPVGVEPTGTGCAYNIASRSASCSHQSAVREKTNPSLSTSKGHSS
KY476322_Pol_P-F      HTPTRWPVGVEPTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KY458061_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KM998715_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843202_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843193_Pol_P-F      HTPTRRPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843180_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
MK058437_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KX264496_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KP718113_Pol_P-F      HTPTRWPVGVEPTGTGSAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KP718104_Pol_P-F      HTPTRWPVGVEPTGTGSAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843206_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843205_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843204_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843203_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843201_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843200_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843199_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843198_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843196_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843195_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843190_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843179_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843176_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843174_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843171_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843170_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843169_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843167_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KY458062_Pol_P-F      HTPTRWPVGXESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843181_Pol_P-F      HTPTRWPVGLESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
JN792922_Pol_P-F      HTPTRWPVGVESTGTGCAHNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KX757665_Pol_P-F      HTPTRWPAGVEPTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KJ843194_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
JN792921_Pol_P-F      HTPTRWPXGVESTGTGCAHNIASRSASRFHQSAVREKXNPSLSTSKRHTS
KJ843164_Pol_P-F      HTPTRWPVGVESTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
                      ::. *     *....      .. ::   ***       .  *. : * .

KJ638664_Pol_P-F      TGHKVEVEHFPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
EF576808_Pol_P-F      TGNAMELHPVPPGLVGSEGKGSVSSCWWLQFRDAEPCSDYCLSHIINILD
DQ899150_Pol_P-F      PGRAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
DQ899147_Pol_P-F      TGNAVELNPVPPGSVGSQGKGSVSSCWWLQFKDTKPCSDYCLSHIINLLE
DQ899145_Pol_P-F      TGNAVELNPVPPGSVGSQGKGSVFSCWWLQFRNTKPCSDYCLSHIINLLE
DQ899144_Pol_P-F      TGNAVELNPVPPGSVGSQGKGSVFSCWWLQFRNTKPCSDYCLSHIINLLE
DQ899146_Pol_P-F      TGNAVELNPVPPGSVGSQGKGSVFSCWWLQFRNTKPCSDYCLSHIINLLE
FJ589066_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
DQ899149_Pol_P-F      TGHAVELNSVPPGSVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AB036915_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AB036905_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AB036909_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AB036911_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AB036912_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AB036913_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AB036914_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AB036916_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AB036917_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AB036918_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AB036919_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AB036920_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
FJ589067_Pol_P-F      TGHAVELNSVPPGSVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AB365453_Pol_P-F      TGNAMELIPVPSGLVGSEGKGSVSSCWWLQFRDAEPCSDYCLSHIINLLD
AB166850_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVSSCWWLQFRDTEPCSDYCLSHIINLLE
DQ899142_Pol_P-F      TGNAVELNPVPPGSVGSHGKGSVFPCWWLQFRDTEPCSDYCLSHIINLLE
DQ899143_Pol_P-F      TGNAVELNPVPPGSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLE
DQ899148_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVSSCWWLQFRDTEPCSDYCLSHIINLLE
AY090455_Pol_P-F      TGNAVELNPVPPGSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSYIINLLE
DQ823087_Pol_P-F      TGNAVELSQVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AF223962_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
DQ823089_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVLSCWWLQFRDTEPCSDYCLSHIINLLE
FJ657522_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
DQ823090_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
FJ657519_Pol_P-F      TGNAVELNPVPPGPVGSEGXGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
DQ776247_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
EU366116_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
FJ657528_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HE981181_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AY090458_Pol_C-F      PGHAVELNSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
EU366132_Pol_P-F      TGNAVDLNPVPPGPVGSEGKGSVSXCWWLQFRDTEPCSDYCLSHIINLLE
AB214516_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVSSCWWLQFRDTEPCSDYCLSHIINLLE
AB116654_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWGLQFRDTEPCSDYCLSHIINLLE
JN688720_Pol_P-F      TGNAMELNPVPPGPVGSEGKGSVFSCWWLQFRHTEPCSDYCLSHIINLLE
AY311370_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVSSCWWLQFRDTEPCSDYCLSHIINLLE
AY311369_Pol_P-F      TGNAVELNPVPPGSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLE
AY090459_Pol_P-F      TGNAVELNSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AY090461_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVLSCWWLQFRDTEPCSDYCLSHIINLLE
