HBVdb

Dataset for protein HBx of genotype G

[Download (right click)] [Edit] [Sequences] [Repertoires]

83 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


FJ023674_HBx_P-G      MAARLCCQLDPARDVLCLRPVGAESSGRPLSGPVGDLPSPSPSAVPAXHG
FR714503_HBx_P-G      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
EF464097_HBx_P-G      MAARLCCHIDPFRDVLCLRPVSVESSGRPLLGSFGDLSPPSPSAVPADHG
KR811785_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811774_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB056514_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSTPSPFAVPADHG
KR811794_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811793_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811783_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811780_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811775_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811767_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811460_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811461_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811765_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811768_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811770_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811771_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811772_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811773_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811776_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811777_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSTVPADHG
KR811781_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811782_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811784_HBx_P-G      MAARLCCQLDPSRDVPCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811786_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811788_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811789_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811790_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811791_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811792_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811795_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811797_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811800_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811802_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811804_HBx_P-G      MAARLCCQLDPTRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811806_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR811807_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KM998716_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF767451_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707677_HBx_P-G      MAARLCCQLDPSRDVLCLRPDSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707657_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707660_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707666_HBx_P-G      MAARLCCHLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707668_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707671_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707673_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707678_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707679_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707680_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPAAHG
GU563556_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
JQ707436_HBx_P-G      LAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KJ194508_HBx_P-G      LAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB056513_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB056515_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB056516_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB064310_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB064312_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375165_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375166_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375167_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375168_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375169_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB375170_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AF160501_HBx_C-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AF405706_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
DQ207798_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
EF464098_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
EF634480_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSVVPADHG
GU565217_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981171_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981172_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981174_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSVVPADHG
HE981175_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981176_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF414679_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF767450_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF767452_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KR230749_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KX264500_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KY004111_HBx_P-G      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB064311_HBx_P-G      MAARLCRQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB064313_HBx_C-G      MAARLCRQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
                      :***** ::** *** **** ..**.**** *..* *...*. .**: **

FJ023674_HBx_P-G      AHLSLRGLPECAFSSAGPCALRFTSARRMETTVNAHLVLPKVLHKRTLGL
FR714503_HBx_P-G      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHLSLPKVLHKRTLGL
EF464097_HBx_P-G      AHLSLRGLPVCSFSSAGPCALCFTSARYMETAMNTSHHLPRQLYKRTLGL
KR811785_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTAARYMETAMNNSHPLPRQLYKRTLGL
KR811774_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMESAMNNSHPLPRQLYKGTLGL
AB056514_HBx_P-G      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
KR811794_HBx_P-G      AHLSLRGLPVCSSSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811793_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHHLPRQLYKRTLGL
KR811783_HBx_P-G      AHLSFRGLPVCSFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811780_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNPHHLPRQLYKRTLGL
KR811775_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRSTSARYMETAMNNSHPLPRQLYKRTLGL
KR811767_HBx_P-G      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNNSHPPPRQLYKRTLGL
KR811460_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811461_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811765_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHHLPRQLYKRTLGL
KR811768_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHHLPRQLYKRTLGL
KR811770_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHHLPRQLYKRTLGL
KR811771_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811772_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811773_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHHLPRQLYKRTLGL
KR811776_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811777_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811781_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHHLPRQLYKRTLGL
KR811782_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811784_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHHLPRQLYKRTLGL
KR811786_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811788_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811789_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHHLPRQLYKRTLGL
KR811790_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHHLPRQLYKRTLGL
KR811791_HBx_P-G      AHLSLRGLPVCSFSSAGPCALCFTSARYMETAMNNSHHLPRQLYKRTLGL
KR811792_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811795_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811797_HBx_P-G      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811800_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811802_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811804_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHHLPRQLYKRTLGL
KR811806_HBx_P-G      ANLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KR811807_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNNSHPLPRQLYKRTLGL
KM998716_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHPLPKQLYKRTLGL
KF767451_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHPLPRQLYKRTLGL
JQ707677_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPKQLYKRTLGL
JQ707657_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPKQLYKRTLGL
JQ707660_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPKQLYKRTLGL
JQ707666_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPKQLYKRTLGL
JQ707668_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPKQLYKRTLGL
JQ707671_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPKQLYKRTLGL
JQ707673_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPKQLYKRTLGL
JQ707678_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPKQLYKRTLGL
JQ707679_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPKQLYKRTLGL
JQ707680_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPKQLYKRTLGL
GU563556_HBx_P-G      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
JQ707436_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
KJ194508_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
AB056513_HBx_P-G      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
AB056515_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
AB056516_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
AB064310_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
AB064312_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
AB375165_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
AB375166_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
AB375167_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
AB375168_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
AB375169_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
AB375170_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
AF160501_HBx_C-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKWTLGL
AF405706_HBx_P-G      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
DQ207798_HBx_P-G      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTSHPLPRQLYKRTLGL
EF464098_HBx_P-G      AHLSLRGLPVCSFSSAGPCALCFTSARYMETAMNTSHHLPRQLYKRTLGL
EF634480_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
GU565217_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTIGL
HE981171_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
HE981172_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
HE981174_HBx_P-G      AHLYLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
HE981175_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
HE981176_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
KF414679_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHPLPRQLYKRTLGL
KF767450_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
KF767452_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHPLPRQLYKRTLGL
KR230749_HBx_P-G      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
KX264500_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
KY004111_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
AB064311_HBx_P-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTYHHLPRQLYKRTLGL
AB064313_HBx_C-G      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTSHHLPRQLYKRTLGL
                      *:* :**** *: ********  *:** **:::*     *. *:* *:**

