HBVdb

Dataset for protein Pol of genotype H

[Download (right click)] [Edit] [Sequences] [Repertoires]

26 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


AB059659_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLHLPNVSI
AY090454_Pol_C-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNVSI
AB059660_Pol_P-H      MPLSCQQFRRLVLLDNEAGPLEEELPRLADEDLNHRVAEDLHLQLPNVSI
HM117851_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNVSI
AB059661_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLQLPNVSI
AY090457_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNVSI
FJ356715_Pol_P-H      MPLSYQRFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNVSI
HM066946_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNVSI
AB205010_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNVSI
HM117850_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNVSI
FJ356716_Pol_C-H      MPLSYPHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNVSI
AB375164_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNVSI
AB375159_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNVSI
AB375160_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNVSI
AB375161_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNVSI
AB375162_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNVSI
AB375163_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNVSI
AY090460_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNVSI
KX264501_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNHRVAEDLNLQLPNVSI
AB818694_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNVSI
EF157291_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNVSI
AB353764_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNVSI
AB275308_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNVSI
AB179747_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNVSI
AB266536_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNVSI
EU498228_Pol_P-H      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNLRVAEDLNLQLPNVSI
                      ****  .****:********************** ******:*:******

AB059659_Pol_P-H      PWTHKVGNFTGLYSSTAPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
AY090454_Pol_C-H      PWTHKVGNFTGLYSSTVPVFNPDWLTPSFPDIHLHQDLIQKCEQFVRPLT
AB059660_Pol_P-H      PWTHKVGNFTGLYSSTVPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
HM117851_Pol_P-H      PWTHKVGNFTGLYSSTVPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
AB059661_Pol_P-H      PWTHKVGNFTGLYSSTVPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
AY090457_Pol_P-H      PWTHKVGNFTGLYSSTVPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
FJ356715_Pol_P-H      PWTHKVGNFTGLYSSTIPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
HM066946_Pol_P-H      PWTHKVGNFTGLYSSTVPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
AB205010_Pol_P-H      PWTHKVGNFTGLYSSTIPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
HM117850_Pol_P-H      PWTHKVGNFTGLYSSTVPVFNPDWLTPSFPNIHLHQDLIQKCEQFVGPLT
FJ356716_Pol_C-H      PWTHKVGNFTGLYSSTIPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
AB375164_Pol_P-H      PWTHKVGNFTGLYSSTIPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
AB375159_Pol_P-H      PWTHKVGNFTGLYSSTVPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
AB375160_Pol_P-H      PWTHKVGNFTGLYSSTVPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
AB375161_Pol_P-H      PWTHKVGNFTGLYSSTVPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
AB375162_Pol_P-H      PWTHKVGNFTGLYSSTVPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
AB375163_Pol_P-H      PWTHKVGNFTGLYSSTXPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
AY090460_Pol_P-H      PWTHKVGNFTGLYSSTIPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
KX264501_Pol_P-H      PWTHKVGNFTGLYSSTIPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
AB818694_Pol_P-H      PWTHKVGNFTGLYSSTIPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
EF157291_Pol_P-H      PWTHKVGNFTGLYSSTIPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
AB353764_Pol_P-H      PWTHKVGNFTGLYSSTIPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
AB275308_Pol_P-H      PWTHKVGNFTGLYSSTIPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
AB179747_Pol_P-H      PWTHKVGNFTGLYSSTIPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
AB266536_Pol_P-H      PWTHKVGNFTGLYSSTIPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
EU498228_Pol_P-H      PWTHKVGNFTGLYSSTIPVFNPDWLTPSFPDIHLHQDLIQKCEQFVGPLT
                      **************** *************:*************** ***

