HBVdb

Dataset for protein SHBs of genotype H

[Download (right click)] [Edit] [Sequences] [Repertoires]

89 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


JN604202_SHBs_P-H      MKNITSGLLGPLLVLQAVFFSLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236129_SHBs_P-H      MENITSGLLGPLPVLQAVCSLLIKILTIPQSLDSWWTSLSFLGVPPGCPG
FJ356715_SHBs_P-H      MENITSGLLGPLLVLQAVFFLLTKVLTIPKSLDSWWTSLNFLGVPPGCPG
AB059659_SHBs_P-H      MENITSGLLGPLPVLQGVFFSLTKILTIPQSLDSWWTSLNFLEVPPGCPG
DQ236127_SHBs_P-H      MENITSGLLGPLLVLQGVFFSLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236126_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDLWWTSLNFLGVPPGCPG
MF150691_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGVPPECPG
DQ236109_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MF150692_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGVPPECPG
KM998723_SHBs_P-H      MESITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KM606937_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGEPPGCPG
KC836829_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
GQ486268_SHBs_P-H      MENITSGLLGPLLVLQAVSFLLTKILTIPRSLDSWWTSLSFLGVPPGCPG
DQ236132_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGVPPGCPG
KM606705_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGEPPGCPG
DQ236113_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236112_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236111_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369543_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369540_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236106_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369536_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSRNFLGVPPGCPG
AB353764_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
AB353766_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
HM117850_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB275308_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
AB375163_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236118_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB064315_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLNFLGVPPGCPG
MF150695_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KX372218_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KM998717_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
GQ486375_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLSFLGVPPXCPG
AB059660_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB059661_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB179747_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
AB205010_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
AB266536_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
AB353765_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
AB375159_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB375161_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB375162_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB375164_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB818694_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
AF369531_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369535_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369537_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369538_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369539_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369541_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369542_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AY090454_SHBs_C-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AY090457_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AY090460_SHBs_P-H      MENITSGLLRPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236101_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236102_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236114_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236120_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236121_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236122_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236123_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236124_SHBs_P-H      MENITSGLLGPLLVLQAVCSLLTKIRTIPKSLDSWWTSLNFLGVPPGCPG
DQ236125_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236130_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236131_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
EF157291_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
EU159675_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
EU498228_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
FJ356716_SHBs_C-H      MENITSGLLGPLLVLQAVCFLLTKIRTIPQSLDSWWTSLNFLGVPPGCPG
GQ486592_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
HM066946_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
HM117851_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
HQ285946_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
JN604203_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKIXTIPKSLDSWWTSLNFLGVPPGCPG
JN604310_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KM998718_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KM998719_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KM998720_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KM998721_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KM998722_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KP997512_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
KX264501_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KY458059_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KY458060_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MF150696_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
U91819_SHBs_P-H        MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
U91827_SHBs_P-H        MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB375160_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236115_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
                       *:.****** ** ***.*   * *: ***.*** **** .**  ** ***

JN604202_SHBs_P-H      QNXQSPISNHLPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236129_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ356715_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB059659_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236127_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
DQ236126_SHBs_P-H      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MF150691_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIISLFILLLCLIFLLVLLDY
DQ236109_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF150692_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM998723_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606937_SHBs_P-H      QNSQSPISNHLPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC836829_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486268_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236132_SHBs_P-H      QNSQSPISNHLPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606705_SHBs_P-H      QNSQSPISNHLPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236113_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236112_SHBs_P-H      QSSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236111_SHBs_P-H      QSSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369543_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369540_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236106_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369536_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB353764_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB353766_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM117850_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB275308_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375163_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236118_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB064315_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF150695_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372218_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM998717_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486375_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB059660_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB059661_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB179747_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205010_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB266536_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB353765_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375159_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375161_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375162_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375164_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB818694_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369531_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369535_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369537_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369538_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369539_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369541_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369542_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY090454_SHBs_C-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY090457_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY090460_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236101_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236102_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236114_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236120_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236121_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236122_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236123_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236124_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236125_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236130_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236131_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF157291_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU159675_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU498228_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ356716_SHBs_C-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486592_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM066946_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM117851_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ285946_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604203_SHBs_P-H      QNSQSPISNHLQTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604310_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM998718_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM998719_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM998720_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM998721_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM998722_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KP997512_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX264501_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY458059_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY458060_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF150696_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91819_SHBs_P-H        QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91827_SHBs_P-H        QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375160_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRRMCLRRFIIFLFILLLGLIFLLVLLDY
DQ236115_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRRMCLRRFIIFLFILLLGLIFLLVLLDY
                       *. *** ****  **********.******** ** *** ***** *:**

