HBVdb

Dataset for protein HBe of genotype H

[Download (right click)] [Edit] [Sequences] [Repertoires]

40 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


AB059659_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLPS
FJ356715_HBe_P-H      IQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPN
FJ356716_HBe_C-H      IQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB059660_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPT
JX896129_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB205010_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB064315_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLPS
JX896133_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JX896126_HBe_P-H      MQLFHLCLIIXCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JX915624_HBe_P-H      FLLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB059661_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDLYKEFGASVELLSFLPS
AB179747_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB266536_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB275308_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB353764_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB375159_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB375160_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB375161_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB375162_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLXFLPS
AB375163_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB375164_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AB818694_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AY090454_HBe_C-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AY090457_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
AY090460_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
EF157291_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
EU498228_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM066946_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM117850_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
HM117851_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JX896124_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JX896127_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVEXLSFLPS
JX896128_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JX896130_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLXFLPS
JX896131_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KX264501_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
KC836867_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JX896132_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JX896134_HBe_P-H      MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
JX896125_HBe_P-H      MXLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPS
                      : ******** *****************.**** *******.* * ***.

AB059659_HBe_P-H      DFYPSVRDLLDTASALHRDALESPEHCSPHHTALRQAVSCWREVTDFGDW
FJ356715_HBe_P-H      DFFPSVRDLLDTASALHREALESPDHCTPNHTALRQAISCWGELMTLASW
FJ356716_HBe_C-H      DFFPSVRDLLDTASALHRDALESPDHCTPNHTALRQAISCWGELMNLASW
AB059660_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPHHTAIRQVILCWGELMTLASW
JX896129_HBe_P-H      DFFPSIRDLLDTASALYRDALESPEHCSPNHTAIRQAILCWGELMTLASW
AB205010_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPSHTALRQAILCWGELMTLASW
AB064315_HBe_P-H      DFFPSVRDLLDTATALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JX896133_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JX896126_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JX915624_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB059661_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB179747_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB266536_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB275308_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB353764_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB375159_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB375160_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB375161_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB375162_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB375163_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB375164_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AB818694_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AY090454_HBe_C-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AY090457_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
AY090460_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
EF157291_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
EU498228_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM066946_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPSHTALRQAILCWGELMTLASW
HM117850_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
HM117851_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JX896124_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JX896127_HBe_P-H      DFFPSVRDLXDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JX896128_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JX896130_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JX896131_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KX264501_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
KC836867_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JX896132_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNXTALRQAILCWGELMTLASW
JX896134_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
JX896125_HBe_P-H      DFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLASW
                      **:**:*** ***:**:*:*****:**:*  **:**.: ** *:  :..*

AB059659_HBe_P-H      VGNNLQDQAARDLVVNYVNANIGLKIRQLLWFHISCLTFGRETVIEYLVS
FJ356715_HBe_P-H      VGNNLEDPAARDLVVNYVNANMGLKIRQFLWFHISCLTFGRETVLEYLVS
FJ356716_HBe_C-H      VGNNLEDPAARDLVVNYVNANMGLKIRQFLWFHISCLTFGRETVLEYLVS
AB059660_HBe_P-H      VGNNLNDPAARDLVVNYVNTHMGLKIRQLLWFHISCLTFGREIVLEYLVS
JX896129_HBe_P-H      VGHNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB205010_HBe_P-H      VGNNLEDPGARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB064315_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JX896133_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JX896126_HBe_P-H      VGNNLEDPAARDLVVNYVSTNMGLKIRQLLWFHISXLTFGRETVLEYLVX
JX915624_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB059661_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVS
AB179747_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB266536_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB275308_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB353764_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB375159_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB375160_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB375161_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB375162_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB375163_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB375164_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AB818694_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AY090454_HBe_C-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
AY090457_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVS
AY090460_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
EF157291_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
EU498228_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM066946_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM117850_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
HM117851_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JX896124_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JX896127_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JX896128_HBe_P-H      VGNNLEDPAARDLVVNYVNNNMGLKIRQLLWFHISCLTFGRDTVLEYLVS
JX896130_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JX896131_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWXHISCLTFGRETVLEYLVS
KX264501_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
KC836867_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JX896132_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JX896134_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
JX896125_HBe_P-H      VGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVS
                      **:**:* .*********. ::******:** *** *****: *:**** 