AB365450_Pol_P-F      TGNAVELNPVPSGLVGSEGKGSVFSCWWLQFRDAEPCSDYCLSHIINLLE
AB365449_Pol_P-F      TGNAVELNPVPSGLVGSEGKGSVSSCWWLQFRDAEPCSDYCLSHIINLLE
AB116551_Pol_P-F      TGHAVEFNSVPPGSVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AB036910_Pol_P-F      TGHAVELNSVPPGSVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ676694_Pol_P-F      TGXAEQLNPVSPGPVRPKGKGSVFSCWWLQFRDAEPCSDYCLSHIINLLE
FJ657525_Pol_P-F      TGHAVELNSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
DQ823086_Pol_P-F      TGNAVELNPVPPGLVGSEGKGSVFSCWWLQFRDAEPCSDYCLSHIINLLE
AB365446_Pol_P-F      TGNAMELNPVPSGLVGSEGKGSVSSCWWLQFRDAEPCSDYCLSHIINLLE
JN688709_Pol_P-F      TGNAMELNPVPLNPVGSEGKGSVXSCWWLQFRDTEPCSDYCLSXIINLLE
AB116549_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AF223965_Pol_P-F      TGNAVELNPVPPGLVGSEGKGSVFSCWWLQFRDAEPCSDYCLSHIINLLE
EF576812_Pol_P-F      TGNAVELNPVPPGLVGSEGKGSVFSCWWLQFRDAEPCSDYCLSHIINLLE
KJ638660_Pol_P-F      TGHAVEHHPVPPGSSRSQSQGPVESCWWLQFRDTEPCSDYCLSHIINLXE
HM590474_Pol_P-F      TGHAVEFHSVSPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM585194_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
JN792918_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
DQ823092_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
DQ823093_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
EU366133_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM585197_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
JN792920_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM585196_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
FJ709494_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM585190_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM585199_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
FJ709462_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
FJ709460_Pol_P-F      TGHAVELHSVPPDSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
FJ709459_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
FJ709457_Pol_P-F      TGHAVELHSVPPDSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
DQ823095_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
DQ823094_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
EU366118_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
FJ657529_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
FJ709458_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
FJ709464_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
FJ709465_Pol_P-F      TGHAVELHSVPPGSVRSEGKDSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HE981182_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HE981183_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM585186_Pol_P-F      TGHAVEFHSVSPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM585187_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM585188_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM585189_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM585191_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM585195_Pol_P-F      TGHAVERHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM585198_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM590471_Pol_P-F      TGHAVEFHSVSPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM590472_Pol_P-F      TGHAVEFHSVSPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM590473_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM622135_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HQ378247_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
JN792919_Pol_P-F      TGHAMELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
DQ823091_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
JN688691_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
JN688699_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
JN688703_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
FJ709463_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AB064316_Pol_P-F      TGHAVEFHSVPPDSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AB116552_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AF223963_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AY179735_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM585192_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM585193_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
X75663_Pol_P-F        SGHAVELNSLPPSSVGSQGKGTVFSCWWLQFRNTEPCSDYCLSHIINLLE
JN792917_Pol_P-F      TGHAVELHSVPPDSVRSEGKGSVSSCWWLQFRDTEPCSDYCLSHIINLLE
JN688701_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ638663_Pol_P-F      TVHTEQLHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLRE
KJ638662_Pol_P-F      TGHAVEHNPVPPGSVGSKGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
HM585200_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
DQ823088_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
X75658_Pol_C-F        TGNAVELNSLPPGSVGSEGKGTVFSCWWLQFRHAEPCSDYCLSHIINLLE
KY476326_Pol_P-F      TGNAMELIPVPPGPVGSEGKGSVXSCWWLQFRDTEPCSDYCLSHIINLLE
KP995118_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KP995117_Pol_P-F      TGHAVELNPVPPGSVKSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KP995111_Pol_P-F      TGHAVELNPVPPGSVRSEGNGSVFSCWWLQFRDTEPCSDYCLSHIINLLD
KJ843225_Pol_P-F      TGNAMELNPVPPGPVGSEGKDSVSSCWWLQFRDTEPCSDYCLSHIINLLE
KP995097_Pol_P-F      TGHAVELNPVPPGSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSYIINLLE
KJ843220_Pol_P-F      TCNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
AF223964_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRHAEPCSDYCLSHIINLLE
KP995123_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KP995101_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQSRNTKPCSDYCLSHIINLLE
HM627320_Pol_P-F      TGHAVELHSVPPGSVRSEGKGXVFXCWWLQFRDTEPCSDYCLSHIINLLE
AB086397_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KP995126_Pol_P-F      TGHAVELNPVPSGSVRSEGKGSVSSCWWLQFRDTEPCSDYCLSHIINLLE
KP995125_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KP995124_Pol_P-F      TGHAVELNPVPSGSVRSEGKGSVSSCWWLQFRDTEPCSDYCLSHIINLLE
