HBVdb

Dataset for protein MHBs of genotype G

[Download (right click)] [Edit] [Sequences] [Repertoires]

78 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


DQ207798_MHBs_P-G      MQWNSTAFHQALQNPKVRGLY-PAGGSSSGTVSPVPTIASHISSIFSRIG
JQ707436_MHBs_P-G      MQWNSTAFHQALQNPKVRGLY-PAGGSSSGIVNPVPTIASHISSIFSRIG
KF767451_MHBs_P-G      MQWNSTAFHQALQNPKVRGLY-PAGGSSSGIVNPVPTIASHISSIFSRIG
KF779357_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPNIASHISSIFSRIG
JF439784_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFTRIG
JF439781_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFTRIG
JF439782_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFTRIG
JF439786_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFTRIG
JF439791_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFTRIG
AB056515_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSKIG
JF439788_MHBs_P-G      MQWNSTAFYQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFTRIG
KF414679_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
JQ707678_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
JQ707671_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
JN604208_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439779_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFTRIG
JF439789_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFTRIG
JQ707657_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
JQ707660_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
JQ707666_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
JQ707668_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
JQ707673_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
JQ707677_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
JQ707679_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
JQ707680_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439792_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439793_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
GU565217_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439787_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439780_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439785_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439803_MHBs_P-G      MQWNSTAVHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439804_MHBs_P-G      MQWNSTAVHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439805_MHBs_P-G      MQWNSTAVHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439806_MHBs_P-G      MQWNSTAVHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439807_MHBs_P-G      MQWNSTAVHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439808_MHBs_P-G      MQWNSTAVHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439809_MHBs_P-G      MQWNSTAVHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439810_MHBs_P-G      MQWNSTAVHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439811_MHBs_P-G      MQWNSTAVHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439812_MHBs_P-G      MQWNSTAVHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439813_MHBs_P-G      MQWNSTAVHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439814_MHBs_P-G      MQWNSTAVHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439815_MHBs_P-G      MQWNSTAVHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439816_MHBs_P-G      MQWNSTAVHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439817_MHBs_P-G      MQWNSTAVHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JF439818_MHBs_P-G      MQWNSTAVHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
AB056513_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
AB064311_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
AB064312_MHBs_P-G      MQWNSTAFHQALQNPTVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
AB064313_MHBs_C-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
AB375165_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
AB375166_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
AB375167_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
AB375168_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
AB375169_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
AB375170_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
AF160501_MHBs_C-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
AF405706_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
EF634480_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
GU563556_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
HE981174_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
HE981175_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
HE981176_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
KF767450_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
KF779233_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
KF779235_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
KF779267_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
KJ194508_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
KM998716_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
KR230749_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
KX264500_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
KY004111_MHBs_P-G      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
AB064310_MHBs_P-G      LQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
EF464097_MHBs_P-G      MQWNSTQFHQALQNPKVRGLYFPAGGSSSETQNPVPTIASLTSSIFSKTG
EF464098_MHBs_P-G      MQWNSTQFHQALQNPKVRGLYFPAGGSSSETAEPAPTIASLTSSIFSKTG
FJ023674_MHBs_P-G      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSIFARTG
FR714503_MHBs_P-G      MQWNSTTFHQALQDPRIRGLYLPAGGSSSGTVNPAPNIASHISSIFTRIG
                       :***** .:****:* :**** *******   .*.*.***  ****:. *

DQ207798_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JQ707436_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KF767451_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KF779357_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGYFVLTRFFTIPQSLDSWWTSLNFLGGV
JF439784_MHBs_P-G      DPAPNMENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439781_MHBs_P-G      DPAPNMENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439782_MHBs_P-G      DPAPNMENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439786_MHBs_P-G      DPAPNMENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439791_MHBs_P-G      DPAPNMENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AB056515_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF439788_MHBs_P-G      DPAPNMENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KF414679_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JQ707678_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JQ707671_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JN604208_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439779_MHBs_P-G      DPAPNMENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439789_MHBs_P-G      DPAPNMENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JQ707657_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JQ707660_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JQ707666_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JQ707668_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JQ707673_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JQ707677_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JQ707679_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JQ707680_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439792_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439793_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
GU565217_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439787_MHBs_P-G      DPAPNMENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439780_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439785_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439803_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439804_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439805_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439806_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439807_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439808_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439809_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439810_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439811_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439812_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439813_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439814_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439815_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439816_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439817_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JF439818_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AB056513_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AB064311_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AB064312_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AB064313_MHBs_C-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AB375165_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AB375166_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AB375167_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AB375168_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AB375169_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AB375170_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AF160501_MHBs_C-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AF405706_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
EF634480_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
GU563556_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
HE981174_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
HE981175_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
HE981176_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KF767450_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KF779233_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KF779235_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KF779267_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KJ194508_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KM998716_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KR230749_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGVFLLTRILTIPQSLDSWWTSLNFLGGV
KX264500_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KY004111_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AB064310_MHBs_P-G      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
EF464097_MHBs_P-G      GPAPNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEV
EF464098_MHBs_P-G      GPAPNMENITSGLLGPLLVLQAVCFLLTRILTIPQSLDSWWTSLNFLGEV
FJ023674_MHBs_P-G      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
FR714503_MHBs_P-G      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
                       . *.********:****** **  *:**.::***************** .

