HBVdb

Dataset for protein HBSP of genotype G

[Download (right click)] [Edit] [Sequences] [Repertoires]

88 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


JF439797_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADKDLNRRVAKDLHLQLPNDPR
KF779267_HBSP_P-G      MPLSYQHFRRLLLLDEEAGLLEEELPRLAEPSPNSRVAEDLHLQLPNDPR
FJ023674_HBSP_P-G      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPR
FR714503_HBSP_P-G      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPR
HE981174_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
HE981175_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
HE981176_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
AB056513_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
AB056514_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
AB064310_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
AB064311_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
AB064312_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
AB064313_HBSP_C-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
AB375165_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
AB375166_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
AB375167_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
AB375168_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
AB375169_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
AB375170_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
AF160501_HBSP_C-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
AF405706_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
DQ207798_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
EF634480_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPP
GU563556_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439795_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439796_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLKLPNDPR
JF439801_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLKLPNDPR
JQ707436_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JQ707657_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLKLPNDPR
JQ707660_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JQ707666_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JQ707668_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JQ707671_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JQ707673_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JQ707677_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JQ707678_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JQ707679_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JQ707680_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
KF767450_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
KF779233_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
KF779235_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
KF779357_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
KJ194508_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
KM998716_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
KR230749_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
KX264500_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
KY004111_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
EF464097_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
EF464098_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
GU565217_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
HE981171_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
HE981172_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439779_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439780_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439781_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439782_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439784_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439785_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439786_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439787_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439788_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439789_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439791_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439792_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLKLPNDPR
JF439793_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLKLPNDPR
JF439794_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439799_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439800_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439802_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439803_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439804_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439805_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439806_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439807_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439808_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439809_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439810_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439811_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439812_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439813_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439814_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439815_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439816_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439817_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
JF439818_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
KF414679_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
KF767451_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
KF767452_HBSP_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDPR
                       *********.*****:*** *********: . * ***:**:*   *** 

JF439797_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
KF779267_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
FJ023674_HBSP_P-G      PPVRDPAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
FR714503_HBSP_P-G      PPVRDHAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
HE981174_HBSP_P-G      PPARDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
HE981175_HBSP_P-G      PPARDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
HE981176_HBSP_P-G      PPARDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB056513_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB056514_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB064310_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB064311_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB064312_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB064313_HBSP_C-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB375165_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB375166_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB375167_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB375168_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB375169_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB375170_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AF160501_HBSP_C-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AF405706_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
DQ207798_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
EF634480_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
GU563556_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439795_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439796_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439801_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JQ707436_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JQ707657_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JQ707660_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JQ707666_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JQ707668_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JQ707671_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNFRTEIAPVFPSHHLGLSQNTYGS
JQ707673_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JQ707677_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JQ707678_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JQ707679_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JQ707680_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
KF767450_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
KF779233_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
KF779235_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
KF779357_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
KJ194508_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
KM998716_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
KR230749_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
KX264500_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
KY004111_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
EF464097_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
EF464098_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
GU565217_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGI
HE981171_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
HE981172_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439779_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGI
JF439780_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439781_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439782_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439784_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439785_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439786_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439787_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGI
JF439788_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439789_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGI
JF439791_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439792_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439793_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439794_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNFRTEIAPVFPSHHLGLSQNTYGS
JF439799_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439800_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439802_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439803_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439804_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439805_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439806_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439807_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439808_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439809_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439810_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439811_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439812_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439813_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439814_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439815_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439816_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439817_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JF439818_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
KF414679_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
KF767451_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGT
KF767452_HBSP_P-G      PPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
                       **.** *:*******************:********************* 

