HBVdb

Dataset for protein Pol of genotype G

[Download (right click)] [Edit] [Sequences] [Repertoires]

48 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KR230749_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
EF464097_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
EF464098_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
KF779267_Pol_P-G      MPLSYQHFRRLLLLDEEAGLLEEELPRLAEPSPNSRVAEDLHLQLPNVSI
AB056515_Pol_P-G      MPLSYQHFRRLLLLDEETGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
JQ707677_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
KF779357_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
AF405706_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
GU565217_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNDSI
HE981171_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
HE981172_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
KF414679_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
AB064310_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
JQ707660_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
AB064312_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
AB056513_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
JQ707657_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLKLPNVSI
JQ707666_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
JQ707668_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
JQ707671_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
JQ707673_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
JQ707678_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
JQ707679_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
JQ707680_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
HE981174_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
HE981175_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
HE981176_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
KF779235_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
KF767450_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
AF160501_Pol_C-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
AB064311_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
AB064313_Pol_C-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
KY004111_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
KX264500_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
KM998716_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
KJ194508_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
KF779233_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
GU563556_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
EF634480_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
AB375170_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
AB375169_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
AB375168_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
AB375167_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
AB375165_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
AB375166_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
KF767452_Pol_P-G      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLHLQLPNVSI
FJ023674_Pol_P-G      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNVSI
FR714503_Pol_P-G      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNVSI
                      *********.*****:*:* *********: . * ******:*   * **

KR230749_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
EF464097_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
EF464098_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
KF779267_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
AB056515_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
JQ707677_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
KF779357_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
AF405706_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
GU565217_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
HE981171_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
HE981172_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
KF414679_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
AB064310_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
JQ707660_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
AB064312_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
AB056513_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
JQ707657_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
JQ707666_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
JQ707668_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
JQ707671_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
JQ707673_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
JQ707678_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
JQ707679_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
JQ707680_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
HE981174_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
HE981175_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
HE981176_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
KF779235_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
KF767450_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
AF160501_Pol_C-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
AB064311_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
AB064313_Pol_C-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
KY004111_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
KX264500_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
KM998716_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
KJ194508_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
KF779233_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
GU563556_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
EF634480_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
AB375170_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
AB375169_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
AB375168_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
AB375167_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
AB375165_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
AB375166_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
KF767452_Pol_P-G      PWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQFVGPLT
FJ023674_Pol_P-G      PWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLHEDIIDRCQQFVGPLT
FR714503_Pol_P-G      PWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQFVGPLT
                      ****************:*****:************:*** .*:*******

KR230749_Pol_P-G      VNEK---QLVMPARFFPNSTKYLPLDKGIK-YYPENVVNHYFQTRHYLHT
EF464097_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
EF464098_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
KF779267_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
AB056515_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
JQ707677_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
KF779357_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
AF405706_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
GU565217_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
HE981171_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
HE981172_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
KF414679_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
AB064310_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
JQ707660_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
AB064312_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
AB056513_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
JQ707657_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
JQ707666_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
JQ707668_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
JQ707671_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
JQ707673_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
JQ707678_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
JQ707679_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
JQ707680_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
HE981174_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
HE981175_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
HE981176_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
KF779235_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
KF767450_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
AF160501_Pol_C-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
AB064311_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
AB064313_Pol_C-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
KY004111_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
KX264500_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
KM998716_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
KJ194508_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
KF779233_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
GU563556_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
EF634480_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
AB375170_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
AB375169_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
AB375168_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
AB375167_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
AB375165_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
AB375166_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
KF767452_Pol_P-G      VNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQTRHYLHT
FJ023674_Pol_P-G      VNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPEHAVNHYFKARHYLHT
FR714503_Pol_P-G      VNEKRRLNLIMPARFYPNRTKYLPLDKGIKPYYPEQAVNHYFKTRHYLHT
                      ****   :*:*****:** *********** ****:.*****::******