KP995119_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KP718111_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
MH051987_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDAEPCSDYCLSHIINLLE
MH051986_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDAEPCSDYCLSHIINLLE
KY382411_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843226_Pol_P-F      TGNAVELNPVPPGPVGSESKGSVFSCWWLQFRDAEPCSDYCLSHIINLLE
KJ843224_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843222_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843221_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843219_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843213_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843212_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843210_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843208_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843185_Pol_P-F      TGNAVELNPVPPGLVGSEGKGSVSSCWWLQFRDAEPCSDYCLSHIINLLE
KC494398_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843211_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843207_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843175_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KC494394_Pol_P-F      TGNAVELNPVPPSSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLE
JX079937_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KX264498_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KP718106_Pol_P-F      XGXAVELNPVPPGSARSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843209_Pol_P-F      TGNAVELNPVPPGLVGSEGKGSVFSCWWLQFRDAEPCSDYCLSHIINLLE
JQ272888_Pol_P-F      TGSKVELSQVPPGLVGSEGKGSVSSCWWLQFRDAEPCSDYCLSHIINLLD
KP995109_Pol_P-F      TGHAMEFNSVPPGSVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KP995106_Pol_P-F      TGHAVELNPVPPGSVRSAGKGSVSSCWWLQFRDTEPCSDYCLSHIINLLE
KP718103_Pol_P-F      TGHAVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIVNLLE
KJ843223_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
JN811655_Pol_P-F      TGNAVELNPVPPGSVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KP995114_Pol_P-F      TGNAMELKQVPPASVGTRGKGSVSPCWWLQFRDTEPCSDYCLSHIINLLE
KP995105_Pol_P-F      TGNTVELNPVPPGSVRSEGKGSVSSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843189_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KX264499_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KP995113_Pol_P-F      TGNAVELNPVPPGSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLE
KP718112_Pol_P-F      TGHAVELNSVPPGSVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KP718109_Pol_P-F      TGHAVELNSVPPGSVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ638656_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
JN811656_Pol_P-F      TGNAVELNPVPPGPVGSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ638659_Pol_P-F      TGHXVELNPVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KP995120_Pol_P-F      TGNAVELNPVPPGSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLE
KC494401_Pol_P-F      TGDAVELNPVPPGSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLE
KY476329_Pol_P-F      TGHTVEHPSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KT896494_Pol_P-F      TGNAVELNPVPPTSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLD
KP995104_Pol_P-F      TGNAVELNPVPPGSVGSQGKGSVPPCWWLQFRDTKPCSDYCLSHIINLLE
KJ586807_Pol_P-F      TGHGVELPSIPPGSVNSQGKGSPAGCWWVQFQDTEPCSDYCLSHIINLLE
KC494396_Pol_P-F      TGNAVELNPVPPGSVGSQGMGSVLSCWWLQFRDTEPCSDYCLSHIINLSE
KC494395_Pol_P-F      TGNAVELNPVPPSSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLE
KY476330_Pol_P-F      TGHAVEFHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KC494405_Pol_P-F      TGNAVELNPVPPSSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLE
KC494400_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KY476327_Pol_P-F      TGRAVELHSVPPGSVRSEGKSSVFSCWWLQFRDTAPCSDYCLSHIINLLE
KP995116_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843177_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ638657_Pol_P-F      TGHAEELHSVPPGSVRSEGKGSVCSCWWLQFRDTEPCSDYCLSHIINLLE
KC494399_Pol_P-F      TGNAVELNPVPPGSVGSQGKGSVLPCWWLQFRNTEPCSDYCLSHIINLLE
KY382416_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCXSHIINLLE
KY382415_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCXSHIINLLE
KY382417_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCXSHIINLLE
KP995110_Pol_P-F      TGNAVELNPVPPGSVGSQGEGSVLPCWWLQFRDTKPCSDYCLSHIINLLE
KP718107_Pol_P-F      TGHAVELHSVPSGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KF779236_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRNSKPCSDYCLSHIINLLE
KC494404_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KC494403_Pol_P-F      TGNAVELNPVPPSSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLE
KC494397_Pol_P-F      TGNAVELNPVPPSSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLE
KP995115_Pol_P-F      TGDAVELNPVPPGSVGSQGKGSVFPCWWLQFRDTEPCSDYCLSHIINLLE
KP995107_Pol_P-F      TGNAVELNPVPPGSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLE
KJ843178_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
X69798_Pol_P-F        TGNAVELNPVPPSSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLE
KX264497_Pol_P-F      TGNAVELNPVPPGSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLE
KC494402_Pol_P-F      TGDAVELNPVPPGSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLE
JX079936_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KY476324_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLD
KP718110_Pol_P-F      TGHAVELQSVPPGSVRSEGKGSVSSCWWLQFRDTEPCSDYCLSHIINLLX
KJ843197_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843191_Pol_P-F      TGNAVELNPVPPGSVGSQGKGSVLPCWWLQFRDTEPCSDYCLSHIINLLE
KF199901_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWVLQFRDTEPCSDYCLSHIINLLE
