HBVdb

Dataset for protein HBc of genotype H

[Download (right click)] [Edit] [Sequences] [Repertoires]

41 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


AB059660_HBc_P-H      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCTP
AB059659_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALHRDALESPEHCSP
AB064315_HBc_P-H      MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCTP
JX896129_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
HM066946_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HQ285946_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ356716_HBc_C-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALHRDALESPDHCTP
FJ356715_HBc_P-H      MDIDPYKEFGASVELLSFLPNDFFPSVRDLLDTASALHREALESPDHCTP
JX896128_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB205010_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB059661_HBc_P-H      MDIDLYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AY090457_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JX896133_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB179747_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB266536_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB275308_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB353764_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB375159_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB375160_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB375161_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JX896125_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JX896124_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM117851_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM117850_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
EU498228_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
EF157291_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AY090460_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AY090454_HBc_C-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB818694_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB375164_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AB375163_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KX264501_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KC836867_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JX915624_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JX896134_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JX896132_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JX896126_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JX896131_HBc_P-H      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JX896127_HBc_P-H      MDIDPYKEFGASVEXLSFLPSDFFPSVRDLXDTASALYRDALESPEHCTP
AB375162_HBc_P-H      MDIDPYKEFGASVELLXFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JX896130_HBc_P-H      MDIDPYKEFGASVELLXFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
                      **** *******.* * ***.**:**:*** ***:**:*:*****:**:*

AB059660_HBc_P-H      HHTAIRQVILCWGELMTLASWVGNNLNDPAARDLVVNYVNTHMGLKIRQL
AB059659_HBc_P-H      HHTALRQAVSCWREVTDFGDWVGNNLQDQAARDLVVNYVNANIGLKIRQL
AB064315_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JX896129_HBc_P-H      NHTAIRQAILCWGELMTLASWVGHNLEDPAARDLVVNYVNTNMGLKIRQL
HM066946_HBc_P-H      SHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HQ285946_HBc_P-H      SHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ356716_HBc_C-H      NHTALRQAISCWGELMNLASWVGNNLEDPAARDLVVNYVNANMGLKIRQF
FJ356715_HBc_P-H      NHTALRQAISCWGELMTLASWVGNNLEDPAARDLVVNYVNANMGLKIRQF
JX896128_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNNNMGLKIRQL
AB205010_HBc_P-H      SHTALRQAILCWGELMTLASWVGNNLEDPGARDLVVNYVNTNMGLKIRQL
AB059661_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AY090457_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JX896133_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB179747_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB266536_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB275308_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB353764_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB375159_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB375160_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB375161_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JX896125_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JX896124_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM117851_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
HM117850_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
EU498228_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
EF157291_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AY090460_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AY090454_HBc_C-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB818694_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB375164_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB375163_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KX264501_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
KC836867_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JX915624_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JX896134_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JX896132_HBc_P-H      NXTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JX896126_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVSTNMGLKIRQL
JX896131_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JX896127_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
AB375162_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JX896130_HBc_P-H      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
                        **:**.: ** *:  :..***:**:* .*********. ::******:

AB059660_HBc_P-H      LWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPPNAPILSTIPETCVIR
AB059659_HBc_P-H      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB064315_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVIR
JX896129_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
HM066946_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVIR
HQ285946_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVIR
FJ356716_HBc_C-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVR
FJ356715_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JX896128_HBc_P-H      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB205010_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB059661_HBc_P-H      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY090457_HBc_P-H      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JX896133_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGGWIRTPPAYRPPNAPILSTLPETTVVR
AB179747_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB266536_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB275308_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB353764_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB375159_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB375160_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB375161_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JX896125_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JX896124_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM117851_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM117850_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU498228_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EF157291_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY090460_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY090454_HBc_C-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB818694_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB375164_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB375163_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KX264501_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC836867_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JX915624_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JX896134_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JX896132_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JX896126_HBc_P-H      LWFHISXLTFGRETVLEYLVXFGVWIRTPPAYRPPNAPILSTLPETTVVR
JX896131_HBc_P-H      LWXHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JX896127_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB375162_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JX896130_HBc_P-H      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
                      ** *** *****: *:**** ** *****  ***********:**  *:*

AB059660_HBc_P-H      QRGRAPRGRTPSPRRRRSKSPRRRRSPSPASQC
AB059659_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPSSKC
AB064315_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
JX896129_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM066946_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
HQ285946_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
FJ356716_HBc_C-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
FJ356715_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
JX896128_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB205010_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB059661_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
AY090457_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
JX896133_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSRASQC
AB179747_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB266536_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB275308_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB353764_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB375159_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB375160_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB375161_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
JX896125_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
JX896124_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM117851_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
HM117850_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
EU498228_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
EF157291_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
AY090460_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
AY090454_HBc_C-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB818694_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB375164_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB375163_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
KX264501_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
KC836867_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
JX915624_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
JX896134_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
JX896132_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
JX896126_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
JX896131_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
JX896127_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
AB375162_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
JX896130_HBc_P-H      QRGRAPRRRTPSPRRRRSQSPRRRRSQSPASQC
                      ******* **********:******* * :*:*

© 1998-2019