AB059659_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
FJ356715_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
FJ356716_HBe_C-H      FGVWIRTPXAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AB059660_HBe_P-H      FGVWIRTPPAYRPPNAPILSTIPETCVIRQRGRAPRGRTPSPRRRRSKSP
JX896129_HBe_P-H      FGVWIRTPPPYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AB205010_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AB064315_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPECTVIRQRGRAPRRRTPSPRRRRSQSP
JX896133_HBe_P-H      FGGWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
JX896126_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
JX915624_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AB059661_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AB179747_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AB266536_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AB275308_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AB353764_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AB375159_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AB375160_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AB375161_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AB375162_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AB375163_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AB375164_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AB818694_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AY090454_HBe_C-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AY090457_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
AY090460_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
EF157291_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
EU498228_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
HM066946_HBe_P-H      FGVWIRTPPGYRPPNAPILSTLPETTVIRQRGRAPRRRTPSPRRRRSQSP
HM117850_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
HM117851_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
JX896124_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
JX896127_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
JX896128_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
JX896130_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
JX896131_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
KX264501_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
KC836867_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
JX896132_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
JX896134_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
JX896125_HBe_P-H      FGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRAPRRRTPSPRRRRSQSP
                      ** *****  ***********:**  *:******** **********:**

AB059659_HBe_P-H      RRRRSQSPSSKC
FJ356715_HBe_P-H      RRRRSQSPASQC
FJ356716_HBe_C-H      RRRRSQSPASQC
AB059660_HBe_P-H      RRRRSPSPASQC
JX896129_HBe_P-H      RRRRSQSPASQC
AB205010_HBe_P-H      RRRRSQSPASQC
AB064315_HBe_P-H      RRRRSQSPASQC
JX896133_HBe_P-H      RRRRSQSRASQC
JX896126_HBe_P-H      RRRRSQSPASQC
JX915624_HBe_P-H      RRRRSQSPASQC
AB059661_HBe_P-H      RRRRSQSPASQC
AB179747_HBe_P-H      RRRRSQSPASQC
AB266536_HBe_P-H      RRRRSQSPASQC
AB275308_HBe_P-H      RRRRSQSPASQC
AB353764_HBe_P-H      RRRRSQSPASQC
AB375159_HBe_P-H      RRRRSQSPASQC
AB375160_HBe_P-H      RRRRSQSPASQC
AB375161_HBe_P-H      RRRRSQSPASQC
AB375162_HBe_P-H      RRRRSQSPASQC
AB375163_HBe_P-H      RRRRSQSPASQC
AB375164_HBe_P-H      RRRRSQSPASQC
AB818694_HBe_P-H      RRRRSQSPASQC
AY090454_HBe_C-H      RRRRSQSPASQC
AY090457_HBe_P-H      RRRRSQSPASQC
AY090460_HBe_P-H      RRRRSQSPASQC
EF157291_HBe_P-H      RRRRSQSPASQC
EU498228_HBe_P-H      RRRRSQSPASQC
HM066946_HBe_P-H      RRRRSQSPASQC
HM117850_HBe_P-H      RRRRSQSPASQC
HM117851_HBe_P-H      RRRRSQSPASQC
JX896124_HBe_P-H      RRRRSQSPASQC
JX896127_HBe_P-H      RRRRSQSPASQC
JX896128_HBe_P-H      RRRRSQSPASQC
JX896130_HBe_P-H      RRRRSQSPASQC
JX896131_HBe_P-H      RRRRSQSPASQC
KX264501_HBe_P-H      RRRRSQSPASQC
KC836867_HBe_P-H      RRRRSQSPASQC
JX896132_HBe_P-H      RRRRSQSPASQC
JX896134_HBe_P-H      RRRRSQSPASQC
JX896125_HBe_P-H      RRRRSQSPASQC
                      ***** * :*:*

© 1998-2019