KR230749_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
EF464097_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
EF464098_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
KF779267_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
AB056515_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
JQ707677_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
KF779357_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
AF405706_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
GU565217_Pol_P-G      LWKTGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
HE981171_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
HE981172_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
KF414679_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
AB064310_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
JQ707660_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
AB064312_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
AB056513_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
JQ707657_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
JQ707666_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
JQ707668_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
JQ707671_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
JQ707673_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
JQ707678_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
JQ707679_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
JQ707680_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
HE981174_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
HE981175_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
HE981176_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
KF779235_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
KF767450_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
AF160501_Pol_C-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFRQQ
AB064311_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
AB064313_Pol_C-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
KY004111_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
KX264500_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
KM998716_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
KJ194508_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
KF779233_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
GU563556_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
EF634480_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
AB375170_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
AB375169_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
AB375168_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
AB375167_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
AB375165_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
AB375166_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
KF767452_Pol_P-G      LWKAGILYKRETSRSASFCGSPYTWEQDLQHGAF-LDGPSRVGKEPFHQQ
FJ023674_Pol_P-G      LWKAGILYKRETTRSASFCGSPYSWEQELQHGRVDIHPSERHGDESFCTQ
FR714503_Pol_P-G      LWKAGILYKRETTRSASFCGSPYYREQEPQHGRLVFQTSKRHGDESFCSQ
                      ***:********:********** .**: *** . :  ..* *.*.*  *

KR230749_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
EF464097_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
EF464098_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
KF779267_Pol_P-G      SSGILSRSPVGPSLQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
AB056515_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
JQ707677_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
KF779357_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
AF405706_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
GU565217_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
HE981171_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
HE981172_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
KF414679_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
AB064310_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
JQ707660_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
AB064312_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
AB056513_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
JQ707657_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
JQ707666_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
JQ707668_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
JQ707671_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
JQ707673_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
JQ707678_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
JQ707679_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
JQ707680_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
HE981174_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
HE981175_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
HE981176_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
KF779235_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLRTRVHPS
KF767450_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
AF160501_Pol_C-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
AB064311_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
AB064313_Pol_C-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
KY004111_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
KX264500_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
KM998716_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
KJ194508_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
KF779233_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
GU563556_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
EF634480_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
AB375170_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
AB375169_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
AB375168_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
AB375167_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
AB375165_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
AB375166_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSWSLWTRVHPS
KF767452_Pol_P-G      SSRIPSRSPVGPSIQSKYQQSRLGLQSQKGPLARGQQGRSRSLWTRVHPS
FJ023674_Pol_P-G      SSGISSRSSVGSCVRSQLKQSRLGLQPQQGPLATSPSGRSGSIRARVHPS
FR714503_Pol_P-G      SSGISSRSSVGPCVRSQLKQSRLGLQPQQGPLATSPSGRSGSIRARVHPS
                      ** * ***.**..:.*: :*******.*:**** . .*** *:.:*****

KR230749_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
EF464097_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
EF464098_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
KF779267_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
AB056515_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTSKRQSSSGH
JQ707677_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
KF779357_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
AF405706_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
GU565217_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
HE981171_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
HE981172_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
KF414679_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
AB064310_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGP
JQ707660_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
AB064312_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
AB056513_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
JQ707657_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
JQ707666_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
JQ707668_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
JQ707671_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
JQ707673_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
JQ707678_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
JQ707679_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
JQ707680_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
HE981174_Pol_P-G      TRRPFGVEPSISGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
HE981175_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
HE981176_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
KF779235_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
KF767450_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
AF160501_Pol_C-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
AB064311_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSAHCLHQSSVREAAYSHLSTTKRQSSSGH
AB064313_Pol_C-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
KY004111_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
KX264500_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
KM998716_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
KJ194508_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
KF779233_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
GU563556_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
EF634480_Pol_P-G      TRRPSGVEPSVSGHTNNFTSRSASCLHQSSVREAAYSHLSTTKRQSSSGH
AB375170_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
AB375169_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
AB375168_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
AB375167_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
AB375165_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
AB375166_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
KF767452_Pol_P-G      TRRPFGVEPSVSGHTNNFASRSASCLHQSSVREAAYSHLSTTKRQSSSGH
FJ023674_Pol_P-G      TRRSVGVEPSGSGHINKCASSSSSCLNQSAVRTAAHSHLSTSERQXSSGH
FR714503_Pol_P-G      SRRSFGVEPSGSGHINKRASSSSSCLHQSAVRKAANSHISTSKRQSSSGH
                      :**. ***** *** *: :* *: **:**:** ** **:**::** *** 

