HBVdb

Dataset for protein LHBs of genotype G

[Download (right click)] [Edit] [Sequences] [Repertoires]

78 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KF779357_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439784_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439781_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439782_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439786_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439791_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JN604208_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439787_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
GU565217_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439779_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439789_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
AB056515_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439788_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
KF414679_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JQ707678_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JQ707671_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JQ707657_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JQ707660_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JQ707666_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JQ707668_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JQ707673_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JQ707677_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JQ707679_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JQ707680_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439792_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439793_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
AF160501_LHBs_C-G      -MGLSWTVPLEWGKNLSASNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
AB064312_LHBs_P-G      -MGLSWTVPLEWGRNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
AB064311_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
AB064310_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
AB056513_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
AB064313_LHBs_C-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
AB375165_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
AB375166_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
AB375167_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
AB375168_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
AB375169_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
AB375170_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
AF405706_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
EF634480_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
GU563556_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
HE981174_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
HE981175_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
HE981176_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
KF767450_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
KF779233_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
KF779235_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
KF779267_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPKKD
KJ194508_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
KM998716_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
KR230749_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
KX264500_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
KY004111_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439780_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439785_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439803_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439804_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439805_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439806_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439807_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439808_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439809_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439810_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439811_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439812_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439813_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439814_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439815_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439816_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439817_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JF439818_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
EF464097_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
EF464098_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
DQ207798_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
JQ707436_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
KF767451_LHBs_P-G      -MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNPKKD
FJ023674_LHBs_P-G      MGGWTSTPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKD
FR714503_LHBs_P-G      MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNPNKD
                         * : .     * ***..*****:********* **:*********:**

KF779357_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439784_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439781_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439782_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439786_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439791_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JN604208_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439787_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
GU565217_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPPSQGTLTTLPADPPPASTNRQ
JF439779_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439789_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
AB056515_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439788_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
KF414679_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JQ707678_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JQ707671_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JQ707657_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JQ707660_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JQ707666_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JQ707668_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JQ707673_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JQ707677_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JQ707679_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JQ707680_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439792_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439793_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
AF160501_LHBs_C-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
AB064312_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
AB064311_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPTASTNRQ
AB064310_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
AB056513_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
AB064313_LHBs_C-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
AB375165_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
AB375166_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
AB375167_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
AB375168_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
AB375169_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
AB375170_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
AF405706_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
EF634480_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
GU563556_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
HE981174_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSLQSQGTLTTLPADPPPASTNRQ
HE981175_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSLQSQGTLTTLPADPPPASTNRQ
HE981176_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSLQSQGTLTTLPADPPPASTNRQ
KF767450_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
KF779233_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
KF779235_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
KF779267_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
KJ194508_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
KM998716_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
KR230749_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
KX264500_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
KY004111_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439780_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439785_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439803_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439804_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439805_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439806_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439807_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439808_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439809_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439810_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439811_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439812_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439813_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439814_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439815_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439816_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439817_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JF439818_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
EF464097_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
EF464098_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
DQ207798_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
JQ707436_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
KF767451_LHBs_P-G      PWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPASTNRQ
FJ023674_LHBs_P-G      HWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPASTNRQ
FR714503_LHBs_P-G      HWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPASTNRQ
                        **:*::**.**:***************  :** **.:** **.******