JN604202_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236129_SHBs_P-H      QGMLPVCPLLPGSSTTSTGPCKTCTTLAQGTSMVPSCCCTKPSDGNCTCI
FJ356715_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB059659_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236127_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236126_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MF150691_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236109_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSWCCTKPSDGNCTCI
MF150692_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM998723_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM606937_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KC836829_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
GQ486268_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236132_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM606705_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236113_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236112_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGNSMFPSCCCTKPSDGNCTCI
DQ236111_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369543_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369540_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236106_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369536_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB353764_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB353766_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
HM117850_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB275308_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGPSMFPSCCCTKPSDGNCTCI
AB375163_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTXAQGTSMFPSCCCTKPSDGNCTCI
DQ236118_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTXAQGTSMFPSCCCTKPSDGNCTCI
AB064315_SHBs_P-H      QGMLPVCPLLPGSSTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MF150695_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KX372218_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM998717_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCX
GQ486375_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB059660_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB059661_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB179747_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB205010_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB266536_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB353765_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB375159_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB375161_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB375162_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB375164_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB818694_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369531_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369535_SHBs_P-H      QGMLPVCPLLPGSSTTSTGPCKTCTTLAQGTSMYPSCCCTKPSDGNCTCI
AF369537_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369538_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369539_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369541_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369542_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AY090454_SHBs_C-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AY090457_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AY090460_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236101_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236102_SHBs_P-H      QGMLPVCPLLPGSSTTSTGPCKTCTTLAQGTSMYPSCCCTKPSDGNCTCI
DQ236114_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMLPSCCCTKPSDGNCTCI
DQ236120_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236121_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236122_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236123_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236124_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236125_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236130_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTSLAQGTSMFPSCCCTKPSDGNCTCI
DQ236131_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
EF157291_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
EU159675_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
EU498228_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
FJ356716_SHBs_C-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
GQ486592_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
HM066946_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
HM117851_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCIKPSDGNCTCI
HQ285946_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
JN604203_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
JN604310_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM998718_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM998719_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM998720_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM998721_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM998722_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCTKPSEGNCTCI
KP997512_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KX264501_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KY458059_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KY458060_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MF150696_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
U91819_SHBs_P-H        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
U91827_SHBs_P-H        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB375160_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236115_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
                       *************:*******.***: *** ** ** ** ***:***** 

JN604202_SHBs_P-H      PIPSSWALGNYLWEWASARFSWLSLLVQFVQWCVGLSPIVWPLVIWMIWY
DQ236129_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
FJ356715_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB059659_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236127_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236126_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTAWLSVIWMIWY
MF150691_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236109_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLAIWMMWY
MF150692_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM998723_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM606937_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KC836829_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
GQ486268_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236132_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM606705_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236113_SHBs_P-H      PIPSSWAFRKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236112_SHBs_P-H      PIPSSWAFVKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236111_SHBs_P-H      PIPSSWAFVKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF369543_SHBs_P-H      PIPSSWAFGKFLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
AF369540_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236106_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF369536_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB353764_SHBs_P-H      PIPSSWAFGKYLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
AB353766_SHBs_P-H      PIPSSWAFGKYLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
HM117850_SHBs_P-H      PIPSSWAFGKYLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
AB275308_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB375163_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVPFVQWCVGLSPTVWLSAIWMMWY
DQ236118_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVPFVQWCVGLSPTVWLSAIWMMWY
AB064315_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MF150695_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KX372218_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM998717_SHBs_P-H      PIPSSWAFGKYLWGWASARFFWLSLLVPFVQWCVGLSPTVWLLVIWMIWY
GQ486375_SHBs_P-H      PIPSSWAFAKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB059660_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB059661_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB179747_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB205010_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB266536_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB353765_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB375159_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
AB375161_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB375162_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
AB375164_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB818694_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF369531_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF369535_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF369537_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF369538_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF369539_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF369541_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
AF369542_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
AY090454_SHBs_C-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY090457_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY090460_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236101_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236102_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236114_SHBs_P-H      PIPSSWAFGKYLWEWASVRFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236120_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
DQ236121_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236122_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236123_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236124_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236125_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236130_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236131_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF157291_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EU159675_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EU498228_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
FJ356716_SHBs_C-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
GQ486592_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
HM066946_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
HM117851_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
HQ285946_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN604203_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN604310_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM998718_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM998719_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM998720_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVHFVQWCVGLSPTVWLLVIWMIWY
KM998721_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM998722_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP997512_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KX264501_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY458059_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY458060_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MF150696_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
U91819_SHBs_P-H        PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
U91827_SHBs_P-H        PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB375160_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLAQFAQWCVGLSPTVWLLVIWMIWY
DQ236115_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLAQFAQWCVGLSPTVWLLVIWMIWY
                       *******: ::** ***.** *****. *.******** .*  .:**:**