KR230749_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
EF464097_Pol_P-G      AVELHPVPPSSTKSQSQGPVFSCWWLQFRDTEPCSDYCLSHIINLLEDWG
EF464098_Pol_P-G      AVELHPVPPSSTKSQSQGPVFSCWWLQFRDSRTCSDYCLSHIINLLEDWG
KF779267_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
AB056515_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
JQ707677_Pol_P-G      AVELYSIPPSSTKSQSQGPVSSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
KF779357_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSEYCLSHLVNLLQDWG
AF405706_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
GU565217_Pol_P-G      AVELYSIPPSSTKSQSQGPVSSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
HE981171_Pol_P-G      AVELYSIPPSSTKSQSQ----SCWWLQFRDSEPCSDYCLSHLVNLLQDWG
HE981172_Pol_P-G      AVELYSIPPSSTKSQSQ----SCWWLQFRDSEPCSDYCLSHLVNLLQDWG
KF414679_Pol_P-G      AVELYSIPPSSTKSQSQGPVSSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
AB064310_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
JQ707660_Pol_P-G      AVELYSIPPSSTKSQSQGPVSSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
AB064312_Pol_P-G      AVELYSIPPSSTKSHSQGPVSSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
AB056513_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
JQ707657_Pol_P-G      AVELYSIPPSSTKSQSQGPVSSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
JQ707666_Pol_P-G      AVELYSIPPSSTKSQSQGPVSSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
JQ707668_Pol_P-G      AVELYSIPPSSTKSQSQGPVSSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
JQ707671_Pol_P-G      AVELYSIPPSSTKSQSQGPVSSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
JQ707673_Pol_P-G      AVELYSIPPSSTKSQSQGPVSSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
JQ707678_Pol_P-G      AVELYSIPPSSTKSQSQGPVSSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
JQ707679_Pol_P-G      AVELYSIPPSSTKSQSQGPVSSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
JQ707680_Pol_P-G      AVELYSIPPSSTKSQSQGPVSSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
HE981174_Pol_P-G      AVELYSIPPSSTKSQSQGPVSSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
HE981175_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
HE981176_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
KF779235_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
KF767450_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
AF160501_Pol_C-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
AB064311_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
AB064313_Pol_C-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
KY004111_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
KX264500_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
KM998716_Pol_P-G      AVELYSIPPSSTKSQSQGPVSSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
KJ194508_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
KF779233_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
GU563556_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
EF634480_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
AB375170_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
AB375169_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
AB375168_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
AB375167_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
AB375165_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
AB375166_Pol_P-G      AVELYSIPPSSTKSQSQGPVFSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
KF767452_Pol_P-G      AV-LYSIPPSSTKSQSQGPVSSCWWLQFRDSEPCSDYCLSHLVNLLQDWG
FJ023674_Pol_P-G      AVELHNLPPSSSXSQSQGPVFSCWWLQFRNSKPCSEYCLSHLINLRKDWG
FR714503_Pol_P-G      AVELHHLPPSSTRSQNQGPVSSCWWLQFRNSKPCSEYCLSHLINLHEDWG
                      ** *: :****: *:.*    ********:: .**:*****::** :***

KR230749_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGGFLVDKNPHNTAESRLVVDFSQFSRGSA
EF464097_Pol_P-G      PCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
EF464098_Pol_P-G      PCTEHGEHHIRTPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
KF779267_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
AB056515_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
JQ707677_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
KF779357_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFRVDKILHNTAESRLVVDFSQFSRGSA
AF405706_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSA
GU565217_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
HE981171_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
HE981172_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
KF414679_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
AB064310_Pol_P-G      PCTEYGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
JQ707660_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTTESRLVVDFSQFSRGSA
AB064312_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
AB056513_Pol_P-G      PCTEHGEYHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
JQ707657_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
JQ707666_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
JQ707668_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
JQ707671_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
JQ707673_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
JQ707678_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
JQ707679_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
JQ707680_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
HE981174_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
HE981175_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
HE981176_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
KF779235_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
KF767450_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
AF160501_Pol_C-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
AB064311_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
AB064313_Pol_C-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
KY004111_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
KX264500_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
KM998716_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
KJ194508_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
KF779233_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
GU563556_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
EF634480_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
AB375170_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
AB375169_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
AB375168_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
AB375167_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
AB375165_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
AB375166_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
KF767452_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGSA
FJ023674_Pol_P-G      PCTEHGEHHIRIPRTPARVTGGIFLVDKNPHNTAESRLVVDFSQFSRGNN
FR714503_Pol_P-G      PCNEHGEHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRGST
                      **.*:**:*** ********** * ***  ***:**************. 