KF779357_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
JF439784_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JF439781_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JF439782_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JF439786_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JF439791_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JN604208_LHBs_P-G      SRRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JF439787_LHBs_P-G      SRRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
GU565217_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JF439779_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JF439789_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
AB056515_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
JF439788_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFYQALQNPKVRGLYLPAGGSSSGI
KF414679_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JQ707678_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JQ707671_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JQ707657_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JQ707660_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JQ707666_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JQ707668_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JQ707673_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JQ707677_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JQ707679_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JQ707680_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JF439792_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
JF439793_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
AF160501_LHBs_C-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
AB064312_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPTVRGLYLPAGGSSSGI
AB064311_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
AB064310_LHBs_P-G      SGRQPTPISPPLRDSHPQALQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
AB056513_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
AB064313_LHBs_C-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
AB375165_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
AB375166_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
AB375167_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
AB375168_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
AB375169_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
AB375170_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
AF405706_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
EF634480_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
GU563556_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
HE981174_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
HE981175_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
HE981176_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
KF767450_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
KF779233_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
KF779235_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
KF779267_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
KJ194508_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
KM998716_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSSSGI
KR230749_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
KX264500_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
KY004111_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
JF439780_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
JF439785_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSSSGI
JF439803_LHBs_P-G      SGRQPTPIFPPLRDSHPQAMQWNSTAVHQALQNPKVRGLYFPAGGSSSGI
JF439804_LHBs_P-G      SGRQPTPIFPPLRDSHPQAMQWNSTAVHQALQNPKVRGLYFPAGGSSSGI
JF439805_LHBs_P-G      SGRQPTPIFPPLRDSHPQAMQWNSTAVHQALQNPKVRGLYFPAGGSSSGI
JF439806_LHBs_P-G      SGRQPTPIFPPLRDSHPQAMQWNSTAVHQALQNPKVRGLYFPAGGSSSGI
JF439807_LHBs_P-G      SGRQPTPIFPPLRDSHPQAMQWNSTAVHQALQNPKVRGLYFPAGGSSSGI
JF439808_LHBs_P-G      SGRQPTPIFPPLRDSHPQAMQWNSTAVHQALQNPKVRGLYFPAGGSSSGI
JF439809_LHBs_P-G      SGRQPTPIFPPLRDSHPQAMQWNSTAVHQALQNPKVRGLYFPAGGSSSGI
JF439810_LHBs_P-G      SGRQPTPIFPPLRDSHPQAMQWNSTAVHQALQNPKVRGLYFPAGGSSSGI
JF439811_LHBs_P-G      SGRQPTPIFPPLRDSHPQAMQWNSTAVHQALQNPKVRGLYFPAGGSSSGI
JF439812_LHBs_P-G      SGRQPTPIFPPLRDSHPQAMQWNSTAVHQALQNPKVRGLYFPAGGSSSGI
JF439813_LHBs_P-G      SGRQPTPIFPPLRDSHPQAMQWNSTAVHQALQNPKVRGLYFPAGGSSSGI
JF439814_LHBs_P-G      SGRQPTPIFPPLRDSHPQAMQWNSTAVHQALQNPKVRGLYFPAGGSSSGI
JF439815_LHBs_P-G      SGRQPTPIFPPLRDSHPQAMQWNSTAVHQALQNPKVRGLYFPAGGSSSGI
JF439816_LHBs_P-G      SGRQPTPIFPPLRDSHPQAMQWNSTAVHQALQNPKVRGLYFPAGGSSSGI
JF439817_LHBs_P-G      SGRQPTPIFPPLRDSHPQAMQWNSTAVHQALQNPKVRGLYFPAGGSSSGI
JF439818_LHBs_P-G      SGRQPTPIFPPLRDSHPQAMQWNSTAVHQALQNPKVRGLYFPAGGSSSGI
EF464097_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTQFHQALQNPKVRGLYFPAGGSSSET
EF464098_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTQFHQALQNPKVRGLYFPAGGSSSET
DQ207798_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLY-PAGGSSSGT
JQ707436_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLY-PAGGSSSGI
KF767451_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLY-PAGGSSSGI
FJ023674_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGT
FR714503_LHBs_P-G      SGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYLPAGGSSSGT
                       * ****** **********:***** .:****:* :**** *******  