AB059659_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVDHYFKTRHYLHT
AY090454_Pol_C-H      KNEVRRLKLIMPARFYPKATKYFPLDKGIKPYYPENVVNHYFKTTHYLHT
AB059660_Pol_P-H      TNERRRLKMIMPARFYPKATKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
HM117851_Pol_P-H      KNERRRLKLIMPARFYPKGTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
AB059661_Pol_P-H      KNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
AY090457_Pol_P-H      KNEVRRLKLIMPARFYPKVTKYFPLDKGIKPYYPEHVVNHYFKTRHYLHT
FJ356715_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKARHYLHT
HM066946_Pol_P-H      KNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
AB205010_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
HM117850_Pol_P-H      KNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
FJ356716_Pol_C-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTKHYLHT
AB375164_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
AB375159_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
AB375160_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
AB375161_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
AB375162_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
AB375163_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
AY090460_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
KX264501_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
AB818694_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
EF157291_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
AB353764_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
AB275308_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
AB179747_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
AB266536_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
EU498228_Pol_P-H      TNERRRLKLIMPARFYPKVTKYFPLDKGIKPYYPENVVNHYFKTRHYLHT
                      .** ****:********* ****************:**:****: *****

AB059659_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
AY090454_Pol_C-H      LWKARILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESLCAQ
AB059660_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLHGEKGHGTESFCAQ
HM117851_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
AB059661_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLHGEKGHGTESFCAQ
AY090457_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
FJ356715_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTEPFCAQ
HM066946_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLHGEKGHGTESFCAQ
AB205010_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
HM117850_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
FJ356716_Pol_C-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTEXFCAQ
AB375164_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTEPFCAQ
AB375159_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
AB375160_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
AB375161_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
AB375162_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
AB375163_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSXEQELQHGSTSLNGXKGXGTEXFCAQ
AY090460_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTEPFCAQ
KX264501_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
AB818694_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
EF157291_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
AB353764_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
AB275308_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
AB179747_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
AB266536_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
EU498228_Pol_P-H      LWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNGEKGHGTESFCAQ
                      **** ******************* ***********:* ** *** :***

AB059659_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
AY090454_Pol_C-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLWSRVHTP
AB059660_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHRQGQLANGKQGRSGRLRSRVHTP
HM117851_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGSLRSRVHTP
AB059661_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
AY090457_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLWSRVHTP
FJ356715_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
HM066946_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
AB205010_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
HM117850_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
FJ356716_Pol_C-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
AB375164_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLGNGKQGRSGRLRSRVHTP
AB375159_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
AB375160_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
AB375161_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
AB375162_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
AB375163_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
AY090460_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
KX264501_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
AB818694_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
EF157291_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
AB353764_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
AB275308_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
AB179747_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
AB266536_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
EU498228_Pol_P-H      SSGILSRPPVGSTIQSKFQQSRLGLQHKQGQLANGKQGRSGRLRSRVHTP
                      ***************************.****.******** *.******

AB059659_Pol_P-H      TRWASGVEPSGTGHSDNLATRSTSCFQQSEVRKKANPSLSTSKGHTSTGH
AY090454_Pol_C-H      TRWPSGVEPSGTGHSDNLATRSTSRFHQSEVRKETNPSLSTSKGHTSTGH
AB059660_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKRHTSTGH
HM117851_Pol_P-H      TRWPSGVEPSSTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
AB059661_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
AY090457_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSRFHQSEVRKETNPSLSTSKGHTSTGH
FJ356715_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGX
HM066946_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
AB205010_Pol_P-H      TRWPSGVEPSGTGHSNNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
HM117850_Pol_P-H      TWWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
FJ356716_Pol_C-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
AB375164_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
AB375159_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
AB375160_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
AB375161_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
AB375162_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
AB375163_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
AY090460_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
KX264501_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
AB818694_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
EF157291_Pol_P-H      TRWPSGVEPSGTGHSNNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
AB353764_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
AB275308_Pol_P-H      TRWPSGVEPSGTGHSNNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
AB179747_Pol_P-H      TRWPSGVEPSGTGHSNNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
AB266536_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
EU498228_Pol_P-H      TRWPSGVEPSGTGHSDNLATRSTSCFHQSEVRKKANPSLSTSKGHTSTGH
                      *.*.******.****:******** *:******::******** ***** 