KR230749_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
EF464097_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
EF464098_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
KF779267_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
AB056515_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
JQ707677_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWISLDVSAAFYHIPLHPAAMPHLLVG
KF779357_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
AF405706_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
GU565217_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
HE981171_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
HE981172_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
KF414679_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVAAAFYHIPLHPAAMPHLLVG
AB064310_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
JQ707660_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
AB064312_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
AB056513_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
JQ707657_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
JQ707666_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
JQ707668_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
JQ707671_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
JQ707673_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
JQ707678_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVFAAFYHIPLHPAAMPHLLVG
JQ707679_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVFAAFYHIPLHPAAMPHLLVG
JQ707680_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
HE981174_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
HE981175_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
HE981176_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
KF779235_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
KF767450_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
AF160501_Pol_C-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
AB064311_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
AB064313_Pol_C-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
KY004111_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
KX264500_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
KM998716_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
KJ194508_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
KF779233_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
GU563556_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
EF634480_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
AB375170_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
AB375169_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
AB375168_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
AB375167_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
AB375165_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
AB375166_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
KF767452_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHIPLHPAAMPHLLVG
FJ023674_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
FR714503_Pol_P-G      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
                      *************************:**** *****:*************

KR230749_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGQK
EF464097_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
EF464098_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
KF779267_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGQK
AB056515_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
JQ707677_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
KF779357_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
AF405706_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
GU565217_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
HE981171_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
HE981172_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
KF414679_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGQK
AB064310_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
JQ707660_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
AB064312_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
AB056513_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
JQ707657_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
JQ707666_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
JQ707668_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
JQ707671_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
JQ707673_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
JQ707678_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
JQ707679_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
JQ707680_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
HE981174_Pol_P-G      SSGLSRYVARLSSDSRILDHQHGTLQNLHDSCSRQLYVSLMLLYKTFGRK
HE981175_Pol_P-G      SSGLSRYVARLSSDSRILDHQHGTLQNLHDSCSRQLYVSLMLLYKTFGRK
HE981176_Pol_P-G      SSGLSRYVARLSSDSRILDHQHGTLQNLHDSCSRQLYVSLMLLYKTFGRK
KF779235_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
KF767450_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
AF160501_Pol_C-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
AB064311_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
AB064313_Pol_C-G      SSGLSRYVARLSPDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
KY004111_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
KX264500_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
KM998716_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
KJ194508_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
KF779233_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
GU563556_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
EF634480_Pol_P-G      SSGLSRYVARLSSDSRILHHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
AB375170_Pol_P-G      SSGLSRYVARLSSDFRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
AB375169_Pol_P-G      SSGLSRYVARLSSDFRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
AB375168_Pol_P-G      SSGLSRYVARLSSDFRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
AB375167_Pol_P-G      SSGLSRYVARLSSDFRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
AB375165_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
AB375166_Pol_P-G      SSGLSRYVARLSSDFRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
KF767452_Pol_P-G      SSGLSRYVARLSSDSRILDHQYGTLQNLHVSCSRQLYVSLMLLYKTFGRK
FJ023674_Pol_P-G      SSGLSXYVARLSSNSRILDHQYGTLQNLHDSCSRQLYVSLMLLYKTFGRK
FR714503_Pol_P-G      SSGLSRYVARLSSNSRILDHQYGTMQNLHDSCSRQLYVSLMLLYKTFGRK
                      ***** ******.: *** **:**:**** ******************.*

KR230749_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
EF464097_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYV
EF464098_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYV
KF779267_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB056515_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
JQ707677_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYI
KF779357_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AF405706_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
GU565217_Pol_P-G      LHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYV
HE981171_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYM
HE981172_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYM
KF414679_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYV
AB064310_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
JQ707660_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYI
AB064312_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB056513_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
JQ707657_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYI
JQ707666_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYI
JQ707668_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYI
JQ707671_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYI
JQ707673_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYI
JQ707678_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYI
JQ707679_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYI
JQ707680_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYI
HE981174_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
HE981175_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
HE981176_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
KF779235_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
KF767450_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AF160501_Pol_C-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB064311_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB064313_Pol_C-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
KY004111_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
KX264500_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
KM998716_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
KJ194508_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
KF779233_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
GU563556_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
EF634480_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB375170_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB375169_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB375168_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB375167_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB375165_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB375166_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
KF767452_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLMAQFTSAICSVVRRAFPHCLAFSYV
FJ023674_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
FR714503_Pol_P-G      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
                      ******************:******:***********************:

KR230749_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
EF464097_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
EF464098_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
KF779267_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
AB056515_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
JQ707677_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVI
KF779357_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
AF405706_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPTKTKRWGYSLNFMGYVI
GU565217_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
HE981171_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGYVI
HE981172_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLFSLGIHLNPNKTKRWGYSLNFMGYVI
KF414679_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
AB064310_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
JQ707660_Pol_P-G      DDVVLGAKSVQHLESLFTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVI
AB064312_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPDKTKRWGYSLNFMGYVI
AB056513_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
JQ707657_Pol_P-G      DDVVLGAKSVQHLESLFTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVI
JQ707666_Pol_P-G      DDVVLGAKSVQHLESLFTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVI
JQ707668_Pol_P-G      DDVVLGAKSVQHLESLFTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVI
JQ707671_Pol_P-G      DDVVLGAKSVQHLESLFTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVI
JQ707673_Pol_P-G      DDVVLGAKSVQHLESLFTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVI
JQ707678_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVI
JQ707679_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVI
JQ707680_Pol_P-G      DDVVLGAKSVQHLESLFTAVTNFLLSLGIHLNHNKTKRWGYSLNFMGYVI
HE981174_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
HE981175_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
HE981176_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
KF779235_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
KF767450_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
AF160501_Pol_C-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
AB064311_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
AB064313_Pol_C-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
KY004111_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
KX264500_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
KM998716_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
KJ194508_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
KF779233_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
GU563556_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
EF634480_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
AB375170_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
AB375169_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
AB375168_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
AB375167_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
AB375165_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLXFMGYVI
AB375166_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
KF767452_Pol_P-G      DDVVLGAKSVQHLESLYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
FJ023674_Pol_P-G      DDVVLGAKSVXHLESIYTAVTNFLLSLGIHLNPNKTKRWGYSLNFMGYVI
FR714503_Pol_P-G      DDVVLGAKSVQHLEAIYTAVTNFLLSLGIHLNSNKTKRWGYSLNFMGYVI
                      ********** ***:::*******:*******  ********* ******

KR230749_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
EF464097_Pol_P-G      GSWGTLPQEHIAQKIKQCFGKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
EF464098_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
KF779267_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
AB056515_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
JQ707677_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
KF779357_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
AF405706_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
GU565217_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
HE981171_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
HE981172_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
KF414679_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
AB064310_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
JQ707660_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
AB064312_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
AB056513_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
JQ707657_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
JQ707666_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
JQ707668_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
JQ707671_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
JQ707673_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
JQ707678_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
JQ707679_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
JQ707680_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
HE981174_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
HE981175_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
HE981176_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
KF779235_Pol_P-G      GSWGTLPQEHITKKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
KF767450_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
AF160501_Pol_C-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
AB064311_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
AB064313_Pol_C-G      GSWGTLPQEHITKKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
KY004111_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
KX264500_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
KM998716_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
KJ194508_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
KF779233_Pol_P-G      GSWGTLPQEHITKKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
GU563556_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
EF634480_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
AB375170_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
AB375169_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
AB375168_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
AB375167_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
AB375165_Pol_P-G      GSWGTLPQEHITQKIKXCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
AB375166_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
KF767452_Pol_P-G      GSWGTLPQEHITQKIKQCFRKLPVNRPIDWKVCQRITGLLGFAAPFTQCG
FJ023674_Pol_P-G      GSWGTLPQDHIIQKIRQCFRKLPVNRPVDWKVCQRISGLLGFAAPFTQCG
FR714503_Pol_P-G      GSWGTLPQDHIIQKIKQCFRKLPVNRPIDWKVCQRISGLLGFAAPFTQCG
                      ********:** :**. ** *******:******** *************

KR230749_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYRNLYPVARQRPGLCQVFAD
EF464097_Pol_P-G      YPALMPLYACIQVKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
EF464098_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
KF779267_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYRNLYPVARQRPGLCQVFAD
AB056515_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVARQRPGLCQVFAD
JQ707677_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
KF779357_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AF405706_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
GU565217_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
HE981171_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
HE981172_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
KF414679_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB064310_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
JQ707660_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB064312_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB056513_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
JQ707657_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
JQ707666_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
JQ707668_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
JQ707671_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
JQ707673_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
JQ707678_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
JQ707679_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
JQ707680_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
HE981174_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
HE981175_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
HE981176_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
KF779235_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
KF767450_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AF160501_Pol_C-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB064311_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB064313_Pol_C-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
KY004111_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
KX264500_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
KM998716_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
KJ194508_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
KF779233_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
GU563556_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
EF634480_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB375170_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB375169_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB375168_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB375167_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB375165_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB375166_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
KF767452_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
FJ023674_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYLNLYPVVRQRPGLCQVFAD
FR714503_Pol_P-G      YPALMPLYACIQAKQAFTFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
                      ************.****************** *****.************