KF779357_LHBs_P-G      VNPVPNIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGYFVLTRFF
JF439784_LHBs_P-G      VNPVPTIASHISSIFTRIGDPAPNMENITSGFLGPLLVSQAGFFLLTRIL
JF439781_LHBs_P-G      VNPVPTIASHISSIFTRIGDPAPNMENITSGFLGPLLVSQAGFFLLTRIL
JF439782_LHBs_P-G      VNPVPTIASHISSIFTRIGDPAPNMENITSGFLGPLLVSQAGFFLLTRIL
JF439786_LHBs_P-G      VNPVPTIASHISSIFTRIGDPAPNMENITSGFLGPLLVSQAGFFLLTRIL
JF439791_LHBs_P-G      VNPVPTIASHISSIFTRIGDPAPNMENITSGFLGPLLVSQAGFFLLTRIL
JN604208_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439787_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVSQAGFFLLTRIL
GU565217_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439779_LHBs_P-G      VNPVPTIASHISSIFTRIGDPAPNMENITSGFLGPLLVSQAGFFLLTRIL
JF439789_LHBs_P-G      VNPVPTIASHISSIFTRIGDPAPNMENITSGFLGPLLVSQAGFFLLTRIL
AB056515_LHBs_P-G      VNPVPTIASHISSIFSKIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439788_LHBs_P-G      VNPVPTIASHISSIFTRIGDPAPNMENITSGFLGPLLVSQAGFFLLTRIL
KF414679_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JQ707678_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JQ707671_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JQ707657_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JQ707660_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JQ707666_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JQ707668_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JQ707673_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JQ707677_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JQ707679_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JQ707680_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439792_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439793_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
AF160501_LHBs_C-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
AB064312_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
AB064311_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
AB064310_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
AB056513_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
AB064313_LHBs_C-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
AB375165_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
AB375166_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
AB375167_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
AB375168_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
AB375169_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
AB375170_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
AF405706_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
EF634480_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
GU563556_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
HE981174_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
HE981175_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
HE981176_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
KF767450_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
KF779233_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
KF779235_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
KF779267_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
KJ194508_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
KM998716_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
KR230749_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGVFLLTRIL
KX264500_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
KY004111_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439780_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439785_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439803_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439804_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439805_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439806_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439807_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439808_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439809_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439810_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439811_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439812_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439813_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439814_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439815_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439816_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439817_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JF439818_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
EF464097_LHBs_P-G      QNPVPTIASLTSSIFSKTGGPAPNMENITSGLLGPLLVLQAGFFLLTRIL
EF464098_LHBs_P-G      AEPAPTIASLTSSIFSKTGGPAPNMENITSGLLGPLLVLQAVCFLLTRIL
DQ207798_LHBs_P-G      VSPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
JQ707436_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
KF767451_LHBs_P-G      VNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLTRIL
FJ023674_LHBs_P-G      VNPVPNIASHISSIFARTGDLAPNMENITSGFLGPLLVLQAGFFLLTKIL
FR714503_LHBs_P-G      VNPAPNIASHISSIFTRIGDPATNMENITSGFLGPLLVLQAGFFLLTKIL
                        .*.*.***  ****:. *. *.********:****** **  *:**.::

KF779357_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439784_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439781_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439782_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439786_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439791_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JN604208_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439787_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
GU565217_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439779_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439789_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
AB056515_LHBs_P-G      TIPQSLDSWWTSLNFLGGAPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439788_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
KF414679_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSLISCPPTCPGYRWMW
JQ707678_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JQ707671_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JQ707657_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JQ707660_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JQ707666_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JQ707668_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JQ707673_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JQ707677_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JQ707679_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JQ707680_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439792_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSLISCPPTCPGYRWMC
JF439793_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSLISCPPTCPGYRWMC
AF160501_LHBs_C-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
AB064312_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
AB064311_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
AB064310_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
AB056513_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
AB064313_LHBs_C-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
AB375165_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
AB375166_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
AB375167_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
AB375168_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
AB375169_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
AB375170_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
AF405706_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
EF634480_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
GU563556_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
HE981174_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
HE981175_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
HE981176_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
KF767450_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
KF779233_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
KF779235_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
KF779267_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
KJ194508_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
KM998716_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
KR230749_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
KX264500_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
KY004111_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439780_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439785_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439803_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439804_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439805_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439806_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439807_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439808_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439809_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439810_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439811_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439812_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439813_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439814_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439815_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439816_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439817_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JF439818_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
EF464097_LHBs_P-G      TIPQSLDSWWTSLNFLGEVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
EF464098_LHBs_P-G      TIPQSLDSWWTSLNFLGEVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
DQ207798_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
JQ707436_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
KF767451_LHBs_P-G      TIPQSLDSWWTSLNFLGGVPVCPGLNSQSPTSNHSPISCPPTCPGYRWMC
FJ023674_LHBs_P-G      TIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMC
FR714503_LHBs_P-G      TIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMC
                       ***************** ..** * **********  **** ******* 