AB059659_Pol_P-H      AVELNTVPPSTVRSESKGSVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AY090454_Pol_C-H      AVELNTVPPSTVGSESQGSVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AB059660_Pol_P-H      AVELNTVPPSTVGSESKGSVSSCWWLQFRNTEPCSDYCLSHIINLLEDWG
HM117851_Pol_P-H      AVELNTVPPSTVGSESKGSVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AB059661_Pol_P-H      AVELNTVPPSTVGSESKGSVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AY090457_Pol_P-H      AVELNTVPPSTVGSESKGSVSSCWWLQFRNTEPCSDYCLSHIINLLEDWG
FJ356715_Pol_P-H      AVELNTVPPSTVGSESKGSVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
HM066946_Pol_P-H      AVELNTVPPSTVGSESEGSVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AB205010_Pol_P-H      AVELNTVPPSTVGSESKGAVSSCWWLQFRNTEPCSDYCLSHIINLLEDWG
HM117850_Pol_P-H      AVELNTVPPSTVGSESKGSVFSCWWLQFRNTKPCSDYCLSHIINLLEDWG
FJ356716_Pol_C-H      AVELNTVPPSTVGSESKGSVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AB375164_Pol_P-H      AVELNTVPPSTVGSESKGSVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AB375159_Pol_P-H      AVELNTVPPSTVGSESKGSVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AB375160_Pol_P-H      AVELNTVPPSTVGSESKGSVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AB375161_Pol_P-H      AVELNTVPPSTVGSESKGSVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AB375162_Pol_P-H      AVELNTVPPSTVGSESKGSVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AB375163_Pol_P-H      AVELNTVPPSTVGPESKGSVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AY090460_Pol_P-H      AVELNTVPPSTVGSESKGSVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
KX264501_Pol_P-H      AVELNTVPPSTVGSESKGSVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AB818694_Pol_P-H      AVELNTVPPSTVGSESKGAVFSCWWLQFRNTEPCADYCLSHIINLLEDWG
EF157291_Pol_P-H      AVELNTVPPSTVGSESKGAVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AB353764_Pol_P-H      AVELNTVPPSTVGSESKGAVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AB275308_Pol_P-H      AVELNTVPPSTVGSESKGAVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AB179747_Pol_P-H      AVELNTVPPSTVGSESKGAVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
AB266536_Pol_P-H      AVELNTVPPSTVGSESKGAVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
EU498228_Pol_P-H      AVELNTVPPSTVGSESKGAVFSCWWLQFRNTEPCSDYCLSHIINLLEDWG
                      ************ .**:*:* **********:**:***************

AB059659_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
AY090454_Pol_C-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
AB059660_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
HM117851_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
AB059661_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
AY090457_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
FJ356715_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKSPHNTKESRLVVDFSQFSRGTT
HM066946_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTKESRLVVDFSQFSRGTT
AB205010_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTKESRLVVDFSQFSRGTT
HM117850_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
FJ356716_Pol_C-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
AB375164_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
AB375159_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
AB375160_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
AB375161_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
AB375162_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
AB375163_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
AY090460_Pol_P-H      PCYEHGEHHIRTPKTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
KX264501_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTTESRLVVDFSQFSRGTT
AB818694_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTKESRLVVDFSQFSRGTT
EF157291_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTKESRLVVDFSQFSRGTT
AB353764_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTKESRLVVDFSQFSRGTT
AB275308_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTKESRLVVDFSQFSRGTT
AB179747_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTKESRLVVDFSQFSRGTT
AB266536_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTKESRLVVDFSQFSRGTT
EU498228_Pol_P-H      PCYEHGEHHIRTPRTPSRVTGGVFLVDKNPHNTKESRLVVDFSQFSRGTT
                      *************.**************.****.****************