KR230749_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
EF464097_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
EF464098_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELIAACFARSRSGAKLIGTDNS
KF779267_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
AB056515_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGATLIGTDNS
JQ707677_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
KF779357_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTADLRAACFARSRSGAKLIGTDNS
AF405706_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
GU565217_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
HE981171_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
HE981172_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
KF414679_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
AB064310_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
JQ707660_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
AB064312_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
AB056513_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
JQ707657_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
JQ707666_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
JQ707668_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
JQ707671_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
JQ707673_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
JQ707678_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
JQ707679_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
JQ707680_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
HE981174_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
HE981175_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
HE981176_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
KF779235_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
KF767450_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
AF160501_Pol_C-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
AB064311_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
AB064313_Pol_C-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
KY004111_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
KX264500_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
KM998716_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
KJ194508_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
KF779233_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
GU563556_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
EF634480_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
AB375170_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
AB375169_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
AB375168_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
AB375167_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
AB375165_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
AB375166_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
KF767452_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
FJ023674_Pol_P-G      ATPTGWGLAMGHQRMRGTFVAPLPIHTAELLAACFARSRSGANIIGTDNS
FR714503_Pol_P-G      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGAKLIGTDNS
                      *********:******************:* ***********.:******

KR230749_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
EF464097_Pol_P-G      VVLSRKYTSFPWLLGCAAISTLSGTSFVYVPSALNPADDPSWGRLGICRP
EF464098_Pol_P-G      VVLSRKYTSFPWQLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
KF779267_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB056515_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
JQ707677_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPTALNPADDPSRGRLGLCRP
KF779357_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AF405706_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
GU565217_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
HE981171_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
HE981172_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
KF414679_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB064310_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
JQ707660_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB064312_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB056513_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
JQ707657_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
JQ707666_Pol_P-G      VVLSRKYTSFPWLLGCAATWILRGTSFVYVPSALNPADDPSRGRLGLCRP
JQ707668_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
JQ707671_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
JQ707673_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
JQ707678_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
JQ707679_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
JQ707680_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
HE981174_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
HE981175_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
HE981176_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
KF779235_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
KF767450_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
AF160501_Pol_C-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB064311_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB064313_Pol_C-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
KY004111_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
KX264500_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
KM998716_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
KJ194508_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
KF779233_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
GU563556_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
EF634480_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB375170_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB375169_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB375168_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB375167_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB375165_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB375166_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
KF767452_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
FJ023674_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
FR714503_Pol_P-G      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGIYRP
                      ************ *****   * ********:*********.****: **

KR230749_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
EF464097_Pol_P-G      LLRLPFLPTTGRTSLYAVSRSVPSHLPDRVHFASPLHVTWKPP
EF464098_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
KF779267_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPSHVTWKPP
AB056515_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
JQ707677_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
KF779357_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
AF405706_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
GU565217_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
HE981171_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
HE981172_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
KF414679_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
AB064310_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
JQ707660_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
AB064312_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
AB056513_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
JQ707657_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
JQ707666_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
JQ707668_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
JQ707671_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
JQ707673_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
JQ707678_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
JQ707679_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
JQ707680_Pol_P-G      LLRLPFLPPTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
HE981174_Pol_P-G      LLRLSFLPTTGRTSIYAVSPSVPSHLPDRVHFASPLHVTWKPP
HE981175_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
HE981176_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
KF779235_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
KF767450_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
AF160501_Pol_C-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
AB064311_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
AB064313_Pol_C-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
KY004111_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
KX264500_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
KM998716_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
KJ194508_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
KF779233_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
GU563556_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
EF634480_Pol_P-G      LLRLSFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
AB375170_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
AB375169_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
AB375168_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
AB375167_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
AB375165_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
AB375166_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
KF767452_Pol_P-G      LLRLPFLPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVTWKPP
FJ023674_Pol_P-G      LLRLPYRPXTGRTSLYADSPSVPFHLPDRVHFASPLHVAWKPP
FR714503_Pol_P-G      LLHLPYRPSTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
                      **.*.: * *****:** * *** *********** **:*.**

© 1998-2019