HBVdb

Dataset for protein HBc of genotype G

[Download (right click)] [Edit] [Sequences] [Repertoires]

88 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KY004111_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
KF779235_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JX899374_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELXSFLPSDFFPSVRDLLDTASALY
HE981171_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
AB064312_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
AB056515_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439792_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439793_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439796_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439801_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JQ707657_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
AB056513_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JQ707436_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
AB056514_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
AB064310_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
AB064311_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
AB064313_HBc_C-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
AB375165_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
AB375166_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
AB375167_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
AB375168_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
AB375169_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
AB375170_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
AF160501_HBc_C-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
AF405706_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
DQ207798_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
EF464097_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
EF464098_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
EF634480_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
GU563556_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
HE981172_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
HE981174_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
HE981175_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
HE981176_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439779_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439780_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439781_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439782_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439784_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439785_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439786_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439787_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439788_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439789_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439791_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439794_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439795_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439797_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTTSALY
JF439799_HBc_P-G      MDRITLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439800_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439802_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439803_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439804_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439805_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439806_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439807_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439808_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439809_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439810_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439811_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439812_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439813_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439814_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439815_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439816_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439817_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JF439818_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JQ707660_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JQ707666_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JQ707668_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JQ707671_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JQ707673_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JQ707677_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JQ707678_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JQ707679_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JQ707680_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
JX899375_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
KF414679_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
KF767450_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
KF767451_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASXLY
KF767452_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
KF779233_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
KF779357_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
KJ194508_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
KM998716_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
KR230749_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
KX264500_HBc_P-G      MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
M74502_HBc_P-G        MDRTTLPYGLFGLDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALY
                      *** *********************** *****************:* **

KY004111_HBc_P-G      REALESFDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
KF779235_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JX899374_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
HE981171_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLAVNY
AB064312_HBc_P-G      RESLESSDHCSPHHAALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
AB056515_HBc_P-G      RESLESSVHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439792_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439793_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439796_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439801_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JQ707657_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
AB056513_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JQ707436_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
AB056514_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
AB064310_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
AB064311_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
AB064313_HBc_C-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
AB375165_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
AB375166_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
AB375167_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
AB375168_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
AB375169_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
AB375170_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
AF160501_HBc_C-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
AF405706_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
DQ207798_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
EF464097_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
EF464098_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
EF634480_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
GU563556_HBc_P-G      RESLESSEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
HE981172_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
HE981174_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
HE981175_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
HE981176_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439779_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439780_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439781_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439782_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439784_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439785_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439786_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439787_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439788_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439789_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439791_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439794_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439795_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439797_HBc_P-G      RESLESSDHCSPHHTALSQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439799_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439800_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439802_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439803_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439804_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439805_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439806_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439807_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439808_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439809_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439810_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439811_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439812_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439813_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439814_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439815_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439816_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439817_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JF439818_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JQ707660_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JQ707666_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JQ707668_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JQ707671_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JQ707673_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JQ707677_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JQ707678_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JQ707679_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JQ707680_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
JX899375_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
KF414679_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
KF767450_HBc_P-G      RESLESSDHSSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
KF767451_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
KF767452_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
KF779233_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
KF779357_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
KJ194508_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
KM998716_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
KR230749_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
KX264500_HBc_P-G      RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
M74502_HBc_P-G        RESLESSDHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNY
                      **:***  *.****:** ****************************.***

KY004111_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
KF779235_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JX899374_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
HE981171_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAP
AB064312_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
AB056515_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439792_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439793_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439796_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439801_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JQ707657_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
AB056513_HBc_P-G      VNTNLGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JQ707436_HBc_P-G      VNTNLGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
AB056514_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
AB064310_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
AB064311_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
AB064313_HBc_C-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
AB375165_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
AB375166_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
AB375167_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
AB375168_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
AB375169_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
AB375170_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
AF160501_HBc_C-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
AF405706_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
DQ207798_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
EF464097_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
EF464098_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
EF634480_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
GU563556_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
HE981172_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAP
HE981174_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
HE981175_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
HE981176_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439779_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439780_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439781_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439782_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439784_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439785_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439786_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439787_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439788_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439789_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439791_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439794_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439795_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439797_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439799_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439800_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439802_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439803_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439804_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439805_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439806_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439807_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439808_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439809_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439810_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439811_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439812_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439813_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439814_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439815_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439816_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439817_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JF439818_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JQ707660_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JQ707666_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JQ707668_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JQ707671_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JQ707673_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JQ707677_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JQ707678_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JQ707679_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JQ707680_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
JX899375_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
KF414679_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
KF767450_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
KF767451_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAP
KF767452_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
KF779233_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
KF779357_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
KJ194508_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
KM998716_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
KR230749_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
KX264500_HBc_P-G      VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
M74502_HBc_P-G        VNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAP
                      ****:************************************ ********

KY004111_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSTSPASQC
KF779235_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASSASQC
JX899374_HBc_P-G      ILSTLPETAVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
HE981171_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
AB064312_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
AB056515_HBc_P-G      ILSTLPETTVVRRRDRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439792_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASQASQC
JF439793_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASQASQC
JF439796_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASQASQC
JF439801_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASQASQC
JQ707657_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASQASQC
AB056513_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JQ707436_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
AB056514_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
AB064310_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
AB064311_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
AB064313_HBc_C-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
AB375165_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
AB375166_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
AB375167_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
AB375168_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
AB375169_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
AB375170_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
AF160501_HBc_C-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
AF405706_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
DQ207798_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
EF464097_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
EF464098_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
EF634480_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
GU563556_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
HE981172_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
HE981174_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
HE981175_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
HE981176_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439779_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439780_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439781_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439782_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439784_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439785_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439786_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439787_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439788_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439789_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439791_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439794_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439795_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439797_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRQRSQSPRRKRSASPASQC
JF439799_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439800_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439802_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439803_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439804_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439805_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439806_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439807_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439808_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439809_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439810_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439811_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439812_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439813_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439814_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439815_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439816_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439817_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JF439818_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JQ707660_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JQ707666_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JQ707668_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JQ707671_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JQ707673_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRGRSASPASQC
JQ707677_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JQ707678_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JQ707679_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JQ707680_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
JX899375_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
KF414679_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
KF767450_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
KF767451_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
KF767452_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
KF779233_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
KF779357_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
KJ194508_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
KM998716_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
KR230749_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
KX264500_HBc_P-G      ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
M74502_HBc_P-G        ILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSASPASQC
                      ********:*****.************.******* **:* ****

© 1998-2019