HBVdb

Dataset for protein HBx of genotype H

[Download (right click)] [Edit] [Sequences] [Repertoires]

34 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


AB205010_HBx_P-H      MAARMCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPAVDG
AB064315_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPANDG
HM117851_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB275308_HBx_P-H      MADRLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KM998719_HBx_P-H      MAARLCCQLDPARDVLCLRPVDAESCGRPLSWSLGALPPSSPPAVPADDG
KM998723_HBx_P-H      MAARLCCQLDPARDVLCLRPVDAESCGRPLSWSLGALPPSSPPAVPADDG
KM998720_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPTDDG
AY090454_HBx_C-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSPGALPPPSPPSVPADDR
AB059659_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB179747_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB266536_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPVVPADDG
AB353764_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGALPPSSPPVVPADDG
AB375159_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPTVPADDG
AB375160_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPTVPADDG
KY458060_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KY458059_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KX264501_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KM998721_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
KM998718_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPPSPPAVPADDG
HM117850_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSFGALPPSSPPAVPADDG
HM066946_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
FJ356716_HBx_C-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
FJ356715_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
EU498228_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPVVPADDG
EF157291_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AY090460_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AY090457_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSPGALPPPSPPSVPADDG
AB818694_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPVVPADDG
AB375164_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB375163_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPPSPPAVPADDG
AB375161_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPPSPPAVPADDG
AB375162_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB059660_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
AB059661_HBx_P-H      MAARLCCQLDPARDVLCLRPVGAESCGRPLSWSLGALPPSSPPAVPADDG
                      ** *:****************.********* * *****.*** **: * 

AB205010_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
AB064315_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARHMETTVNAPRNLPTTLYKRTLGL
HM117851_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
AB275308_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
KM998719_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
KM998723_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
KM998720_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
AY090454_HBx_C-H      AHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPQSLPTPLHKRTLGL
AB059659_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARHMETTVNAPWNLPTTLYKRTLGL
AB179747_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
AB266536_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
AB353764_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
AB375159_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
AB375160_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
KY458060_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
KY458059_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
KX264501_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
KM998721_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
KM998718_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPQSLPTTLHKRTLGL
HM117850_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
HM066946_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPRSLPTTLHKRTLGL
FJ356716_HBx_C-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
FJ356715_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLYKRTLGL
EU498228_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
EF157291_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
AY090460_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
AY090457_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPQSLPTTLHKRTLGL
AB818694_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPWNLPTTLHKRTLGL
AB375164_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETXVNAPWNLPTTLHKRTLGL
AB375163_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPQSLPTTLHKRTLGL
AB375161_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPXNLPTTLHKRTLGL
AB375162_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAHWNLPTTLHKRTLGL
AB059660_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPRSLPTTLHKRTLGL
AB059661_HBx_P-H      SHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAPRSLPTTLHKRTLGL
                      :**************************.*** ***  .***.*:******

AB205010_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLMIFVLGGCRHKLVCSPAPCNF
AB064315_HBx_P-H      SPRSMTWIEEYIKDCVFKGWEESGEELRLMIYVLGGCRHKLVCSPAPCNF
HM117851_HBx_P-H      SPQSTTWIEEYIKDCVFKDWEESGEESRLMVYVLGGCRHKLVCSPAPCNF
AB275308_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
KM998719_HBx_P-H      SPQSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHRLVCSPAPCNF
KM998723_HBx_P-H      SPQSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
KM998720_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
AY090454_HBx_C-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
AB059659_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
AB179747_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
AB266536_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
AB353764_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
AB375159_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
AB375160_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
KY458060_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
KY458059_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
KX264501_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
KM998721_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
KM998718_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPPPCNF
HM117850_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
HM066946_HBx_P-H      SPRSTTWIEDYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
FJ356716_HBx_C-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPFNF
FJ356715_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPFNF
EU498228_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
EF157291_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
AY090460_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
AY090457_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
AB818694_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCAPAPCNF
AB375164_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
AB375163_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
AB375161_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
AB375162_HBx_P-H      SPRSTTWIEEYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
AB059660_HBx_P-H      SPRSTTWIEDYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
AB059661_HBx_P-H      SPRSTTWIEDYIKDCVFKDWEESGEELRLKVFVLGGCRHKLVCSPAPCNF
                      **.* ****:********.******* ** ::*******.***:*.* **

AB205010_HBx_P-H      STSA
AB064315_HBx_P-H      FTSA
HM117851_HBx_P-H      FTSA
AB275308_HBx_P-H      FTSA
KM998719_HBx_P-H      FTSG
KM998723_HBx_P-H      FTSA
KM998720_HBx_P-H      FTSA
AY090454_HBx_C-H      FTSA
AB059659_HBx_P-H      FTSA
AB179747_HBx_P-H      FTSA
AB266536_HBx_P-H      FTSA
AB353764_HBx_P-H      FTSA
AB375159_HBx_P-H      FTSA
AB375160_HBx_P-H      FTSA
KY458060_HBx_P-H      FTSA
KY458059_HBx_P-H      FTSA
KX264501_HBx_P-H      FTSA
KM998721_HBx_P-H      FTSA
KM998718_HBx_P-H      FTSA
HM117850_HBx_P-H      FTSA
HM066946_HBx_P-H      FTSA
FJ356716_HBx_C-H      FTSA
FJ356715_HBx_P-H      FTSA
EU498228_HBx_P-H      FTSA
EF157291_HBx_P-H      FTSA
AY090460_HBx_P-H      FTSA
AY090457_HBx_P-H      FTSA
AB818694_HBx_P-H      FTSA
AB375164_HBx_P-H      FTSA
AB375163_HBx_P-H      FTSA
AB375161_HBx_P-H      FTSA
AB375162_HBx_P-H      FTSA
AB059660_HBx_P-H      FTSA
AB059661_HBx_P-H      FTSA
                       **.

© 1998-2019