HBVdb

Dataset for protein LHBs of genotype H

[Download (right click)] [Edit] [Sequences] [Repertoires]

30 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


JN604202_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AB059659_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
FJ356715_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AB375164_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AB275308_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AB353764_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
HM117850_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AB375163_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AB375160_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AB059660_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTDKD
AB205010_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AY090457_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AB059661_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AB179747_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AB266536_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AB375159_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AB375161_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AB375162_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AB818694_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AY090454_LHBs_C-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
AY090460_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
EF157291_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
EU498228_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
FJ356716_LHBs_C-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
HM066946_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
HM117851_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
HQ285946_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
JN604203_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
JN604310_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
KX264501_LHBs_P-H      MGAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKD
                       ***********************************************:**

JN604202_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGIMTTSPPVPPPASTNRR
AB059659_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASNNRR
FJ356715_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
AB375164_LHBs_P-H      NWAMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
AB275308_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
AB353764_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
HM117850_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
AB375163_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
AB375160_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
AB059660_LHBs_P-H      NWPMANKVGAGGFGPGFTPPHGGLLGWSPQAQGILTTLPPDPPPASTNRR
AB205010_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
AY090457_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
AB059661_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTLPPDPPPASTNRR
AB179747_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
AB266536_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
AB375159_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
AB375161_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
AB375162_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
AB818694_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
AY090454_LHBs_C-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
AY090460_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
EF157291_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
EU498228_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
FJ356716_LHBs_C-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
HM066946_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTLPPDPPPASTNRR
HM117851_LHBs_P-H      NWPMANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
HQ285946_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTLPPDPPPASTNRR
JN604203_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTLPPDPPPASTNRR
JN604310_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
KX264501_LHBs_P-H      NWPMANKVGVGGFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRR
                       **.******.*.**********************:** ** *****.***

JN604202_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPKVRGLYFPAGGSSSET
AB059659_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
FJ356715_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSIQFHQALLDPRVRGLYFPAGGSSSET
AB375164_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
AB275308_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
AB353764_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
HM117850_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
AB375163_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
AB375160_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
AB059660_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYLPAGGSSSET
AB205010_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYLPAGGSSSET
AY090457_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYLPAGGSSSET
AB059661_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
AB179747_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
AB266536_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
AB375159_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
AB375161_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
AB375162_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
AB818694_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
AY090454_LHBs_C-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
AY090460_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
EF157291_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
EU498228_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
FJ356716_LHBs_C-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
HM066946_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
HM117851_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
HQ285946_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
JN604203_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
JN604310_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
KX264501_LHBs_P-H      SGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRGLYFPAGGSSSET
                       ************************ *********.*****:*********

JN604202_LHBs_P-H      QNPAPTIVSLTSSIFSKTGDPAMNMKNITSGLLGPLLVLQAVFFSLTKIL
AB059659_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLPVLQGVFFSLTKIL
FJ356715_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVFFLLTKVL
AB375164_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
AB275308_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
AB353764_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPVMNMENITSGLLGPLLVLQAVCFLLTKIL
HM117850_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
AB375163_LHBs_P-H      QNPAPTIVSLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
AB375160_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
AB059660_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
AB205010_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
AY090457_LHBs_P-H      QNPVPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
AB059661_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
AB179747_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
AB266536_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPVMNMENITSGLLGPLLVLQAVCFLLTKIL
AB375159_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
AB375161_LHBs_P-H      QNPAPTIVSLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
AB375162_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
AB818694_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPVMNMENITSGLLGPLLVLQAVCFLLTKIL
AY090454_LHBs_C-H      QNPVPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
AY090460_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLRPLLVLQAVCFLLTKIL
EF157291_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
EU498228_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPVMNMENITSGLLGPLLVLQAVCFLLTKIL
FJ356716_LHBs_C-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIR
HM066946_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
HM117851_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
HQ285946_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
JN604203_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIX
JN604310_LHBs_P-H      QNPAPTIVSLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
KX264501_LHBs_P-H      QNPAPTIASLTSSIFSKTGDPAMNMENITSGLLGPLLVLQAVCFLLTKIL
                       ***.***.*************.***:******* ** ***.* * ***: 