KF779357_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439784_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439781_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439782_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439786_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439791_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JN604208_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439787_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
GU565217_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439779_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439789_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
AB056515_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439788_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
KF414679_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JQ707678_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JQ707671_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JQ707657_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JQ707660_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JQ707666_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JQ707668_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JQ707673_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JQ707677_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JQ707679_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JQ707680_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439792_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439793_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
AF160501_LHBs_C-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
AB064312_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
AB064311_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
AB064310_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
AB056513_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
AB064313_LHBs_C-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
AB375165_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
AB375166_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSSTTSTGPCKTCTT
AB375167_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSSTTSTGPCKTCTT
AB375168_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSSTTSTGPCKTCTT
AB375169_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSSTTSTGPCKTCTT
AB375170_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLISGSSTTSTGPCKTCTT
AF405706_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
EF634480_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
GU563556_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
HE981174_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
HE981175_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
HE981176_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
KF767450_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
KF779233_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
KF779235_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
KF779267_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
KJ194508_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
KM998716_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
KR230749_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
KX264500_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
KY004111_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439780_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439785_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439803_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439804_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439805_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439806_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439807_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439808_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439809_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439810_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439811_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439812_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439813_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439814_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439815_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439816_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439817_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JF439818_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
EF464097_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
EF464098_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
DQ207798_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
JQ707436_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
KF767451_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
FJ023674_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTT
FR714503_LHBs_P-G      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTT
                       **********************************.**********.****

KF779357_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASARFSWLSLL
JF439784_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439781_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439782_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439786_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439791_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JN604208_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439787_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLL
GU565217_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLL
JF439779_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLL
JF439789_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLL
AB056515_LHBs_P-G      PAQGNSMYPSCCCIKPSEGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439788_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
KF414679_LHBs_P-G      PAQGNSMYPSCCCTKPSDRNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JQ707678_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JQ707671_LHBs_P-G      PAQGNSMYPSCCCTKLSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JQ707657_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JQ707660_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JQ707666_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JQ707668_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JQ707673_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JQ707677_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JQ707679_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JQ707680_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439792_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439793_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
AF160501_LHBs_C-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
AB064312_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
AB064311_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
AB064310_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
AB056513_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
AB064313_LHBs_C-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
AB375165_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
AB375166_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
AB375167_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
AB375168_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
AB375169_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
AB375170_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
AF405706_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
EF634480_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
GU563556_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
HE981174_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
HE981175_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
HE981176_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
KF767450_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
KF779233_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
KF779235_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
KF779267_LHBs_P-G      PAQGNSMYPSCCCTKPSDRNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
KJ194508_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
KM998716_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
KR230749_LHBs_P-G      PAQGNSMYPSCCCTKPSDRNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
KX264500_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
KY004111_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439780_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439785_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439803_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439804_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439805_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439806_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439807_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439808_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439809_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439810_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439811_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439812_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439813_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439814_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439815_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439816_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439817_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JF439818_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
EF464097_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
EF464098_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
DQ207798_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
JQ707436_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLL
KF767451_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWDWASVRFSWLSLL
FJ023674_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASARFSWLSLL
FR714503_LHBs_P-G      PAQGNSMYPSCCCTKPSDGNCTCIPIPSSWAFAKYLWEWASARFSWLSLL
                       ************* * *: ******************:***.********

KF779357_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
JF439784_LHBs_P-G      VPFVQWFVGLSHTVWLSAMWMILYWGPNLYNILSPFIPLLPIFFCLWVYI
JF439781_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMILYWGPNLYNILSPFIPLLPIFFCLWVYI
JF439782_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMILYWGPNLYNILSPFIPLLPIFFCLWVYI
JF439786_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMILYWGPNLYNILSPFIPLLPIFFCLWVYI
JF439791_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMILYWGPNLYNILSPFIPLLPIFFCLWVYI
JN604208_LHBs_P-G      VPFVQWFVGLSPTVWLSVIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
JF439787_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
GU565217_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
JF439779_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
JF439789_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
AB056515_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
JF439788_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
KF414679_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
JQ707678_LHBs_P-G      VPFVQWFVGLSPTVWLSAISMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
JQ707671_LHBs_P-G      VPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
JQ707657_LHBs_P-G      VPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
JQ707660_LHBs_P-G      VPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
JQ707666_LHBs_P-G      VPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
JQ707668_LHBs_P-G      VPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
JQ707673_LHBs_P-G      VPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
JQ707677_LHBs_P-G      VPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
JQ707679_LHBs_P-G      VPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
JQ707680_LHBs_P-G      VPFVQWFVGLSPTVWLSAILMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
JF439792_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
JF439793_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFLPLLPIFFCLWVYI
AF160501_LHBs_C-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
AB064312_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
AB064311_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
AB064310_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
AB056513_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
AB064313_LHBs_C-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
AB375165_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
AB375166_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
AB375167_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
AB375168_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
AB375169_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
AB375170_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
AF405706_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
EF634480_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
GU563556_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
HE981174_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
HE981175_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
HE981176_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
KF767450_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
KF779233_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
KF779235_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
KF779267_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
KJ194508_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
KM998716_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
KR230749_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
KX264500_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
KY004111_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
JF439780_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439785_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439803_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439804_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439805_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439806_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439807_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439808_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439809_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439810_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439811_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439812_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439813_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439814_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439815_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439816_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439817_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
JF439818_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFLCLWVYI
EF464097_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
EF464098_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
DQ207798_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
JQ707436_LHBs_P-G      VPFVQWFVGLSPTVWLSAIWMMWYWGPNLYNILSPFIPLLPIFFCLWVYI
KF767451_LHBs_P-G      VPFVQWFVGLSPTVWLSAMWMMWYWGPNLYSILSPFIPLLPIFFCLWVYI
FJ023674_LHBs_P-G      APFVQWFVGLSPTVWLSVIWMMWYWGPNLYXTLSPFIPLLPIFFCLWVYI
FR714503_LHBs_P-G      VPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILRPFIPLLPIFFCLWVYI
                       .********** *****.: *: ****.**  * **:******:******