FJ023674_HBx_P-G      SAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPTPCNF
FR714503_HBx_P-G      SAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPCNF
EF464097_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
KR811785_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCSF
KR811774_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCTPKLVCAPAPCNF
AB056514_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
KR811794_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811793_HBx_P-G      FVTSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811783_HBx_P-G      FAMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811780_HBx_P-G      FVVSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811775_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811767_HBx_P-G      FAMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811460_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811461_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811765_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811768_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811770_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811771_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811772_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811773_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811776_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811777_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811781_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811782_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811784_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811786_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811788_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811789_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811790_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811791_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIIVLGGCRHKLVCAPAPCNF
KR811792_HBx_P-G      FAMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811795_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811797_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811800_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLTIYVLGGCRHKLVCAPAPCNF
KR811802_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811804_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KR811806_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNRSRLMIYVLGGCRHKLVCAPAPCNF
KR811807_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KM998716_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
KF767451_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPCNF
JQ707677_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNF
JQ707657_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNF
JQ707660_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNF
JQ707666_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNF
JQ707668_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNF
JQ707671_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNF
JQ707673_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNF
JQ707678_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNF
JQ707679_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNF
JQ707680_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNF
GU563556_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKWVCAPAPCNF
JQ707436_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPCNF
KJ194508_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
AB056513_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
AB056515_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
AB056516_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
AB064310_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
AB064312_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
AB375165_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
AB375166_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
AB375167_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
AB375168_HBx_P-G      FVMSTTGVEKYLKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
AB375169_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
AB375170_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
AF160501_HBx_C-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
AF405706_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
DQ207798_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
EF464098_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
EF634480_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
GU565217_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPWNF
HE981171_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
HE981172_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
HE981174_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
HE981175_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
HE981176_HBx_P-G      FVMSTTGMEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
KF414679_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
KF767450_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
KF767452_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
KR230749_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
KX264500_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
KY004111_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
AB064311_HBx_P-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
AB064313_HBx_C-G      FVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPCNF
                       . ***.:* *:***** :*****:  **   *****  * **:*:* .*

FJ023674_HBx_P-G      FTSA
FR714503_HBx_P-G      FTSA
EF464097_HBx_P-G      FTSA
KR811785_HBx_P-G      FTSA
KR811774_HBx_P-G      FTSA
AB056514_HBx_P-G      FTSA
KR811794_HBx_P-G      FTSA
KR811793_HBx_P-G      FTSA
KR811783_HBx_P-G      FTSA
KR811780_HBx_P-G      FTSA
KR811775_HBx_P-G      FTSA
KR811767_HBx_P-G      FTSA
KR811460_HBx_P-G      FTSA
KR811461_HBx_P-G      FTSA
KR811765_HBx_P-G      FTSA
KR811768_HBx_P-G      FTSA
KR811770_HBx_P-G      FTSA
KR811771_HBx_P-G      FTSA
KR811772_HBx_P-G      FTSA
KR811773_HBx_P-G      FTSA
KR811776_HBx_P-G      FTSA
KR811777_HBx_P-G      FTSA
KR811781_HBx_P-G      FTSA
KR811782_HBx_P-G      FTSA
KR811784_HBx_P-G      FTSA
KR811786_HBx_P-G      FTSA
KR811788_HBx_P-G      FTSA
KR811789_HBx_P-G      FTSA
KR811790_HBx_P-G      FTSA
KR811791_HBx_P-G      FTSA
KR811792_HBx_P-G      FTSA
KR811795_HBx_P-G      FTSA
KR811797_HBx_P-G      FTSA
KR811800_HBx_P-G      FTSA
KR811802_HBx_P-G      FTSA
KR811804_HBx_P-G      FTSA
KR811806_HBx_P-G      FTSA
KR811807_HBx_P-G      FTSA
KM998716_HBx_P-G      FTSA
KF767451_HBx_P-G      FTSA
JQ707677_HBx_P-G      FTSA
JQ707657_HBx_P-G      FTSA
JQ707660_HBx_P-G      FTSA
JQ707666_HBx_P-G      FTSA
JQ707668_HBx_P-G      FTSA
JQ707671_HBx_P-G      FTSA
JQ707673_HBx_P-G      FTSA
JQ707678_HBx_P-G      FTSA
JQ707679_HBx_P-G      FTSA
JQ707680_HBx_P-G      FTSA
GU563556_HBx_P-G      FTSA
JQ707436_HBx_P-G      FTSA
KJ194508_HBx_P-G      FTSA
AB056513_HBx_P-G      FTSA
AB056515_HBx_P-G      FTSA
AB056516_HBx_P-G      FTSA
AB064310_HBx_P-G      FTSA
AB064312_HBx_P-G      FTSA
AB375165_HBx_P-G      FTSA
AB375166_HBx_P-G      FTSA
AB375167_HBx_P-G      FTSA
AB375168_HBx_P-G      FTSA
AB375169_HBx_P-G      FTSA
AB375170_HBx_P-G      FTSA
AF160501_HBx_C-G      FTSA
AF405706_HBx_P-G      FTSA
DQ207798_HBx_P-G      FTSA
EF464098_HBx_P-G      FTSA
EF634480_HBx_P-G      FTSA
GU565217_HBx_P-G      FTSA
HE981171_HBx_P-G      FTSA
HE981172_HBx_P-G      FTSA
HE981174_HBx_P-G      FTSA
HE981175_HBx_P-G      FTSA
HE981176_HBx_P-G      FTSA
KF414679_HBx_P-G      FTSA
KF767450_HBx_P-G      FTSA
KF767452_HBx_P-G      FTSA
KR230749_HBx_P-G      FTSA
KX264500_HBx_P-G      FTSA
KY004111_HBx_P-G      FTSA
AB064311_HBx_P-G      FTSA
AB064313_HBx_C-G      FTSA
                      ****

© 1998-2019