JN604202_LHBs_P-H      TIPQSLDSWWTSLNFLGVPPGCPGQNXQSPISNHLPISCPPTCPGYRWMC
AB059659_LHBs_P-H      TIPQSLDSWWTSLNFLEVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
FJ356715_LHBs_P-H      TIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
AB375164_LHBs_P-H      TIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
AB275308_LHBs_P-H      TIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
AB353764_LHBs_P-H      TIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
HM117850_LHBs_P-H      TIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
AB375163_LHBs_P-H      TIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
AB375160_LHBs_P-H      TIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRRMC
AB059660_LHBs_P-H      TIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
AB205010_LHBs_P-H      TIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
AY090457_LHBs_P-H      TIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
AB059661_LHBs_P-H      TIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
AB179747_LHBs_P-H      TIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
AB266536_LHBs_P-H      TIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
AB375159_LHBs_P-H      TIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
AB375161_LHBs_P-H      TIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
AB375162_LHBs_P-H      TIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
AB818694_LHBs_P-H      TIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
AY090454_LHBs_C-H      TIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
AY090460_LHBs_P-H      TIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
EF157291_LHBs_P-H      TIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
EU498228_LHBs_P-H      TIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
FJ356716_LHBs_C-H      TIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
HM066946_LHBs_P-H      TIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
HM117851_LHBs_P-H      TIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
HQ285946_LHBs_P-H      TIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
JN604203_LHBs_P-H      TIPKSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLQTSCPPTCPGYRWMC
JN604310_LHBs_P-H      TIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
KX264501_LHBs_P-H      TIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMC
                       ***:************ ********* ********  **********.**

JN604202_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AB059659_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
FJ356715_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AB375164_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AB275308_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AB353764_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
HM117850_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AB375163_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AB375160_LHBs_P-H      LRRFIIFLFILLLGLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AB059660_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AB205010_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AY090457_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AB059661_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AB179747_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AB266536_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AB375159_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AB375161_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AB375162_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AB818694_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AY090454_LHBs_C-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
AY090460_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
EF157291_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
EU498228_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
FJ356716_LHBs_C-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
HM066946_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
HM117851_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
HQ285946_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
JN604203_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
JN604310_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
KX264501_LHBs_P-H      LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTT
                       ************* ************************************

JN604202_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWALGNYLWEWASARFSWLSLL
AB059659_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
FJ356715_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
AB375164_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
AB275308_LHBs_P-H      LAQGPSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
AB353764_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWDWASARFSWLSLL
HM117850_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWDWASARFSWLSLL
AB375163_LHBs_P-H      XAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
AB375160_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
AB059660_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
AB205010_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
AY090457_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
AB059661_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
AB179747_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
AB266536_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
AB375159_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
AB375161_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
AB375162_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
AB818694_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
AY090454_LHBs_C-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
AY090460_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
EF157291_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
EU498228_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
FJ356716_LHBs_C-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
HM066946_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
HM117851_LHBs_P-H      LAQGTSMFPSCCCIKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
HQ285946_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
JN604203_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
JN604310_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
KX264501_LHBs_P-H      LAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLL
                        ***.******** *****************:*:***:************

JN604202_LHBs_P-H      VQFVQWCVGLSPIVWPLVIWMIWYWGPNLCNILSPFIPLLPIFCYLWASI
AB059659_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
FJ356715_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
AB375164_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
AB275308_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
AB353764_LHBs_P-H      VQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
HM117850_LHBs_P-H      VQFVQWCVGLSPTVWLLVMWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
AB375163_LHBs_P-H      VPFVQWCVGLSPTVWLSAIWMMWYWGPNLCSILSPFIPLLPIFCYLWASI
AB375160_LHBs_P-H      AQFAQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
AB059660_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
AB205010_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
AY090457_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
AB059661_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILRPFIPLLPIFCYLWASI
AB179747_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
AB266536_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
AB375159_LHBs_P-H      VQFAQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
AB375161_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
AB375162_LHBs_P-H      VQFAQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
AB818694_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
AY090454_LHBs_C-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
AY090460_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
EF157291_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
EU498228_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
FJ356716_LHBs_C-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
HM066946_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
HM117851_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
HQ285946_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
JN604203_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLYSILSPFIPLLPIFCYLWASI
JN604310_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
KX264501_LHBs_P-H      VQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
                       . *.******** **  .:**:******* .** ****************

JN604202_LHBs_P-H      -
AB059659_LHBs_P-H      -
FJ356715_LHBs_P-H      -
AB375164_LHBs_P-H      -
AB275308_LHBs_P-H      -
AB353764_LHBs_P-H      -
HM117850_LHBs_P-H      -
AB375163_LHBs_P-H      -
AB375160_LHBs_P-H      -
AB059660_LHBs_P-H      -
AB205010_LHBs_P-H      -
AY090457_LHBs_P-H      -
AB059661_LHBs_P-H      -
AB179747_LHBs_P-H      -
AB266536_LHBs_P-H      -
AB375159_LHBs_P-H      -
AB375161_LHBs_P-H      X
AB375162_LHBs_P-H      -
AB818694_LHBs_P-H      -
AY090454_LHBs_C-H      -
AY090460_LHBs_P-H      -
EF157291_LHBs_P-H      -
EU498228_LHBs_P-H      -
FJ356716_LHBs_C-H      -
HM066946_LHBs_P-H      -
HM117851_LHBs_P-H      -
HQ285946_LHBs_P-H      -
JN604203_LHBs_P-H      -
JN604310_LHBs_P-H      -
KX264501_LHBs_P-H      -
                        

© 1998-2019