HBVdb

Dataset for protein HBSP of genotype H

[Download (right click)] [Edit] [Sequences] [Repertoires]

27 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


AB059660_HBSP_P-H      MPLSCQQFRRLVLLDNEAGPLEEELPRLADEDLNHRVAEDLHLQLPNDLQ
AB064315_HBSP_P-H      MPLSYQRFLSVLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQ
FJ356715_HBSP_P-H      MPLSYQRFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQ
HM117850_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQ
AY090457_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQ
FJ356716_HBSP_C-H      MPLSYPHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDQQ
AB375163_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDQQ
AB375162_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQ
AB375161_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQ
AB375160_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQ
AB375159_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQ
AB353764_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDLQ
AB059659_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLHLPNDLQ
AB059661_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDLQ
EU498228_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDLQ
EF157291_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDLQ
AB818694_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDLQ
AB275308_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDLQ
AB266536_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDLQ
AB179747_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDXQ
AB205010_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDLQ
HM066946_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQ
AB375164_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQ
AY090454_HBSP_C-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQ
AY090460_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQ
HQ285946_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQ
KX264501_HBSP_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNDLQ
                       ****  .*  ::********************** ******:*:**** *

AB059660_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPVAVPNLRTEIAPVFPSHHLGLSENTYGS
AB064315_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
FJ356715_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPLAAVPNLRTEIAPVFPSHHLGLSENTYGS
HM117850_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGT
AY090457_HBSP_P-H      PPARVPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
FJ356716_HBSP_C-H      PPARDPAKPAPLLLKEPLCFPLAAVPNLRTEIAPVFPSHHLGLSENTYGS
AB375163_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
AB375162_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
AB375161_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
AB375160_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
AB375159_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
AB353764_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGI
AB059659_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
AB059661_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
EU498228_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
EF157291_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHRLGLSENTYGS
AB818694_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAVVPNLRTEIAPVFPSHHLGLSENTYGS
AB275308_HBSP_P-H      PPARDPAKPAPLLLKDPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
AB266536_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
AB179747_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
AB205010_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
HM066946_HBSP_P-H      PPARDPARPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
AB375164_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
AY090454_HBSP_C-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
AY090460_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPLAAVPNLRTEIAPVFPSHHLGLSENTYGS
HQ285946_HBSP_P-H      PPARDPARPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
KX264501_HBSP_P-H      PPARDPAKPAPLLLKEPLCFPPAAVPNLRTEIAPVFPSHHLGLSENTYGS
                       **** **.*******:***** ..***************.********* 

AB059660_HBSP_P-H      GPQPVSLGSVY
AB064315_HBSP_P-H      GPQPVSLGSVY
FJ356715_HBSP_P-H      GPQPVSLGSVY
HM117850_HBSP_P-H      GPQPVSHGSVY
AY090457_HBSP_P-H      GPQPVSLGSVY
FJ356716_HBSP_C-H      GPQPVSLGSVY
AB375163_HBSP_P-H      GPQPVSLGSVY
AB375162_HBSP_P-H      GPQPVSLGSVY
AB375161_HBSP_P-H      GPQPVSLGSVY
AB375160_HBSP_P-H      GPQPVSLGSVY
AB375159_HBSP_P-H      GPQPVSLGSVY
AB353764_HBSP_P-H      GPQPVSHGSVY
AB059659_HBSP_P-H      GPQPVSLGSVY
AB059661_HBSP_P-H      GPQPVSLGSVY
EU498228_HBSP_P-H      GPQPVSLGSVY
EF157291_HBSP_P-H      GPQPVSLGSVY
AB818694_HBSP_P-H      GPQPVSLGSVY
AB275308_HBSP_P-H      GPQPVSLGSVY
AB266536_HBSP_P-H      GPQPVSLGSVY
AB179747_HBSP_P-H      GPQPVSLGSVY
AB205010_HBSP_P-H      GPQPVSLGSVY
HM066946_HBSP_P-H      GPQPVSLGSVY
AB375164_HBSP_P-H      GPQPVSLGSVY
AY090454_HBSP_C-H      GPQPVSLGSVY
AY090460_HBSP_P-H      GPQPVSLGSVY
HQ285946_HBSP_P-H      GPQPVSLGSVY
KX264501_HBSP_P-H      GPQPVSLGSVY
                       ****** ****

© 1998-2019