JN604202_SHBs_P-H      WGPNLCNILSPFIPLLPIFCYLWASI-
DQ236129_SHBs_P-H      WGPNLCNIWSPFIPLLPIFCYLWASI-
FJ356715_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AB059659_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
DQ236127_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
DQ236126_SHBs_P-H      WGPNLHTILSPFIPLLPIFCYLWASI-
MF150691_SHBs_P-H      WGPNLCSTLRPFIPLLPIFCYLWASI-
DQ236109_SHBs_P-H      WGPSLCSILSPFIPLLPIFCCLWAYI-
MF150692_SHBs_P-H      WGLNLWSTLRPFIPLLPIFCYLWASI-
KM998723_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
KM606937_SHBs_P-H      WGPNLCSILRPFIPLLPICCYLWASI-
KC836829_SHBs_P-H      WGPNLCSILSPFIPLLPIFFCLWVYI-
GQ486268_SHBs_P-H      WGPNLYSTLSPFIPLLPIFCYLWASI-
DQ236132_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
KM606705_SHBs_P-H      WGPNLCSILRPFIPLLPIFCYLWASI-
DQ236113_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
DQ236112_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
DQ236111_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AF369543_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AF369540_SHBs_P-H      WGPNLCSILSPFIPLLPICCYLWASI-
DQ236106_SHBs_P-H      WGPNLCSILSPFIPLLPICCYLWASI-
AF369536_SHBs_P-H      WGPNLCSILSPFILLLPIFCYLWASI-
AB353764_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AB353766_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
HM117850_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AB275308_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AB375163_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
DQ236118_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AB064315_SHBs_P-H      WGPNLCNILSPFIPLLPIFCYLWASI-
MF150695_SHBs_P-H      WGPNLSNTLSPFIPLLPIFCYLWASI-
KX372218_SHBs_P-H      WGPNLWRILSPFIPLLPIFCYLWASI-
KM998717_SHBs_P-H      WGPNLCSILRPFIPLLPIFCYLWASI-
GQ486375_SHBs_P-H      WGPNLCXILSPFIPLLPIFCYLWASI-
AB059660_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AB059661_SHBs_P-H      WGPNLCSILRPFIPLLPIFCYLWASI-
AB179747_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AB205010_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AB266536_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AB353765_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AB375159_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AB375161_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASIX
AB375162_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AB375164_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AB818694_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AF369531_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AF369535_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AF369537_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AF369538_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AF369539_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AF369541_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AF369542_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AY090454_SHBs_C-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AY090457_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
AY090460_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
DQ236101_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
DQ236102_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
DQ236114_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
DQ236120_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
DQ236121_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
DQ236122_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
DQ236123_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
DQ236124_SHBs_P-H      WGPNLFSILSPFIPLLPIFCYLWASI-
DQ236125_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
DQ236130_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
DQ236131_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
EF157291_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
EU159675_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
EU498228_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
FJ356716_SHBs_C-H      WGPNLCSILSPFIPLLPIFCYLWASI-
GQ486592_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
HM066946_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
HM117851_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
HQ285946_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
JN604203_SHBs_P-H      WGPNLYSILSPFIPLLPIFCYLWASI-
JN604310_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
KM998718_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
KM998719_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
KM998720_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
KM998721_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
KM998722_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
KP997512_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
KX264501_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
KY458059_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
KY458060_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
MF150696_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
U91819_SHBs_P-H        WGPNLCSILSPFIPLLPIFCYLWASI-
U91827_SHBs_P-H        WGPNLCSILSPFIPLLPIFCYLWASI-
AB375160_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
DQ236115_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI-
                       ** .*     *** ****   **. * 

© 1998-2019