HBVdb

Dataset for protein HBSP of genotype RF

[Download (right click)] [Edit] [Sequences] [Repertoires]

875 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KC774323_HBSP_P-RF-CB      MPLSYHHFGKLLWTH--D--E--AGPIGALLPRLADEKTNCRVPEDLNLG
KF053166_HBSP_P-RF-BC      MPLSYPHFLRLLLLE--H--G--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803827_HBSP_P-RF-BC      MPLSYPHFLRLLLLE--H--G--AGPLEEELPRLADEGLNRRVAEDLNLG
EU787444_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLLHEGLLRRDEKDLNLG
AB493840_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
KJ717814_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRFAEDLNLG
KJ803802_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRFAEDLNLG
FJ386643_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ386586_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
EF494378_HBSP_P-RF-CA      MPLSYQYFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLSLG
AB493842_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
KU963930_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963931_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963932_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963933_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963934_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963935_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963936_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963938_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963939_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963940_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963941_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963942_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963943_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963944_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KJ410520_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ475335_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU881995_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AF233236_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195940_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195941_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195956_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195957_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB033557_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AB195939_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195955_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY167095_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY206374_HBSP_P-RF-CB      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AB014375_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ032337_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN400086_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774193_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774198_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774201_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774291_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774307_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ377560_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KJ803822_HBSP_P-RF-CB      MPLSYQCFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX504540_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939621_HBSP_P-RF-CB      MPLSYQRFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EF494376_HBSP_P-RF-CA      MPLSYQHFWKLLLLDDGT--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AP011102_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
HQ700519_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377592_HBSP_P-RF-CB      MPLSYQHFRKLLLLE--E--G--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562223_HBSP_P-RF-CD      MPLSYHHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB105172_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
AB493837_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
AB493838_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDDLNRRVAEDLNLG
AB493847_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDDLNRRVAEDLNLG
AP011103_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
GQ358155_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
GQ358156_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
AB049609_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939668_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB642096_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774212_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU589337_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--T--G--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ377556_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--G--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562277_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--D--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377604_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--K--D--AGTLEEELPRLADEGLNRRVAEDLNLG
MG826146_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNHRVAEDLNLG
MG826148_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
MG826144_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MG826141_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
M38454_HBSP_P-RF-CB        MPLSYQHFRKLLLLDXXX--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964313_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP148352_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
KJ717794_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRFAEDVNLG
KJ803788_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRFAEDVNLG
KJ598675_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--N--D--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173350_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF917451_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ732168_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNLRVAEDLNLG
HQ684849_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700523_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ684848_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HM750133_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377564_HBSP_P-RF-CB      MPLSYQHFRKLQLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377565_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377581_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377590_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377596_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377607_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377614_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377627_HBSP_P-RF-CD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FR714496_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ562302_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386674_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU916228_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU589339_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU522070_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB367400_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB367393_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLKLG
AB195950_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195951_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB367419_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB367800_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386649_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562226_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ562294_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ787446_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ787480_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF828933_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF828934_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF828936_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF828938_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF828935_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF053179_HBSP_P-RF-BC      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803772_HBSP_P-RF-BC      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700527_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700528_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX096713_HBSP_P-RF-CA      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873535_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679939_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562317_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774183_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774186_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774230_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AP011104_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AP011105_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939620_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377548_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC416040_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AF411409_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357624_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826147_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
Y18856_HBSP_P-RF-CB        MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNPRVAEDLNLG
MG893561_HBSP_P-RF-CB      MPLSYQHFGKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925384_HBSP_P-RF-DB      MPLSYQHFRRLLLLD--N--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KR013816_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM213033_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803785_HBSP_P-RF-CB      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRFAEDLNLG
KJ717832_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KJ173330_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
KJ173329_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
JQ801476_HBSP_P-RF-CG      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
JF436922_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700526_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700520_HBSP_P-RF-CB      MPLSYQHFRRLLLLD--N--E--AGPLEEELPRLADEGLNRRVAADLNLG
GU357843_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377602_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADDGLNRRVAEDLNLG
EU939623_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939581_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939547_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AP011108_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
GQ377539_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB198084_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU916232_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939630_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700530_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700531_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700532_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774234_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774305_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964005_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964006_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964007_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964008_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964009_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964010_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964303_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964304_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964305_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964306_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964307_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964308_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964309_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964310_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964311_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964312_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964314_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964315_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964316_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964317_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY363262_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY363263_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562247_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU916239_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU916240_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU916241_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377522_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774222_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774246_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774258_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KR013843_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963856_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963857_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963858_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963859_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963860_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963861_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963862_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963863_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963864_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963865_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963866_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963867_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963868_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963869_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963870_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU919166_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU919167_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386593_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871999_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU717211_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY123424_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY247030_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939602_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386646_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377549_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377626_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ377633_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ924618_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF436923_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVVEDLNLG
KF873537_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--X--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873533_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873532_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873531_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEXLNRRVAEDLNLG
KF873530_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--N--E--AGPLEEELPRLADEDLNRRVAEDLNLG
JX661487_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925389_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679952_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--N--E--AGPLXEELPRLABEGLNRRVAXDLNLG
KU679940_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679945_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
Y18857_HBSP_P-RF-CB        MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925382_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925381_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--N--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925370_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964351_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803804_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803798_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803753_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ410506_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF053160_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774324_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ027310_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--X--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX661498_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774344_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ040146_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ040148_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ040174_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ707714_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK321265_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG893559_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG893555_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG893554_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826149_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826142_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC458432_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC279267_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC279266_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC279265_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC279264_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC279263_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY881840_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470893_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964003_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964001_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963999_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963998_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963995_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963994_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963993_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963991_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963990_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963883_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU695742_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELHRLADEGLNRRVAEDLNLG
KM875422_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173358_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173349_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173326_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173325_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173322_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KJ173320_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KJ173300_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173299_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173280_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173279_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774349_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774341_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774332_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774328_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774322_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774317_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774294_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774263_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774188_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX661494_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX661486_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX661485_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX429896_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX026887_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ040142_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
JQ040130_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700547_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GU385774_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377634_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377613_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377611_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEELNLG
GQ377594_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377544_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377534_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377520_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377516_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715414_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715413_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715412_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715411_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715387_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715385_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715384_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715347_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715346_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715345_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562336_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562314_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562305_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562287_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562271_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562267_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562229_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562227_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--V--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386635_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ386633_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386585_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386581_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386578_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ032343_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939606_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
EU939589_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939551_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU872015_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU872014_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871997_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871996_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871995_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871994_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871993_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871992_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871991_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871990_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871989_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871988_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871987_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871986_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871985_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871984_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871983_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871981_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY123041_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY040627_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AF461361_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AF330110_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB670303_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB205152_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB300369_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--VGPLEEELPRLADEGLNRRVAEELNLG
KF873534_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873538_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873540_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873542_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873543_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826151_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPPLAEEGFNRRVAEDLNLG
JF440021_HBSP_P-RF-AG      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
MG826145_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEKELPRLADEDLNRRVAEDLNLG
MH746813_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEKELPRLADEDLNRRVAEDLNLG
MH746811_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MH746812_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MK052970_HBSP_P-RF-BD      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADKGLNRRVTKDLNLG
KF053188_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--D--AGPLEEELPRLADEGLNRRVADDLNLG
KJ803782_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--D--AGPLEEELPRLADEGLNRRVADDLNLG
GQ377595_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ717800_HBSP_P-RF-CB      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRLAEDLNLG
KJ803791_HBSP_P-RF-CB      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRLAEDLNLG
EU660227_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
MG826150_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774414_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--K--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ801477_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK052967_HBSP_P-RF-BD      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939627_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377630_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP148337_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK052968_HBSP_P-RF-BD      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRPADEGLNRRVAEDLNLG
GQ377635_HBSP_P-RF-BC      MPLSYQRFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC315400_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ717815_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ717816_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803803_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ410497_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB241109_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774178_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774364_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MH094410_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU882006_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AF297619_HBSP_P-RF-DA      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
AB194949_HBSP_P-RF-AE      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
GQ331048_HBSP_P-RF-AE      MPLSYQHFRKLLLLD--EGTE--VGPLEEELPRLADEDLNRRVAEDLNLG
JF439776_HBSP_P-RF-AG      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADEDLNRRVAEDLHLQ
JF440019_HBSP_P-RF-AG      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADADLNRRVAEDLNLG
JF440022_HBSP_P-RF-AG      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
AB222708_HBSP_P-RF-AD      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
AB453985_HBSP_P-RF-AC      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
AB933282_HBSP_P-RF-AG      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
AB933283_HBSP_P-RF-AG      MPLSYQHFRKLLLLD--DXTX--AGPLEEELPRLADADLNRRVAZDLNLG
MF925386_HBSP_P-RF-AC      MPLSYQHFRKLLLLD--DGTE--SGPLEEELPRLADADLNRRVAEDLNLG
GQ161788_HBSP_P-RF-AE      MPLSYQHFRSVLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ161767_HBSP_P-RF-AE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ161837_HBSP_P-RF-AE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ161838_HBSP_P-RF-AE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HF571060_HBSP_P-RF-AE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KP148450_HBSP_P-RF-GC      MPLSYQQFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939631_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HM146131_HBSP_P-RF-AD      MPLSYQHFRKLLLLD--DEAE--VGPLEGELPRLADEDLNRRVAEDLNLG