DQ207798_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707436_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF767451_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF779357_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439784_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439781_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439782_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439786_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439791_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB056515_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439788_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF414679_MHBs_P-G      PVCPGLNSQSPTSNHSLISCPPTCPGYRWMWLRRFIIFLFILLLCLIFLL
JQ707678_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707671_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN604208_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439779_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439789_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707657_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707660_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707666_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707668_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707673_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707677_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707679_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ707680_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439792_MHBs_P-G      PVCPGLNSQSPTSNHSLISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439793_MHBs_P-G      PVCPGLNSQSPTSNHSLISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU565217_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439787_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439780_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439785_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439803_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439804_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439805_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439806_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439807_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439808_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439809_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439810_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439811_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439812_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439813_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439814_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439815_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439816_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439817_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF439818_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB056513_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB064311_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB064312_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB064313_MHBs_C-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB375165_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB375166_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB375167_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB375168_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB375169_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB375170_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF160501_MHBs_C-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF405706_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EF634480_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU563556_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HE981174_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HE981175_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HE981176_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF767450_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF779233_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF779235_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF779267_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ194508_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM998716_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KR230749_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX264500_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY004111_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB064310_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EF464097_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EF464098_MHBs_P-G      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ023674_MHBs_P-G      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FR714503_MHBs_P-G      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
                       .** * **********  **** ******* *******************

DQ207798_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JQ707436_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
KF767451_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
KF779357_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439784_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439781_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439782_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439786_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439791_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
AB056515_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCIKPSEG
JF439788_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
KF414679_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDR
JQ707678_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JQ707671_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKLSDG
JN604208_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439779_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439789_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JQ707657_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JQ707660_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JQ707666_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JQ707668_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JQ707673_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JQ707677_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JQ707679_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JQ707680_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439792_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439793_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
GU565217_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439787_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439780_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439785_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439803_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439804_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439805_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439806_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439807_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439808_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439809_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439810_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439811_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439812_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439813_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439814_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439815_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439816_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439817_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
JF439818_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
AB056513_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
AB064311_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
AB064312_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
AB064313_MHBs_C-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
AB375165_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
AB375166_MHBs_P-G      VLLDYQGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
AB375167_MHBs_P-G      VLLDYQGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
AB375168_MHBs_P-G      VLLDYQGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
AB375169_MHBs_P-G      VLLDYQGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
AB375170_MHBs_P-G      VLLDYQGMLPVCPLISGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
AF160501_MHBs_C-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
AF405706_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
EF634480_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
GU563556_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
HE981174_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
HE981175_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
HE981176_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
KF767450_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
KF779233_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
KF779235_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
KF779267_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDR
KJ194508_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
KM998716_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
KR230749_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDR
KX264500_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
KY004111_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
AB064310_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
EF464097_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
EF464098_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
FJ023674_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDG
FR714503_MHBs_P-G      VLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDG
                       ***************.**********.***************** * *: 