KY476331_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KM233681_Pol_P-F      TGHAVEFHSVSPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ586808_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KY476332_Pol_P-F      TGHAVELHSVPSGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KP995098_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843163_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KY476328_Pol_P-F      TGHAVELHSVSPGSVRSKGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KY476325_Pol_P-F      TGHAMELHSVSPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KY476323_Pol_P-F      TGHAVELHSVSPGSVSSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KY476322_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KY458061_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KM998715_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843202_Pol_P-F      TGHAVELHSVPPDSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843193_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843180_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
MK058437_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KX264496_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KP718113_Pol_P-F      TGHAVELNSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KP718104_Pol_P-F      TGHAVELNSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843206_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843205_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843204_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843203_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843201_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843200_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843199_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843198_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843196_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843195_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843190_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843179_Pol_P-F      TGHAVEFHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843176_Pol_P-F      TGHAVELHSVPPGSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843174_Pol_P-F      TGHAVELHSVPPRSVRSQGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843171_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843170_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843169_Pol_P-F      TGHAVELHSVPPDSVRSESKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843167_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KY458062_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KJ843181_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
JN792922_Pol_P-F      TGRAVELHSVPPDSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
KX757665_Pol_P-F      TGHAVELNSVPPGXXXXXXXXXXXXXXXXXXXXXXXXXXXCLSHIINLLE
KJ843194_Pol_P-F      TGHAVELHSVPPDSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
JN792921_Pol_P-F      TGNAVELXSVPPXSVXSZGKGSVXXCWWLQFRDTEPCSDYCLSHIINLLE
KJ843164_Pol_P-F      TGHAVELHSVPPGSVRSEGKGSVFSCWWLQFRDTEPCSDYCLSHIINLLE
                           :   ..                             * * *:*:  

KJ638664_Pol_P-F      DWGPCYEHGQHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
EF576808_Pol_P-F      DWGPCYEHGQHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
DQ899150_Pol_P-F      DWGPCNEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
DQ899147_Pol_P-F      DWGPCYEHGQHYIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
DQ899145_Pol_P-F      DWGPCYEHGQHYIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
DQ899144_Pol_P-F      DWGPCYEHGQHYIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
DQ899146_Pol_P-F      DWGPCYEHGQHYIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
FJ589066_Pol_P-F      DWGPCHEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
DQ899149_Pol_P-F      DWGPCHEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
AB036915_Pol_P-F      DWGPCYEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
AB036905_Pol_P-F      DWGPCYEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
AB036909_Pol_P-F      DWGPCYEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
AB036911_Pol_P-F      DWGPCYEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
AB036912_Pol_P-F      DWGPCYEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
AB036913_Pol_P-F      DWGPCYEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
AB036914_Pol_P-F      DWGPCYEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
AB036916_Pol_P-F      DWGPCYEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
AB036917_Pol_P-F      DWGPCYEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
AB036918_Pol_P-F      DWGPCYEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
AB036919_Pol_P-F      DWGPCYEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
AB036920_Pol_P-F      DWGPCYEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
FJ589067_Pol_P-F      DWGPCHEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
AB365453_Pol_P-F      DWGPCYEHGQHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
AB166850_Pol_P-F      NWGPCYEHGQHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
DQ899142_Pol_P-F      DWGPCYEHGQHYIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
DQ899143_Pol_P-F      DWGPCYEHGQHYIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
DQ899148_Pol_P-F      DWGPCHEHGEHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
AY090455_Pol_P-F      DWGPCYEHGQHYIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
DQ823087_Pol_P-F      DWGPCYEHGQHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
AF223962_Pol_P-F      DWGPCYEHGQHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
DQ823089_Pol_P-F      DWGPCYEHGQHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
FJ657522_Pol_P-F      DWGPCYEHGQHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
DQ823090_Pol_P-F      DWGPCYEHGQHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
FJ657519_Pol_P-F      DWGPCYEHGQHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
DQ776247_Pol_P-F      DWGPCYEHGQHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
EU366116_Pol_P-F      DWGPCYEHGQHHIRTPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSR
FJ657528_Pol_P-F      DWGPCYDHGQHHIRTPRTPARVTGGVFLVDKNPHNTTES