KF779357_LHBs_P-G      -
JF439784_LHBs_P-G      -
JF439781_LHBs_P-G      -
JF439782_LHBs_P-G      -
JF439786_LHBs_P-G      -
JF439791_LHBs_P-G      -
JN604208_LHBs_P-G      -
JF439787_LHBs_P-G      -
GU565217_LHBs_P-G      -
JF439779_LHBs_P-G      -
JF439789_LHBs_P-G      -
AB056515_LHBs_P-G      -
JF439788_LHBs_P-G      Q
KF414679_LHBs_P-G      -
JQ707678_LHBs_P-G      -
JQ707671_LHBs_P-G      -
JQ707657_LHBs_P-G      -
JQ707660_LHBs_P-G      -
JQ707666_LHBs_P-G      -
JQ707668_LHBs_P-G      -
JQ707673_LHBs_P-G      -
JQ707677_LHBs_P-G      -
JQ707679_LHBs_P-G      -
JQ707680_LHBs_P-G      -
JF439792_LHBs_P-G      -
JF439793_LHBs_P-G      -
AF160501_LHBs_C-G      -
AB064312_LHBs_P-G      -
AB064311_LHBs_P-G      -
AB064310_LHBs_P-G      -
AB056513_LHBs_P-G      -
AB064313_LHBs_C-G      -
AB375165_LHBs_P-G      -
AB375166_LHBs_P-G      -
AB375167_LHBs_P-G      -
AB375168_LHBs_P-G      -
AB375169_LHBs_P-G      -
AB375170_LHBs_P-G      -
AF405706_LHBs_P-G      -
EF634480_LHBs_P-G      -
GU563556_LHBs_P-G      -
HE981174_LHBs_P-G      -
HE981175_LHBs_P-G      -
HE981176_LHBs_P-G      -
KF767450_LHBs_P-G      -
KF779233_LHBs_P-G      -
KF779235_LHBs_P-G      -
KF779267_LHBs_P-G      -
KJ194508_LHBs_P-G      -
KM998716_LHBs_P-G      -
KR230749_LHBs_P-G      -
KX264500_LHBs_P-G      -
KY004111_LHBs_P-G      -
JF439780_LHBs_P-G      -
JF439785_LHBs_P-G      -
JF439803_LHBs_P-G      -
JF439804_LHBs_P-G      -
JF439805_LHBs_P-G      -
JF439806_LHBs_P-G      -
JF439807_LHBs_P-G      -
JF439808_LHBs_P-G      -
JF439809_LHBs_P-G      -
JF439810_LHBs_P-G      -
JF439811_LHBs_P-G      -
JF439812_LHBs_P-G      -
JF439813_LHBs_P-G      -
JF439814_LHBs_P-G      -
JF439815_LHBs_P-G      -
JF439816_LHBs_P-G      -
JF439817_LHBs_P-G      -
JF439818_LHBs_P-G      -
EF464097_LHBs_P-G      -
EF464098_LHBs_P-G      -
DQ207798_LHBs_P-G      -
JQ707436_LHBs_P-G      -
KF767451_LHBs_P-G      -
FJ023674_LHBs_P-G      -
FR714503_LHBs_P-G      -
                        

© 1998-2019