JF439797_HBSP_P-G      GPQSVSHGSVY
KF779267_HBSP_P-G      GPQSVSLGSVY
FJ023674_HBSP_P-G      GPQPVSPGSVY
FR714503_HBSP_P-G      GPQPVSPGSVY
HE981174_HBSP_P-G      GPQSVSLGSVY
HE981175_HBSP_P-G      GPQSVSLGSVY
HE981176_HBSP_P-G      GPQSVSLGSVY
AB056513_HBSP_P-G      GPQSVSLGSVY
AB056514_HBSP_P-G      GPQSVSLGSVY
AB064310_HBSP_P-G      GPQSVSLGSVY
AB064311_HBSP_P-G      GPQSVSLGSVY
AB064312_HBSP_P-G      GPQSVSLGSVY
AB064313_HBSP_C-G      GPQSVSLGSVY
AB375165_HBSP_P-G      GPQSVSLGSVY
AB375166_HBSP_P-G      GPQSVSLGSVY
AB375167_HBSP_P-G      GPQSVSLGSVY
AB375168_HBSP_P-G      GPQSVSLGSVY
AB375169_HBSP_P-G      GPQSVSLGSVY
AB375170_HBSP_P-G      GPQSVSLGSVY
AF160501_HBSP_C-G      GPQSVSLGSVY
AF405706_HBSP_P-G      GPQSVSLGSVY
DQ207798_HBSP_P-G      GPQSVSLGSVY
EF634480_HBSP_P-G      GPQSVSLGSVY
GU563556_HBSP_P-G      GPQSVSLGSVY
JF439795_HBSP_P-G      GPQSVSLGSVY
JF439796_HBSP_P-G      GPQSVSLGSVY
JF439801_HBSP_P-G      GPQSVSLGSVY
JQ707436_HBSP_P-G      GPQSVSLGSVY
JQ707657_HBSP_P-G      GPQSVSLGSVY
JQ707660_HBSP_P-G      GPQSVSLGSVY
JQ707666_HBSP_P-G      GPQSVSLGSVY
JQ707668_HBSP_P-G      GPQSVSLGSVY
JQ707671_HBSP_P-G      GPQSVSLGSVY
JQ707673_HBSP_P-G      GPQSVSLGSVY
JQ707677_HBSP_P-G      GPQSVSLGSVY
JQ707678_HBSP_P-G      GPQSVSLGSVY
JQ707679_HBSP_P-G      GPQSVSLGSVY
JQ707680_HBSP_P-G      GPQSVSLGSVY
KF767450_HBSP_P-G      GPQSVSLGSVY
KF779233_HBSP_P-G      GPQSVSLGSVY
KF779235_HBSP_P-G      GPQSVSLGSVY
KF779357_HBSP_P-G      GPQPVSLGSVY
KJ194508_HBSP_P-G      GPQSVSLGSVY
KM998716_HBSP_P-G      GPQSVSLGSVY
KR230749_HBSP_P-G      GPQSVSLGSVY
KX264500_HBSP_P-G      GPQSVSLGSVY
KY004111_HBSP_P-G      GPQSVSLGSVY
EF464097_HBSP_P-G      GPQSVSHGSVY
EF464098_HBSP_P-G      GPQSVSHGSVY
GU565217_HBSP_P-G      GPQSVSHGSVY
HE981171_HBSP_P-G      GSQSVSHGSVY
HE981172_HBSP_P-G      GPQSVSHGSVY
JF439779_HBSP_P-G      GPQSVSHGSVY
JF439780_HBSP_P-G      GPQSVSHGSVY
JF439781_HBSP_P-G      GPQSVSHGSVY
JF439782_HBSP_P-G      GPQSVSHGSVY
JF439784_HBSP_P-G      GPQSVSHGSVY
JF439785_HBSP_P-G      GPQSVSHGSVY
JF439786_HBSP_P-G      GPQSVSHGSVY
JF439787_HBSP_P-G      GPQSVSHGSVY
JF439788_HBSP_P-G      GPQSVSHGSVY
JF439789_HBSP_P-G      GPQSVSHGSVY
JF439791_HBSP_P-G      GPQSVSHGSVY
JF439792_HBSP_P-G      GPQSVSHGSVY
JF439793_HBSP_P-G      GPQSVSHGSVY
JF439794_HBSP_P-G      GPQSVSHGSVY
JF439799_HBSP_P-G      GPQSVSHGSVY
JF439800_HBSP_P-G      GPQSVSHGSVY
JF439802_HBSP_P-G      GPQSVSHGSVY
JF439803_HBSP_P-G      GPQSVSHGSVY
JF439804_HBSP_P-G      GPQSVSHGSVY
JF439805_HBSP_P-G      GPQSVSHGSVY
JF439806_HBSP_P-G      GPQSVSHGSVY
JF439807_HBSP_P-G      GPQSVSHGSVY
JF439808_HBSP_P-G      GPQSVSHGSVY
JF439809_HBSP_P-G      GPQSVSHGSVY
JF439810_HBSP_P-G      GPQSVSHGSVY
JF439811_HBSP_P-G      GPQSVSHGSVY
JF439812_HBSP_P-G      GPQSVSHGSVY
JF439813_HBSP_P-G      GPQSVSHGSVY
JF439814_HBSP_P-G      GPQSVSHGSVY
JF439815_HBSP_P-G      GPQSVSHGSVY
JF439816_HBSP_P-G      GPQSVSHGSVY
JF439817_HBSP_P-G      GPQSVSHGSVY
JF439818_HBSP_P-G      GPQSVSHGSVY
KF414679_HBSP_P-G      GPQSVSHGSVY
KF767451_HBSP_P-G      GPQSVSHGSVY
KF767452_HBSP_P-G      GPQSVSHGSVY
                       *.*.** ****

© 1998-2019