AB059659_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
AY090454_Pol_C-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
AB059660_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
HM117851_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
AB059661_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
AY090457_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
FJ356715_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
HM066946_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
AB205010_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
HM117850_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
FJ356716_Pol_C-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
AB375164_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
AB375159_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
AB375160_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSSDVSAAFYHLPLHPAARPHLLVG
AB375161_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
AB375162_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
AB375163_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
AY090460_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
KX264501_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
AB818694_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
EF157291_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
AB353764_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
AB275308_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
AB179747_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
AB266536_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
EU498228_Pol_P-H      RVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVG
                      *************************** *************** ******

AB059659_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
AY090454_Pol_C-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
AB059660_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
HM117851_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYKTFGRK
AB059661_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
AY090457_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGSLQNLHHSCSRNLYVSLLLLYQTFGRK
FJ356715_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
HM066946_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQDLHHSCSRNLYVSLLLLYQTFGRK
AB205010_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
HM117850_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
FJ356716_Pol_C-H      SSGLSRYVARVSSTSRINNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
AB375164_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
AB375159_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
AB375160_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
AB375161_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
AB375162_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
AB375163_Pol_P-H      SSGLSRYVARVSSTSRINNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
AY090460_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
KX264501_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
AB818694_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
EF157291_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
AB353764_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
AB275308_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRTLYVSLLLLYQTFGRK
AB179747_Pol_P-H      SSGLSRYVARVSSTSRIXNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
AB266536_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
EU498228_Pol_P-H      SSGLSRYVARVSSTSRIYNHQHGTLQNLHHSCSRNLYVSLLLLYQTFGRK
                      ***************** *****:**:*******.*********:*****

AB059659_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AY090454_Pol_C-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB059660_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
HM117851_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB059661_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AY090457_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
FJ356715_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
HM066946_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB205010_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
HM117850_Pol_P-H      LHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFSYV
FJ356716_Pol_C-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB375164_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB375159_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB375160_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB375161_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB375162_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB375163_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AY090460_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
KX264501_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB818694_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
EF157291_Pol_P-H      LHLYSHPIVLGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB353764_Pol_P-H      LHLYSHPIILGFRKIPMGLGLSPFLMAQFTSAICSVVRRAFPHCLAFGYV
AB275308_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB179747_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
AB266536_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
EU498228_Pol_P-H      LHLYSHPIILGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYM
                      ********:*********:******:*********************.*:

AB059659_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKRWGYSLHFMGYII
AY090454_Pol_C-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
AB059660_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
HM117851_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYVI
AB059661_Pol_P-H      DDLVLGAKSVQHLEALYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
AY090457_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
FJ356715_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKXWGYTLHFMGYRI
HM066946_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
AB205010_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYTLHFMGYRI
HM117850_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
FJ356716_Pol_C-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKRWGYSLHFMGYII
AB375164_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
AB375159_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
AB375160_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
AB375161_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
AB375162_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
AB375163_Pol_P-H      DDVVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
AY090460_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
KX264501_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
AB818694_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
EF157291_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
AB353764_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
AB275308_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
AB179747_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
AB266536_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
EU498228_Pol_P-H      DDLVLGAKSVQHLESLYTAVTNFLLSVGIHLNTAKTKWWGYSLHFMGYII
                      **:***********:********************** ***:****** *

AB059659_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AY090454_Pol_C-H      GSWGTLPQEHIVQKIKNCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AB059660_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
HM117851_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AB059661_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AY090457_Pol_P-H      GSWGTLPQEHIVQKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
FJ356715_Pol_P-H      GSWGTLPQEHIVHKIKDCFXKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
HM066946_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AB205010_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
HM117850_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
FJ356716_Pol_C-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AB375164_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AB375159_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AB375160_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AB375161_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AB375162_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AB375163_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AY090460_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
KX264501_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AB818694_Pol_P-H      GSWGTLPQEHIVHKIKECFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
EF157291_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AB353764_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AB275308_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AB179747_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
AB266536_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
EU498228_Pol_P-H      GSWGTLPQEHIVHKIKDCFRKLPVNRPIDWKVCQRIVGLLGFAAPFTQCG
                      ************:***:** ******************************