DQ207798_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
JQ707436_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
KF767451_MHBs_P-G      NCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
KF779357_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSAI
JF439784_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSHTVWLSAM
JF439781_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439782_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439786_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439791_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
AB056515_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
JF439788_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
KF414679_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JQ707678_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
JQ707671_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
JN604208_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVI
JF439779_MHBs_P-G      NCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439789_MHBs_P-G      NCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JQ707657_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
JQ707660_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
JQ707666_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
JQ707668_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
JQ707673_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
JQ707677_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
JQ707679_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
JQ707680_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
JF439792_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439793_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
GU565217_MHBs_P-G      NCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439787_MHBs_P-G      NCTCIPIPSSWAFAKYLWDWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439780_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439785_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439803_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439804_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439805_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439806_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439807_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439808_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439809_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439810_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439811_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439812_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439813_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439814_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439815_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439816_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439817_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
JF439818_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
AB056513_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
AB064311_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
AB064312_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
AB064313_MHBs_C-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
AB375165_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
AB375166_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
AB375167_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
AB375168_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
AB375169_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
AB375170_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
AF160501_MHBs_C-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
AF405706_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
EF634480_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
GU563556_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
HE981174_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
HE981175_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
HE981176_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
KF767450_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
KF779233_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
KF779235_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
KF779267_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
KJ194508_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
KM998716_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
KR230749_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
KX264500_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
KY004111_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
AB064310_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAI
EF464097_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
EF464098_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAM
FJ023674_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASARFSWLSLLAPFVQWFVGLSPTVWLSVI
FR714503_MHBs_P-G      NCTCIPIPSSWAFAKYLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVI
                       ******************:***.********.********** *****.:

DQ207798_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
JQ707436_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
KF767451_MHBs_P-G      WMMWYWGPNLYSILSPFIPLLPIFFCLWVYI-
KF779357_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
JF439784_MHBs_P-G      WMILYWGPNLYNILSPFIPLLPIFFCLWVYI-
JF439781_MHBs_P-G      WMILYWGPNLYNILSPFIPLLPIFFCLWVYI-
JF439782_MHBs_P-G      WMILYWGPNLYNILSPFIPLLPIFFCLWVYI-
JF439786_MHBs_P-G      WMILYWGPNLYNILSPFIPLLPIFFCLWVYI-
JF439791_MHBs_P-G      WMILYWGPNLYNILSPFIPLLPIFFCLWVYI-
AB056515_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
JF439788_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYIQ
KF414679_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
JQ707678_MHBs_P-G      SMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
JQ707671_MHBs_P-G      LMMWYWGPNLYNILSPFLPLLPIFFCLWVYI-
JN604208_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
JF439779_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
JF439789_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
JQ707657_MHBs_P-G      LMMWYWGPNLYNILSPFLPLLPIFFCLWVYI-
JQ707660_MHBs_P-G      LMMWYWGPNLYNILSPFLPLLPIFFCLWVYI-
JQ707666_MHBs_P-G      LMMWYWGPNLYNILSPFLPLLPIFFCLWVYI-
JQ707668_MHBs_P-G      LMMWYWGPNLYNILSPFLPLLPIFFCLWVYI-
JQ707673_MHBs_P-G      LMMWYWGPNLYNILSPFLPLLPIFFCLWVYI-
JQ707677_MHBs_P-G      LMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
JQ707679_MHBs_P-G      LMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
JQ707680_MHBs_P-G      LMMWYWGPNLYNILSPFLPLLPIFFCLWVYI-
JF439792_MHBs_P-G      WMMWYWGPNLYNILSPFLPLLPIFFCLWVYI-
JF439793_MHBs_P-G      WMMWYWGPNLYNILSPFLPLLPIFFCLWVYI-
GU565217_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
JF439787_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
JF439780_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439785_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439803_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439804_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439805_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439806_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439807_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439808_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439809_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439810_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439811_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439812_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439813_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439814_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439815_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439816_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439817_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
JF439818_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFLCLWVYI-
AB056513_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
AB064311_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
AB064312_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
AB064313_MHBs_C-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
AB375165_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
AB375166_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
AB375167_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
AB375168_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
AB375169_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
AB375170_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
AF160501_MHBs_C-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
AF405706_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
EF634480_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
GU563556_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
HE981174_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
HE981175_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
HE981176_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
KF767450_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
KF779233_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
KF779235_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
KF779267_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
KJ194508_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
KM998716_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
KR230749_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
KX264500_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
KY004111_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
AB064310_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
EF464097_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
EF464098_MHBs_P-G      WMMWYWGPNLYNILSPFIPLLPIFFCLWVYI-
FJ023674_MHBs_P-G      WMMWYWGPNLYXTLSPFIPLLPIFFCLWVYI-
FR714503_MHBs_P-G      WMMWYWGPSLYNILRPFIPLLPIFFCLWVYI-
                        *: ****.**  * **:******:****** 

© 1998-2019