HBVdb

Dataset for protein MHBs of genotype H

[Download (right click)] [Edit] [Sequences] [Repertoires]

31 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


JN604202_MHBs_P-H      MQWNSTQFHQALLDPKVRGLYFPAGGSSSETQNPAPTIVSLTSSIFSKTG
JN604203_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AB375163_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIVSLTSSIFSKTG
AB375160_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
HM117851_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
HM117850_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
FJ356716_MHBs_C-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AY090460_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AB353764_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AY090454_MHBs_C-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPVPTIASLTSSIFSKTG
AY090457_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYLPAGGSSSETQNPVPTIASLTSSIFSKTG
AB375161_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIVSLTSSIFSKTG
JN604310_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIVSLTSSIFSKTG
AB375159_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AB375162_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AB266536_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AB818694_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
EU498228_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AB179747_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AB205010_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYLPAGGSSSETQNPAPTIASLTSSIFSKTG
AB275308_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
EF157291_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
FJ356715_MHBs_P-H      MQWNSIQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
HM066946_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
HQ285946_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AB059659_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AB059660_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYLPAGGSSSETQNPAPTIASLTSSIFSKTG
AB375164_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
EU159675_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
KX264501_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
AB059661_MHBs_P-H      MQWNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTG
                       ***** *********.*****:************.***.***********

JN604202_MHBs_P-H      DPAMNMKNITSGLLGPLLVLQAVFFSLTKILTIPQSLDSWWTSLNFLGVP
JN604203_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKIXTIPKSLDSWWTSLNFLGVP
AB375163_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVP
AB375160_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVP
HM117851_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVP
HM117850_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVP
FJ356716_MHBs_C-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKIRTIPQSLDSWWTSLNFLGVP
AY090460_MHBs_P-H      DPAMNMENITSGLLRPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVP
AB353764_MHBs_P-H      DPVMNMENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVP
AY090454_MHBs_C-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVP
AY090457_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVP
AB375161_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVP
JN604310_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVP
AB375159_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVP
AB375162_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVP
AB266536_MHBs_P-H      DPVMNMENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVP
AB818694_MHBs_P-H      DPVMNMENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVP
EU498228_MHBs_P-H      DPVMNMENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVP
AB179747_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVP
AB205010_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVP
AB275308_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVP
EF157291_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVP
FJ356715_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVFFLLTKVLTIPKSLDSWWTSLNFLGVP
HM066946_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVP
HQ285946_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVP
AB059659_MHBs_P-H      DPAMNMENITSGLLGPLPVLQGVFFSLTKILTIPQSLDSWWTSLNFLEVP
AB059660_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVP
AB375164_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVP
EU159675_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVP
KX264501_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVP
AB059661_MHBs_P-H      DPAMNMENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVP
                       **.***:******* ** ***.* * ***: ***:************ **

JN604202_MHBs_P-H      PGCPGQNXQSPISNHLPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN604203_MHBs_P-H      PGCPGQNSQSPISNHLQTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB375163_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB375160_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRRMCLRRFIIFLFILLLGLIFLL
HM117851_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM117850_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ356716_MHBs_C-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY090460_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB353764_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY090454_MHBs_C-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY090457_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB375161_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN604310_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB375159_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB375162_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB266536_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB818694_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU498228_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB179747_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB205010_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB275308_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EF157291_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ356715_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM066946_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ285946_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB059659_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB059660_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB375164_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU159675_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX264501_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB059661_MHBs_P-H      PGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
                       ******* ********  **********.*************** *****

JN604202_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
JN604203_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AB375163_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTXAQGTSMFPSCCCTKPSDG
AB375160_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
HM117851_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCIKPSDG
HM117850_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
FJ356716_MHBs_C-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AY090460_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AB353764_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AY090454_MHBs_C-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AY090457_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AB375161_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
JN604310_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AB375159_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AB375162_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AB266536_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AB818694_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
EU498228_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AB179747_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AB205010_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AB275308_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGPSMFPSCCCTKPSDG
EF157291_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
FJ356715_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
HM066946_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
HQ285946_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AB059659_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AB059660_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AB375164_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
EU159675_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
KX264501_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
AB059661_MHBs_P-H      VLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDG
                       ******************************* ***.******** *****

JN604202_MHBs_P-H      NCTCIPIPSSWALGNYLWEWASARFSWLSLLVQFVQWCVGLSPIVWPLVI
JN604203_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB375163_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVPFVQWCVGLSPTVWLSAI
AB375160_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLAQFAQWCVGLSPTVWLLVI
HM117851_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM117850_MHBs_P-H      NCTCIPIPSSWAFGKYLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVM
FJ356716_MHBs_C-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AY090460_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB353764_MHBs_P-H      NCTCIPIPSSWAFGKYLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVM
AY090454_MHBs_C-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AY090457_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB375161_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
JN604310_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB375159_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVI
AB375162_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVI
AB266536_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB818694_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
EU498228_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB179747_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB205010_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB275308_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
EF157291_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
FJ356715_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HM066946_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
HQ285946_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB059659_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB059660_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB375164_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
EU159675_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
KX264501_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
AB059661_MHBs_P-H      NCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVI
                       ************:*:***:************. *.******** **  .:

JN604202_MHBs_P-H      WMIWYWGPNLCNILSPFIPLLPIFCYLWASI-
JN604203_MHBs_P-H      WMIWYWGPNLYSILSPFIPLLPIFCYLWASI-
AB375163_MHBs_P-H      WMMWYWGPNLCSILSPFIPLLPIFCYLWASI-
AB375160_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
HM117851_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
HM117850_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
FJ356716_MHBs_C-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
AY090460_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
AB353764_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
AY090454_MHBs_C-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
AY090457_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
AB375161_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASIX
JN604310_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
AB375159_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
AB375162_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
AB266536_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
AB818694_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
EU498228_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
AB179747_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
AB205010_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
AB275308_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
EF157291_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
FJ356715_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
HM066946_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
HQ285946_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
AB059659_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
AB059660_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
AB375164_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
EU159675_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
KX264501_MHBs_P-H      WMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
AB059661_MHBs_P-H      WMIWYWGPNLCSILRPFIPLLPIFCYLWASI-
                       **:******* .** **************** 

© 1998-2019