AB059659_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLRQQYMTLYPVARQRPGLCQVFAD
AY090454_Pol_C-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB059660_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYLNLYPVARQRPGLCQVFAD
HM117851_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB059661_Pol_P-H      YPALMPLYACITANQAFVFSPTYKAFLCKQYLNLYPVARQRPGLCQVFAD
AY090457_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
FJ356715_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
HM066946_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYLNLYPVARQRPGLCQVFAD
AB205010_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
HM117850_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYLNLYPVARQRPGLCQVFAD
FJ356716_Pol_C-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB375164_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYLNLYPVARQRPGLCQVFAD
AB375159_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB375160_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB375161_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB375162_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB375163_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AY090460_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
KX264501_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB818694_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
EF157291_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB353764_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB275308_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB179747_Pol_P-H      YPALMPLYACIXAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
AB266536_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
EU498228_Pol_P-H      YPALMPLYACITAKQAFVFSPTYKAFLCKQYMNLYPVARQRPGLCQVFAD
                      *********** *:************* :**:.*****************

AB059659_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
AY090454_Pol_C-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
AB059660_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
HM117851_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
AB059661_Pol_P-H      ATPTGWGLAIGHQRLRGTFEAPLPIHTAELLAACFARSRSGADVIGTDNS
AY090457_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
FJ356715_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
HM066946_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
AB205010_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
HM117850_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
FJ356716_Pol_C-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
AB375164_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
AB375159_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADVIGTDNS
AB375160_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADVIGTDNS
AB375161_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADXIGTDNS
AB375162_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADVIGTDNS
AB375163_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
AY090460_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
KX264501_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
AB818694_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
EF157291_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
AB353764_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
AB275308_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
AB179747_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
AB266536_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
EU498228_Pol_P-H      ATPTGWGLAIGHQRMRGTFVAPLPIHTAELLAACFARSRSGADIIGTDNS
                      **************:**** *********************** ******

AB059659_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
AY090454_Pol_C-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB059660_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
HM117851_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB059661_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AY090457_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
FJ356715_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
HM066946_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLYRP
AB205010_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
HM117850_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
FJ356716_Pol_C-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB375164_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB375159_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB375160_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB375161_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB375162_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB375163_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AY090460_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
KX264501_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB818694_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
EF157291_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB353764_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB275308_Pol_P-H      VVLSRKYTSFPWLIGCAANWILRGTSFVYVPSAQNPADDPSRGRLGLCRP
AB179747_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
AB266536_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
EU498228_Pol_P-H      VVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGLCRP
                      *************:******************* ************* **

AB059659_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVTWRPP
AY090454_Pol_C-H      LLRLPFRPTTGRTSLYADSPPVPFHQPARVHFGSPLHVAWRPP
AB059660_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
HM117851_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
AB059661_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
AY090457_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
FJ356715_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
HM066946_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
AB205010_Pol_P-H      LLRLPFRPSTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
HM117850_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
FJ356716_Pol_C-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
AB375164_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
AB375159_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
AB375160_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
AB375161_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
AB375162_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
AB375163_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
AY090460_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
KX264501_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
AB818694_Pol_P-H      LLRLSFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
EF157291_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
AB353764_Pol_P-H      LLRLSFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
AB275308_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
AB179747_Pol_P-H      LLRLPFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
AB266536_Pol_P-H      LLRLSFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
EU498228_Pol_P-H      LLRLSFRPTTGRTSLYADSPPVPSHLPARVHFASPLHVAWRPP
                      ****.***:************** * ******.*****:****

© 1998-2019