AY161147_HBSP_P-RF-DA      MPLSYQHFRKLLLLD--DETE--AGPLEEELPRLADEDLNRRVAEDLNLG
KJ586810_HBSP_P-RF-AF      MPLSYQHFRKLLLLD--DETE--AGPLEEELPRLADEDLNRRVAEDLNLQ
MF488705_HBSP_P-RF-AD      MPLSYQHFRKLLLLD--DETE--VGPLEEELPRLADEDLNRRVAEDLNLG
AY161140_HBSP_P-RF-AD      MPLSYQHFRRLLLLD--VETE--AGSLEEELPRLADEDLNRRFAEDLNLG
AY161141_HBSP_P-RF-AD      MPLSYQHFRRLLLLD--VETE--AGSLEEELPRLADEDLNRRFAEDLNLG
AY233277_HBSP_P-RF-AC      MPLSYQHFRKLLLLD--DETE--AGPLEEELPRLADEDLNRRVAEDLNLG
AY236161_HBSP_P-RF-DA      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY161145_HBSP_P-RF-AD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY161146_HBSP_P-RF-AD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF214656_HBSP_P-RF-AC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
EF103283_HBSP_P-RF-AD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EF103282_HBSP_P-RF-AD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925404_HBSP_P-RF-AC      MPLSYQHFRKLLLLD--DETE--AGPLEEELPRLADEDLNRRVAEDLNLG
EU833889_HBSP_P-RF-GA      MHLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
EU185780_HBSP_P-RF-AD      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC012653_HBSP_P-RF-AD      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU833890_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
AB933279_HBSP_P-RF-AG      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
AB933280_HBSP_P-RF-AG      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
AB933281_HBSP_P-RF-AG      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707474_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707426_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707421_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707430_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707432_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707441_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707445_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707448_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707450_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707456_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707457_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707458_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707460_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707461_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707462_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707463_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707464_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707465_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707466_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707467_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707468_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLGEELPRLADEDLNRRVAEDLHLQ
JQ707469_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707470_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707471_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707472_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707473_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707475_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707424_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707459_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
EF464099_HBSP_P-RF-AG      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
HE981180_HBSP_P-RF-GF      MPLSYPHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
FJ361772_HBSP_P-RF-GC      MPLSYPHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ272886_HBSP_P-RF-GF      MPLSYPHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLQ
JQ272887_HBSP_P-RF-GF      MPLSYPHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLQ
KF219922_HBSP_P-RF-GH      MPLSYQHFRRLLLLD--X--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
KP274926_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
KY470998_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471001_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY470996_HBSP_P-RF-GC      MPLSYQQFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KP148441_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP148449_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KP148586_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882610_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882613_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882614_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX765835_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023662_HBSP_P-RF-GC      MPLSYQQFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
EU835240_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF214680_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MH368022_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--V--E--AGPLEEELPRLADEDLNRRVAEDLNLG
EU833891_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023659_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023664_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023666_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023667_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023668_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023670_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023673_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882611_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--A--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882612_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882617_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882618_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FR714490_HBSP_P-RF-GB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC172106_HBSP_P-RF-GB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY470997_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY470999_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471000_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471002_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471003_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471004_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471005_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471006_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471007_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ023665_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB330368_HBSP_P-RF-DA      MPLSYQHFRKLLLLD--D--GTEAGPLEEELPRLADADLNRRVAEDLNLG
GU177079_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--GTEAGPLEEELPRLADADLNRRVAEDLNLG
X65259_HBSP_P-RF-DA        MPLSYQHFRRLLLLH--D--E--AGPLEEELPRLPDQGLNRRVAEDLNLG
KX660685_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADKGLNRRVAKDLDLG
EF103284_HBSP_P-RF-AD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN688715_HBSP_P-RF-DE      MPLSYQSFRRLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
MK052957_HBSP_P-RF-DE      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK052969_HBSP_P-RF-DE      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX660684_HBSP_P-RF-DC      MPLSYQHFRKLLLVD--D--E--AGPLEDELPRLADEGLNRRVAKDLNLG
KM577666_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN688689_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--N--K--AGPLEEELPRLADQGLNRRVAEDLNLG
X68292_HBSP_P-RF-DA        MPLSYQHFRKLLLLD--D--G--TGPLEEELPRLADEGLNRRVAEDLNLG
KM577667_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--D--AGPLEEELPRLADEGLNRRVAEDLNLG
KX827302_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--D--AGPLEEELPRLADEGLNRRVAEDLNLG
KF679991_HBSP_P-RF-DE      MPLSYQHFRSVLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774431_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904414_HBSP_P-RF-DE      MPLSYQHFRRLLFLD--E--D--AGPLEEELPRLADEGLNRRVAEDLNLG
EU594406_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ904397_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904408_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ904409_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ464167_HBSP_P-RF-DE      MPLSYPHFRRLLLLD--D--E--AGPLEEELPRLPDEDLNRRVPEDLNLG
DQ464166_HBSP_P-RF-DE      MPLSYPHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
JN688717_HBSP_P-RF-DE      MPLSYQLFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
DQ315777_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY373430_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
MK052976_HBSP_P-RF-BD      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF488702_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLKEELPHLADEGLNRRVAEDLNLG
KT366492_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
KT003704_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KR013806_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM524359_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
KM524337_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM524336_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803771_HBSP_P-RF-DB      MPLSYQRFRRLLLLD--A--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ647351_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADQGLNRRVAEDLNLG
KJ647349_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GU563560_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY233293_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB270538_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB188243_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AB188245_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB583679_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AJ627217_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY233295_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ111987_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ464164_HBSP_P-RF-DE      MPLSYPHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVEEDLNLG
DQ464165_HBSP_P-RF-DE      MPLSYPHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
EF103285_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
EU594435_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ183486_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MH685719_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925397_HBSP_P-RF-DC      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925396_HBSP_P-RF-DC      MPLSYQYFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470844_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357636_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357629_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357626_HBSP_P-RF-DE      MPLSYQHFRRLLLLE--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357625_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT366503_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470898_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--N--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774442_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN664929_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
JN642160_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
JN642127_HBSP_P-RF-DE      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257210_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--D--AGPLEEELPRLADEGLNRRVAEDLNLG
AB674434_HBSP_P-RF-DE      MPLSYQHFRSLLLLD--D--D--AGPLEEELPRLADEGLNRRVAEDLNLG
JN664946_HBSP_P-RF-DA      MPLSYQHFRKLLLLD--V--EGEAGPLEEELPRLADEGLNRRVAEDLNLG
JN257216_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MH464835_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--D--EXXAGPLEEELPRLADEGLNRRVAEDLNLG
MH464846_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--EXXAGPLEEELPRLADEGLNRRVAEDLNLG
MH464850_HBSP_P-RF-DA      MPLSYQHFRKLLLLD--D--EXXAGPLEEELPRLADEDLNRRVAEDLNLG
MH464851_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--EXXAGPLEEELPRLADEGLNRRVAEDLNLG
MH464852_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--EXXAGPLEEELPRLADEGLNRRVAEDLNLG
X80925_HBSP_P-RF-DE        MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KX357630_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--D--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736922_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--X--AGPLEEELPRLADEGLNRRVAXDLNLG
KM577664_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM577663_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM386676_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM359442_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX898696_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX898695_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX898693_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN664943_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925402_HBSP_P-RF-BD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925401_HBSP_P-RF-DB      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925392_HBSP_P-RF-DB      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925388_HBSP_P-RF-DC      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925371_HBSP_P-RF-DC      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925360_HBSP_P-RF-DB      MPLSYQHFRRLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX827299_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357635_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357634_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357633_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357632_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357631_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357627_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357623_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736923_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736921_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT366504_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KR905422_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP995112_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP168418_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP168417_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP168416_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM606751_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLANEGLNRHVAENLNLG
KM606750_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM577665_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM524357_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF471643_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF170740_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ687532_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
JN642152_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN642141_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN642139_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--SGPLEEELPRLADEGLNRRVAEDLNLG
JN642137_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
JN257207_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257206_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257204_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257189_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257191_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470845_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--K--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470848_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--K--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470851_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--K--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470852_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--K--AGPLEEELPRLADEGLNRRVAEDLNLG
J02202_HBSP_P-RF-DE        MPLSYQRFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ349207_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KX660689_HBSP_P-RF-DC      MPLSYQDFRKLLLLD--D--E--AGPLEDELPRLADEDLNRRVAEDLNLG
KU964367_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KP288875_HBSP_P-RF-DE      MPLSYQYFRRLLLLD--E--E--AGPLEEELPHLADEGLNRRVAEDLNLG
HM750147_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750148_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KC774482_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEDLNRRVAEDLNLG
FJ562263_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--N--AGPLEDELPRLADEGLNRRVAEDLNLG
KT991424_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--N--AGPLEDELPRLADEGLNRRVAEDLNLG
KT991427_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--N--AGPLEDELPRLADEGLNRRVAEDLNLG
KX357641_HBSP_P-RF-DE      MPLSYQHFRRLLFLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU711666_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257154_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ161806_HBSP_P-RF-EA      MPLSYQHFRXLLLLD--X--E--AGPLEEELPRLADEDLNRRVAEDLNLQ
FN594771_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FN594767_HBSP_P-RF-DE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLQ
FJ904430_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--E--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MF618346_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964366_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KU964370_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KU964372_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KU964374_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KU964379_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KU964380_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KJ647356_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KF192833_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192835_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192836_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192837_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192838_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192839_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192841_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF618347_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774458_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF491455_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774450_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF491448_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700503_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700536_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLAXEDLNRRVAEDLNLG
HQ700494_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--N--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ161754_HBSP_P-RF-DE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904442_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLKEELPRLADKGLNLRVAEDLNLG
FJ904437_HBSP_P-RF-DE      MPLSYQQFRRLVLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ478889_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRHVAEDLNLG
AY817512_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY817513_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ478898_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU787435_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774428_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774430_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774468_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774492_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774494_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB033559_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AB048702_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AB048703_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ692536_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLR
HQ700492_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEELNLG
HQ700493_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--N--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700497_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700500_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700501_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700524_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700525_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700534_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--SGPLEEELPRLADEDLNRRVAEDLNLG
HQ700535_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700537_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700538_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700539_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700540_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700541_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700579_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700581_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700582_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700583_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700584_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700585_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KF779353_HBSP_P-RF-DA      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MH481858_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MH481860_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEGLPRLADEDLNRRVAEDLNLG
MH481861_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MH481862_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MH481859_HBSP_P-RF-DE      TPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
JX429898_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774434_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774463_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774472_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774489_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774497_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774499_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP276254_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP276255_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY057948_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
AY817511_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
DQ478890_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
FJ349241_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750142_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750143_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750145_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750146_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750149_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750150_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KC774456_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KC774485_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KP276253_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KP276256_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KX354997_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KX660686_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
DQ991753_HBSP_P-RF-DE      MPLSYHHFRRLVLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904407_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB674432_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB674433_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904444_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF754616_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257164_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257174_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY629632_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
EU594436_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904405_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGVNRRVAEELNLG
AB674436_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AM494716_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904394_HBSP_P-RF-DE      MPLSYQHFRXLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904403_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904404_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904406_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904425_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904428_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904436_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904440_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904398_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGXNRRVAEDLNLG
FJ904416_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGXNRRVAEDLNLG
FJ904417_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGXNRRVAEDLNLG
KY470854_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX660680_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEEXPRXADEGLNRRVAEDLNLG
AB270535_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB674504_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY800249_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY817509_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLDEELSRLADEGLNRRVAEDLNLG
AY817510_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY817515_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY862864_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY862865_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY862866_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLR
DQ478886_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
DQ478887_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ478892_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ478897_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU787434_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562278_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF491449_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF491451_HBSP_P-RF-DC      MPLSYPHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774420_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774422_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774423_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774424_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774425_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774426_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774432_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774433_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774435_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774439_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774443_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774447_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774448_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774452_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774453_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774454_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774455_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774457_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774461_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774466_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774470_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774471_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774474_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774475_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774476_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774478_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774479_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774480_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774481_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774483_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774484_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774486_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774488_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774490_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774493_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774495_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774498_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470884_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470886_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470856_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470855_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470850_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470849_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470847_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470846_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470843_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX660682_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX660677_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX660675_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX660674_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736917_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736915_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736914_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU519423_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU519422_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT991423_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT991421_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT991420_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT991419_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT991417_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP168421_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP168420_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470897_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470892_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470891_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470890_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470887_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470888_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904400_HBSP_P-RF-DE      MPLSYQSFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLHLG
KC774449_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FN594769_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM606741_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB674412_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--N--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY670781_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904447_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904396_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904441_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF754613_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN040803_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--N--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357628_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLHLG
                             ***  *  :             *.:              .   :: * 

KC774323_HBSP_P-RF-CB      DLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KF053166_HBSP_P-RF-BC      NLNDHRPPAPDHAKPARFLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
KJ803827_HBSP_P-RF-BC      NLNDHRPPAPDHAKPARFLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
EU787444_HBSP_P-RF-CB      NLGEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB493840_HBSP_P-RF-CB      NPNEPQLPARDLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
KJ717814_HBSP_P-RF-CB      NLNEHQLPAPDHAKPARLLLKEPLCFPHVAVQNLWTETAPVFPSHHLGLS
KJ803802_HBSP_P-RF-CB      NLNEHQLPAPDHAKPARLLLKEPLCFPHVAVQNLWTETAPVFPSHHLGLS
FJ386643_HBSP_P-RF-CB      NLNEPQLPARDLARPAQFLLKEPLYFPLVAVQNLRTETALVFPSHHPGLS
FJ386586_HBSP_P-RF-CB      NLNEHQLPARAHARPAQYLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
EF494378_HBSP_P-RF-CA      NLNEHQQQARDHARPARLLLKASLCFPLVAVQNLRMETAPVFPSHHPGLS
AB493842_HBSP_P-RF-CB      NLNEHQLPVRGLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
KU963930_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963931_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963932_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963933_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963934_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963935_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963936_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963938_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963939_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963940_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963941_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963942_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963943_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963944_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KJ410520_HBSP_P-RF-CB      NLNEHQPPARGHARPARFLLKEPLCFPRVAVQNLRTQTALVFPSHHPGLS
GQ475335_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU881995_HBSP_P-RF-CB      NLNGRQPPARGHARPARFLLKEPLCFPLVAVQNLRTEAALVFPSHHPGLS
AF233236_HBSP_P-RF-CB      NLNEPQPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB195940_HBSP_P-RF-CB      NLNEHQPPARGHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB195941_HBSP_P-RF-CB      NLNEHQPPARGHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB195956_HBSP_P-RF-CB      NLNEHQPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB195957_HBSP_P-RF-CB      NLNEHQPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB033557_HBSP_P-RF-CB      NLNEPQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB195939_HBSP_P-RF-CB      NLNEHQPPARGHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB195955_HBSP_P-RF-CB      NLNEHQPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AY167095_HBSP_P-RF-CB      NLNEHQPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AY206374_HBSP_P-RF-CB      NLNEHQPPARGHARHARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB014375_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ032337_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JN400086_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774193_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774198_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774201_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774291_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774307_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377560_HBSP_P-RF-CB      NLNEHQLPARGHARHARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ803822_HBSP_P-RF-CB      NLNEHQLPARDPARPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
JX504540_HBSP_P-RF-CB      NPNEHQPPARDRARPARFLLKETLCFPLVAVQNLRTETALVFPSHHPGLS
EU939621_HBSP_P-RF-CB      NLSEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EF494376_HBSP_P-RF-CA      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AP011102_HBSP_P-RF-CB      NPNEHQLPPQDLARPAQFLLKEPLCFPPVAVQNLRTETALVFPSHHPGLS
HQ700519_HBSP_P-RF-CB      NPNERQLPARDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
GQ377592_HBSP_P-RF-CB      NLNEHQLPPPDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
FJ562223_HBSP_P-RF-CD      NPNEHQLPARDHARPARILPTEPLCFPLVAVQNLRTETALVFPSHHLGLS
AB105172_HBSP_P-RF-CB      NPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
AB493837_HBSP_P-RF-CB      NPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
AB493838_HBSP_P-RF-CB      NPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
AB493847_HBSP_P-RF-CB      NPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
AP011103_HBSP_P-RF-CB      NPNEHQLPARDLARPAQFLHKEPLCFPHVAVQNLRTETALVFPSHHPGLS
GQ358155_HBSP_P-RF-CB      NPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
GQ358156_HBSP_P-RF-CB      NPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
AB049609_HBSP_P-RF-CB      NLNEQQLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU939668_HBSP_P-RF-CB      NLNEQQLPARDLARHARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB642096_HBSP_P-RF-CB      NLNEQQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774212_HBSP_P-RF-CB      NLNEQQLPARDHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHPGLS
EU589337_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
GQ377556_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562277_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377604_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MG826146_HBSP_P-RF-CB      NLNELQLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLS
MG826148_HBSP_P-RF-CB      NLNELQLPARDHARPARHLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLS
MG826144_HBSP_P-RF-CB      NLNELQLPARDHARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
MG826141_HBSP_P-RF-CB      NLNELQLPARDHARPARLLLREPLCFPLVAVQNLRTEIALVFPSHHPGLS
M38454_HBSP_P-RF-CB        NLNEHQLPARDHARPARFLLKEPLCFPLLAVQNLRTETALVFPSHHLGLS
KU964313_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLREPLCFPLVAVQNLRTETALVFPSHHPGLS
KP148352_HBSP_P-RF-CB      NLNEHQLPVRDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
KJ717794_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPVCFPLVAVQNLRTEIALVFPSHHLGLS
KJ803788_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPVCFPLVAVQNLRTEIALVFPSHHLGLS
KJ598675_HBSP_P-RF-CB      NLNELQLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLS
KJ173350_HBSP_P-RF-CB      NLNEHQQPARDHAKPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KF917451_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPHVAVQNLRTEIAPVFPSHHLGLS
JQ732168_HBSP_P-RF-CB      NLNEHPLPARDHARHARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
HQ684849_HBSP_P-RF-BC      NLNDHQLPAPDHARPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
HQ700523_HBSP_P-RF-CB      NPNEHQLQARDPARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHLGLS
HQ684848_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHRPGLS
HM750133_HBSP_P-RF-CB      NLNEHQPPARDPARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
GQ377564_HBSP_P-RF-CB      NLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377565_HBSP_P-RF-CB      NLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377581_HBSP_P-RF-CB      NLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377590_HBSP_P-RF-CB      NLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377596_HBSP_P-RF-CB      NLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377607_HBSP_P-RF-CB      NLNEHQLPPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377614_HBSP_P-RF-CB      NLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377627_HBSP_P-RF-CD      NLNEHQLPPRDHAKPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
FR714496_HBSP_P-RF-CB      NPNEHQLPARDHARPARFLLKATLCFPLVAVQNLRTEIAPVFPSHHLGLS
FJ562302_HBSP_P-RF-CB      NLNEHQLPVRDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ386674_HBSP_P-RF-BC      NPNDHQQPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
EU916228_HBSP_P-RF-CB      NLNGHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLS
EU589339_HBSP_P-RF-CB      TLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
EU522070_HBSP_P-RF-CB      NLNEHQLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
AB367400_HBSP_P-RF-CB      NLNEQQLPARDHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHPGLS
AB367393_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLAAVQNLRTEIALVFPSHHPGLS
AB195950_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB195951_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB367419_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB367800_HBSP_P-RF-CB      NPNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ386649_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562226_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562294_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ787446_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ787480_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JF828933_HBSP_P-RF-CB      NLNEHQLPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JF828934_HBSP_P-RF-CB      NLNEHQLPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JF828936_HBSP_P-RF-CB      NLNEHQLPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JF828938_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JF828935_HBSP_P-RF-CB      NLNEHQLPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KF053179_HBSP_P-RF-BC      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KJ803772_HBSP_P-RF-BC      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
HQ700527_HBSP_P-RF-CB      NPNEHQLPARDHARPARLLLKEPLCFPPVAVQNLRTETALVFPSHHPGLS
HQ700528_HBSP_P-RF-CB      NPNEHQLPAQDHARPARLLLKEPLCFPPVAVQNLRTETALVFPSHHPGLS
KX096713_HBSP_P-RF-CA      NPNDHQLPARDHAKPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHPGLS
KF873535_HBSP_P-RF-CB      NPNDQRPXARDLAEPARXLLKEPLCXPHVAVQNLRTAIAPVFPSHHLGLS
KU679939_HBSP_P-RF-CB      NPNDQRPPARDLAEPARSLLKEPLCFPPVAVQNLRTAIAPVFPSHHLGLS
FJ562317_HBSP_P-RF-CB      NLNEHQQPARDHARPARLLLKTPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774183_HBSP_P-RF-CB      NLNEHQQPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774186_HBSP_P-RF-CB      NLNEHQQPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774230_HBSP_P-RF-CB      NLNEHQQPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AP011104_HBSP_P-RF-CB      NLNEHQLPVRDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
AP011105_HBSP_P-RF-CB      NLNEHQLPVRDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
EU939620_HBSP_P-RF-CB      NLNEHQLPVRDHARPARFLLKEPLCFPLVAVQNLRTETAPVFPSHYPGLS
GQ377548_HBSP_P-RF-CB      NLNEHQLPVQDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
LC416040_HBSP_P-RF-CB      NLNEHQLPVLDHARPARFLLKEPLCFPHVVVQNLRTETALVFPSHHPGLS
AF411409_HBSP_P-RF-CB      NLNELQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KX357624_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
MG826147_HBSP_P-RF-CB      NLNELQLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLS
Y18856_HBSP_P-RF-CB        NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MG893561_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MF925384_HBSP_P-RF-DB      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHLGLS
KR013816_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
KM213033_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
KJ803785_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKGPLCFPLVAVQNLRTEIALVFPSHRLGLS
KJ717832_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KJ173330_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173329_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JQ801476_HBSP_P-RF-CG      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
JF436922_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKAPLCFPLVAVQNLRTETALVFPSHHPGPS
HQ700526_HBSP_P-RF-CB      NLNEPQLPARDHARPARFLLKEPLCFPHVAVQNLRTEIALVFPSHHPGLS
HQ700520_HBSP_P-RF-CB      NPNEHQLPARDHARPARFLLKAPLCFPLVVVQNLRTETALVFPSHHPGLS
GU357843_HBSP_P-RF-CB      NLNEHQLPAREHAGPARFLLKEPLCFPLVAVQNLRPETALVFPSHHPGLS
GQ377602_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU939623_HBSP_P-RF-CB      TLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU939581_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLRFPLVAVQNLRTETALVFPSHHPGLS
EU939547_HBSP_P-RF-CB      NLNEHRLPARDHARPARLLPTEPLCFPLVAVQNLRTETALVFPSHHPGLS
AP011108_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPPVAVQNLRTETALVFPSHHPGLS
GQ377539_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB198084_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU916232_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU939630_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
HQ700530_HBSP_P-RF-CB      NPNEHQLQARDHARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
HQ700531_HBSP_P-RF-CB      NPNEHQLQARDPARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
HQ700532_HBSP_P-RF-CB      NPNEHQLQARDPARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
KC774234_HBSP_P-RF-CB      NLNEHQLPARDHARPAQLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774305_HBSP_P-RF-CB      NLNEHPLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964005_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964006_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964007_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964008_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964009_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964010_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964303_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964304_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964305_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964306_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964307_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964308_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964309_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964310_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964311_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964312_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964314_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964315_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964316_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964317_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KY363262_HBSP_P-RF-CB      NLNEHQLPARDHARPAQLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KY363263_HBSP_P-RF-CB      NLNEHQLPAWDHARPAQLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562247_HBSP_P-RF-CB      DLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU916239_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
EU916240_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
EU916241_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
GQ377522_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTEIALVFPSHHPGLS
KC774222_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTEIALVFPSHHPGLS
KC774246_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KC774258_HBSP_P-RF-CB      NLNEHQLPARDHAKPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KR013843_HBSP_P-RF-CB      NLNEHQLPARDHAGPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963856_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963857_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963858_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963859_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963860_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963861_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963862_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVKNLRTETALVFPSHHPGLS
KU963863_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963864_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963865_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963866_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963867_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963868_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963869_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963870_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
EU919166_HBSP_P-RF-CB      DLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
EU919167_HBSP_P-RF-CB      DLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
FJ386593_HBSP_P-RF-CB      DLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871999_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU717211_HBSP_P-RF-CB      DLNEHQLPARDPARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
AY123424_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
AY247030_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHLGLS
EU939602_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
FJ386646_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377549_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377626_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377633_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ924618_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
JF436923_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMEIALVFPSHHLGLS
KF873537_HBSP_P-RF-CB      DPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
KF873533_HBSP_P-RF-CB      NPNDQRPPARDLAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
KF873532_HBSP_P-RF-CB      NPNDQRPPARDLAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
KF873531_HBSP_P-RF-CB      NPNDQRPPARDLAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
KF873530_HBSP_P-RF-CB      NPNDQQPPARDLAEPARSLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
JX661487_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSRHPGLS
MF925389_HBSP_P-RF-DC      NLNDHQPPARDHAKPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KU679952_HBSP_P-RF-CB      NPNDQRPPARDLAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
KU679940_HBSP_P-RF-CB      BPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRTXIAPVFPSHHLGLS
KU679945_HBSP_P-RF-CB      NLNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
Y18857_HBSP_P-RF-CB        NLNEHQLPARDLARPARFLLKEPLCFPLVAVQNLRTETAPVFPSHHLGLS
MF925382_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKGPLCFPLVAVQNLRMEIALVFPSHRLGLS
MF925381_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
MF925370_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KU964351_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
KJ803804_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KJ803798_HBSP_P-RF-CB      NLNEHQLPAPDHAKPARFLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
KJ803753_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KJ410506_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KF053160_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KC774324_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
JQ027310_HBSP_P-RF-CB      NLNEXQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
JX661498_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
KC774344_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JQ040146_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JQ040148_HBSP_P-RF-CB      NLNEHQLPALDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JQ040174_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKXPLCFPLVAVQNLRTETALVFPSHHXGLS
JQ707714_HBSP_P-RF-CB      NLNDHQLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MK321265_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLS
MG893559_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MG893555_HBSP_P-RF-CB      NLNEHQLPALDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MG893554_HBSP_P-RF-CB      NLNEHQLPALDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MG826149_HBSP_P-RF-CB      NPNDHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MG826142_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
LC458432_HBSP_P-RF-CB      NLNEHQLPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
LC279267_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
LC279266_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
LC279265_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
LC279264_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
LC279263_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KY881840_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KY470893_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964003_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964001_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU963999_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU963998_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU963995_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU963994_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU963993_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU963991_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU963990_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU963883_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU695742_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
KM875422_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTQTALVFPSHHPGLS
KJ173358_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173349_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173326_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173325_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPICFPLVAVQNLRTETALVFPSHHPGLS
KJ173322_HBSP_P-RF-CB      NLNEHQLPARDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173320_HBSP_P-RF-CB      NLNEHQLPARDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173300_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLHKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173299_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLHKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173280_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173279_HBSP_P-RF-CB      NLNEHQLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774349_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTEIALVFPSHHPGLS
KC774341_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774332_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774328_HBSP_P-RF-CB      NLNEHQLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774322_HBSP_P-RF-CB      NLNEHPLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774317_HBSP_P-RF-CB      NLNEHPLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774294_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774263_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774188_HBSP_P-RF-CB      NLNEHQLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JX661494_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JX661486_HBSP_P-RF-CB      NLNEHQLPALDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JX661485_HBSP_P-RF-CB      NLNEHQLPALDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JX429896_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JX026887_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JQ040142_HBSP_P-RF-CB      NLNEHQLPALDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JQ040130_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
HQ700547_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GU385774_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377634_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377613_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377611_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377594_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377544_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377534_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377520_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377516_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715414_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715413_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715412_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715411_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715387_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715385_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715384_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715347_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715346_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715345_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562336_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562314_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562305_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562287_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHRPGLS
FJ562271_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCIPLVAVQNLRTETALVFPSHHPGLS
FJ562267_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562229_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562227_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLS
FJ386635_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ386633_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ386585_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ386581_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ386578_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ032343_HBSP_P-RF-CB      NPNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
EU939606_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLS
EU939589_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU939551_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU872015_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU872014_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNHRTETALVFPSHHPGLS
EU871997_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871996_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871995_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVRNLRTETALVFPSHHPGLS
EU871994_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871993_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871992_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871991_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871990_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871989_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871988_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871987_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871986_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871985_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871984_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871983_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871981_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AY123041_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AY040627_HBSP_P-RF-CB      NLNEHQLPARDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AF461361_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AF330110_HBSP_P-RF-CB      NLNEHQLPARDHARPARXLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB670303_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB205152_HBSP_P-RF-CB      NLNEHQLPARDHAKPARFLLKEPLCFPLVAVQNLRTZTALVFPSHXPGLS
AB300369_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KF873534_HBSP_P-RF-CB      NLNDQRPPARDLAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
KF873538_HBSP_P-RF-CB      NPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
KF873540_HBSP_P-RF-CB      NPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
KF873542_HBSP_P-RF-CB      NPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
KF873543_HBSP_P-RF-CB      NPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
MG826151_HBSP_P-RF-BC      NLNDHQQPAPDHAKPARLLLKGTLCFPHVAVQNLRTETAPVFPSHHLGLS
JF440021_HBSP_P-RF-AG      NLNDPRPPVRDPAKPARLLLKATLCITHVAVQNLRTEIAPVFPSHHLGLS
MG826145_HBSP_P-RF-BC      NPNDHQPQAPGHAEPARLLLKEPLYFPHVAVQNLRTETAPVFPSHHLGLS
MH746813_HBSP_P-RF-BC      NPNDHQPQAPGHAEPARLLLKEPLYFPHVAVQNLRTETAPVFPSHHLGLS
MH746811_HBSP_P-RF-BC      NPSDHQPQAPGHAEPARLLLKEPLYFPHVAVQNLRTETAPVFPSHHLGLS
MH746812_HBSP_P-RF-BC      NPNDHQPQAPGHAEPARLLLKEPLYFPHVAVQNLRTETAPVFPSHHLGLS
MK052970_HBSP_P-RF-BD      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KF053188_HBSP_P-RF-CB      NLNEHQLPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KJ803782_HBSP_P-RF-CB      NLNEHQLPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
GQ377595_HBSP_P-RF-BC      NLNDHQPQAPGHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KJ717800_HBSP_P-RF-CB      NLNEHQQQARDRARPARLLLKGPLCFPHVAVQNLRTETAPVFPSHHLGLS
KJ803791_HBSP_P-RF-CB      NLNEHQQQARDRARPARLLLKGPLCFPHVAVQNLRTETAPVFPSHHLGLS
EU660227_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MG826150_HBSP_P-RF-BC      NLNDHRPPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHRLGLS
KC774414_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
JQ801477_HBSP_P-RF-BC      BLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK052967_HBSP_P-RF-BD      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSRHLGLS
EU939627_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
GQ377630_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KP148337_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK052968_HBSP_P-RF-BD      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
GQ377635_HBSP_P-RF-BC      NLNEHQLPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KC315400_HBSP_P-RF-CB      NLNEHQLPAPDHAKPAQLLLKGPLCFPHVAVQNLRTETAPVFPSHHLGLS
KJ717815_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KJ717816_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KJ803803_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KJ410497_HBSP_P-RF-BC      NLNDHQRPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
AB241109_HBSP_P-RF-CB      NLNEHPQQARDHARPARLLLKEPLCFPPVAVQNLRTETAPVFPSHHLGLS
KC774178_HBSP_P-RF-BC      NLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KC774364_HBSP_P-RF-BC      NLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MH094410_HBSP_P-RF-BC      NLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
EU882006_HBSP_P-RF-CB      NLNDHQQPVPDHARPARLLLKEPLCFPHVAVQNLRMETAPVFPSHHLGLS
AF297619_HBSP_P-RF-DA      NLNDPQQPARDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLS
AB194949_HBSP_P-RF-AE      NLNDPQPPVRDHAEPARLLLKATLCFPHVAVQNLRTEIALVFPSHHPGLS
GQ331048_HBSP_P-RF-AE      NPNEPQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
JF439776_HBSP_P-RF-AG      LPNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLS
JF440019_HBSP_P-RF-AG      NLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLS
JF440022_HBSP_P-RF-AG      NLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLS
AB222708_HBSP_P-RF-AD      NLNDQQQPVRDHAKPARLLLKATLCFPHVAVPNLRTEIAPVFPSHRPGLS
AB453985_HBSP_P-RF-AC      NLNDQQQPVQDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
AB933282_HBSP_P-RF-AG      NLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
AB933283_HBSP_P-RF-AG      NLNDQQQPVRDHAKPARLLLKATLCXPHVAVQNLRMEIAPVFPSHRPGLS
MF925386_HBSP_P-RF-AC      NLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
GQ161788_HBSP_P-RF-AE      NLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHHGLS
GQ161767_HBSP_P-RF-AE      NLNDQQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHHGLS
GQ161837_HBSP_P-RF-AE      NLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNLRTETAPVFPSHHHGLS
GQ161838_HBSP_P-RF-AE      NLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNLRTETAPVFPSHHHGLS
HF571060_HBSP_P-RF-AE      NLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHHGLS
KP148450_HBSP_P-RF-GC      NPNDPRPPARDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
EU939631_HBSP_P-RF-BC      NLNDPQQPAPDHAKPARLLLTEPLCFPHVAVQNLRTETAPVFPSHHLGLS
HM146131_HBSP_P-RF-AD      NLNDQQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
AY161147_HBSP_P-RF-DA      NLNDLQLPARDHAEPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
KJ586810_HBSP_P-RF-AF      LPNDPQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
MF488705_HBSP_P-RF-AD      NPNDPQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
AY161140_HBSP_P-RF-AD      NLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
AY161141_HBSP_P-RF-AD      NLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
AY233277_HBSP_P-RF-AC      NLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
AY236161_HBSP_P-RF-DA      NLNDPQQPARDHAKPARLLLKATLCFPPVAVQNLRMEIAHVFPSHRPGLS
AY161145_HBSP_P-RF-AD      NLNDPQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
AY161146_HBSP_P-RF-AD      NLNDPQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
KF214656_HBSP_P-RF-AC      NLNDPQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
EF103283_HBSP_P-RF-AD      NLNDQQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
EF103282_HBSP_P-RF-AD      NLNDQQQPARDPAEPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
MF925404_HBSP_P-RF-AC      NLNDQQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
EU833889_HBSP_P-RF-GA      LPSDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLS
EU185780_HBSP_P-RF-AD      NLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
KC012653_HBSP_P-RF-AD      NLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
EU833890_HBSP_P-RF-GA      LPDDPRPPARDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHRPGLS
AB933279_HBSP_P-RF-AG      LPNDQQQPVRDHAKPARLLLKATLCIPHVAVQNLRMEIAPVFPSHRPGLS
AB933280_HBSP_P-RF-AG      LPNDQQQPVRDHAKPARLLLKATLCIPHVAVQNLRMEIAPVFPSHRPGLS
AB933281_HBSP_P-RF-AG      LPNDQQQPVRDHAKPARLLLKATLCIPHVAVQNLRMEIAPVFPSHRPGLS
JQ707474_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKAPLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707426_HBSP_P-RF-GA      LPDDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707421_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707430_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707432_HBSP_P-RF-GA      LPNDPRPPVRDLAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707441_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707445_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707448_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707450_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707456_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707457_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707458_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707460_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707461_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707462_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707463_HBSP_P-RF-GA      LPNDPRPPVWDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707464_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707465_HBSP_P-RF-GA      LPNDPRPPVWDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707466_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707467_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707468_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707469_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707470_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707471_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707472_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707473_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707475_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707424_HBSP_P-RF-GA      LPDDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707459_HBSP_P-RF-GA      LPDDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
EF464099_HBSP_P-RF-AG      LPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
HE981180_HBSP_P-RF-GF      LPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ361772_HBSP_P-RF-GC      NLNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
JQ272886_HBSP_P-RF-GF      LPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
JQ272887_HBSP_P-RF-GF      LPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
KF219922_HBSP_P-RF-GH      LPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
KP274926_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
KY470998_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSQHLGLS
KY471001_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSQHLGLS
KY470996_HBSP_P-RF-GC      NPNDPRPPVREHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KP148441_HBSP_P-RF-GC      NPNDPRPPARDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KP148449_HBSP_P-RF-GC      NPNDPRPPARDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KP148586_HBSP_P-RF-GC      NPNDPRPPARDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
FJ882610_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ882613_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ882614_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
KX765835_HBSP_P-RF-GC      NLNDPQPPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ023662_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
EU835240_HBSP_P-RF-GC      NLNDPRPPVREHAEPARLLLKATLCIPYVAVQNLRTEIAPVFPSHHLGLS
KF214680_HBSP_P-RF-GC      NPNDPRPPVRELAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
MH368022_HBSP_P-RF-GC      NPNDPRPRVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
EU833891_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ023659_HBSP_P-RF-BC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
FJ023664_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ023666_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ023667_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ023668_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ023670_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ023673_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ882611_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ882612_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ882617_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ882618_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FR714490_HBSP_P-RF-GB      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KC172106_HBSP_P-RF-GB      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KY470997_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
KY470999_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KY471000_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KY471002_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KY471003_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KY471004_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
KY471005_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KY471006_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KY471007_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
FJ023665_HBSP_P-RF-GC      DPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
AB330368_HBSP_P-RF-DA      NLNDLQLPARDHAEPARLLLKAPLCIPHVAVPNLRTEIAPVFPSHHPGLS
GU177079_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPLVAVQNLRMETAPVFPSHHPGLS
X65259_HBSP_P-RF-DA        NLNDLQQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLS
KX660685_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCFPPVAVQNLRTEIAPVFPSHHPGLS
EF103284_HBSP_P-RF-AD      NLNDQQQPARDPAKPARLLLKATLCFPHVAVQNLWMEIAPVFPSHHPGLS
JN688715_HBSP_P-RF-DE      NLNDPQPPARDHAELARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MK052957_HBSP_P-RF-DE      NLNDPQQPARDHAEPARLLHKEPLCIPPVAVQNLRTEIAPVFPSRHHGLS
MK052969_HBSP_P-RF-DE      NLNDPQQPARDHAEPARLLLKEPLCIPPVAVPNLQTEIAPVFPSHHPGLS
KX660684_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KM577666_HBSP_P-RF-DE      NLNETQPPARDHAEPARLLLKEPLCISPVAVPNLRTEIAPVFPSHHHGLS
JN688689_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
X68292_HBSP_P-RF-DA        NLNVLQQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLS
KM577667_HBSP_P-RF-DE      NLNDPQPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KX827302_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KF679991_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774431_HBSP_P-RF-DC      NLNDLQLPARDPAKPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
FJ904414_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
EU594406_HBSP_P-RF-DE      NLNDRQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
FJ904397_HBSP_P-RF-DE      NLNDRQPPARDHAEPARLLLKEPLCIPPVAVQNLRMEXAPVFPSHHPGLS
FJ904408_HBSP_P-RF-DE      NLNDRQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904409_HBSP_P-RF-DE      NLNDRQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
DQ464167_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
DQ464166_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JN688717_HBSP_P-RF-DE      NLSDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIALVFPSHHPGLS
DQ315777_HBSP_P-RF-DE      NLNDPQPPAREHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AY373430_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MK052976_HBSP_P-RF-BD      NLNDHQQPAPDHAKPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MF488702_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KT366492_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KT003704_HBSP_P-RF-CB      NLNERQRPVRDHAGPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
KR013806_HBSP_P-RF-CB      NLNEHQRPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KM524359_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KM524337_HBSP_P-RF-DE      NLNDPQPPAREHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KM524336_HBSP_P-RF-DE      NLNDPQPPAREHAEPARLLLKEPLCIPPVAVPNLRTKIAPVFPSHHPGLS
KJ803771_HBSP_P-RF-DB      NLNDLQPPAWDHAEHARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KJ647351_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KJ647349_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLS
GU563560_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AY233293_HBSP_P-RF-DE      DLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AB270538_HBSP_P-RF-DE      NLNDHQPPARAHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AB188243_HBSP_P-RF-DE      NLNDPQPPARDHAEHARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AB188245_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AB583679_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AJ627217_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AY233295_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
DQ111987_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
DQ464164_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
DQ464165_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
EF103285_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
EU594435_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
GQ183486_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MH685719_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLWMETAPVFPSHHPGLS
MF925397_HBSP_P-RF-DC      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHLGLS
MF925396_HBSP_P-RF-DC      NLNDLQQPAWDHAEPARPLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KY470844_HBSP_P-RF-DC      NLNDLRPPARDHAEPARLLLKTPLCIPPVAVQNLRPEIAPVFPSHHPGLS
KX357636_HBSP_P-RF-DE      NLNDLQQPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KX357629_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHLGLS
KX357626_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KX357625_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHHGLS
KT366503_HBSP_P-RF-DE      NLNDLQPPAWDHAEPARLLFKEPLYIPPVAVPNLRTEIAPVFPSHHPGLS
KJ470898_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KC774442_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
JN664929_HBSP_P-RF-DE      NLNDLRPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JN642160_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JN642127_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JN257210_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AB674434_HBSP_P-RF-DE      NLNDLQRPAREHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JN664946_HBSP_P-RF-DA      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JN257216_HBSP_P-RF-DE      NLNDLQLPARAHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLS
MH464835_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIALVFPSHHPGLS
MH464846_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MH464850_HBSP_P-RF-DA      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MH464851_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MH464852_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
X80925_HBSP_P-RF-DE        NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KX357630_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KU736922_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KM577664_HBSP_P-RF-DE      NLNDPQPPARDHAKPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KM577663_HBSP_P-RF-DE      NLNDPQPPARDHAKPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KM386676_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KM359442_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JX898696_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPTVAVPNLRTEIAPVFPSHHPGLS
JX898695_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPTVAVPNLRTEIAPVFPSHHPGLS
JX898693_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPTVAVPNLRTEIAPVFPSHHPGLS
JN664943_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MF925402_HBSP_P-RF-BD      NLNDLQTPAWDHAEPARLLFKEPLCIPLVAVPNLRTEIAPVFPSHHPGLS
MF925401_HBSP_P-RF-DB      NLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MF925392_HBSP_P-RF-DB      NLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MF925388_HBSP_P-RF-DC      NLNDLQPPAWDHAEPARLLFKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MF925371_HBSP_P-RF-DC      NLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MF925360_HBSP_P-RF-DB      NLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KX827299_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KX357635_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KX357634_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KX357633_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KX357632_HBSP_P-RF-DE      NPNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KX357631_HBSP_P-RF-DE      NPNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
KX357627_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KX357623_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KU736923_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KU736921_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KT366504_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKGPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KR905422_HBSP_P-RF-DE      NLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KP995112_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKAPLCIPPVAVQNLRMETAPVFPSHHPGLS
KP168418_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KP168417_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KP168416_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KM606751_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKAPLCIPPVAVQNLRMETAPVFPSHHPGLS
KM606750_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KM577665_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KM524357_HBSP_P-RF-DE      NLNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KF471643_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KF170740_HBSP_P-RF-DE      NLNDLQPPARDPAGPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
JQ687532_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JN642152_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JN642141_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JN642139_HBSP_P-RF-DE      NLNDLQLPARDPAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JN642137_HBSP_P-RF-DE      NPNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JN257207_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLX
JN257206_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLX
JN257204_HBSP_P-RF-DE      NPNDLQPPARDHAEPARPLLKEPLCIPPVAVPNLRTETAPVFPSHHPGLS
JN257189_HBSP_P-RF-DE      NLNDLQXPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JN257191_HBSP_P-RF-DE      NLNDLQXPARXXAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KY470845_HBSP_P-RF-DC      NPNEIRPPARDPAEPARLLLKEPLRIPPVAVQNLRTEIAPVFPSHHPGLS
KY470848_HBSP_P-RF-DC      NPNEIRPPARDPAEPARLLLKEPLRIPPVAVQNLRTEIAPVFPSHHPGLS
KY470851_HBSP_P-RF-DC      NPNEIRPPARDPAEPARLLLKEPLRIPPVAVQNLRTEIAPVFPSHHPGLS
KY470852_HBSP_P-RF-DC      NPNEIRPPARDPAEPARLLLKEPLRIPPVAVQNLRTEIAPVFPSHHPGLS
J02202_HBSP_P-RF-DE        NLNDHQPPARDPAEPARLLLKESLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ349207_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPAAVQNLRMETAPVFPSHHPGLS
KX660689_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KU964367_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRTEIAPVFPSHHFGLS
KP288875_HBSP_P-RF-DE      NLNDLQPPARDRAKPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
HM750147_HBSP_P-RF-DC      NLNDRQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
HM750148_HBSP_P-RF-DC      NLNDRQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774482_HBSP_P-RF-DC      NLNDRQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
FJ562263_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KT991424_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KT991427_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KX357641_HBSP_P-RF-DE      NLNDPQPPARDHARPARLLLKAXLCFPHVAVPNLRTETAPVFPSHHPGLS
KU711666_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHHGLS
JN257154_HBSP_P-RF-DE      NPNDLQLPARDHAEPARLLLKETLRFPPVVVPNLRTEIAPVFPSHHPGLS
GQ161806_HBSP_P-RF-EA      LPDDHQPPVRDPAEPARLLLKEPLCFPHVVVQNLRTEIALVFPSHHHGLS
FN594771_HBSP_P-RF-DE      NLNSLQPPARDHAEPARLLLKEPLCIPPVAVQNLWMETAPVFPSHHHGLS
FN594767_HBSP_P-RF-DE      LPNDRQLPARDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLS
FJ904430_HBSP_P-RF-DE      DLNDLQPPARDHAGLARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
MF618346_HBSP_P-RF-DE      NLNDLQPPAREHAGPARLLLEEPLCIPLVAVQNLRMETALVFPSHHPGLS
KU964366_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRTEIAPVFPSHHLGLS
KU964370_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRTEIAPVFPSHHLGLS
KU964372_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRTEIAPVFPSHHLGLS
KU964374_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRTEIAPVFPSHHLGLS
KU964379_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRTEIAPVFPSHHLGLS
KU964380_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRTEIAPVFPSHHLGLS
KJ647356_HBSP_P-RF-DE      NLNDHQPPARDHAKPAQLLFKEPLCFPHVAVQNLRTEIAPVFPSHHPGLS
KF192833_HBSP_P-RF-DE      NLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KF192835_HBSP_P-RF-DE      NLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KF192836_HBSP_P-RF-DE      NLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KF192837_HBSP_P-RF-DE      NLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KF192838_HBSP_P-RF-DE      NLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KF192839_HBSP_P-RF-DE      NLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KF192841_HBSP_P-RF-DE      NLNDLQPPAREHAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLS
MF618347_HBSP_P-RF-DE      NLNDLQPPAREHAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KC774458_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLEEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
JF491455_HBSP_P-RF-DC      NLNDPQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774450_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JF491448_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLTEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
HQ700503_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLEEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700536_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLEEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700494_HBSP_P-RF-DE      ILNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
GQ161754_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHHGLS
FJ904442_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904437_HBSP_P-RF-DE      NLNDLRPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
DQ478889_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHLGLS
AY817512_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
AY817513_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAHVFPSHHPGLS
DQ478898_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
EU787435_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
KC774428_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
KC774430_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
KC774468_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
KC774492_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
KC774494_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
AB033559_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
AB048702_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
AB048703_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ692536_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHRPGLS
HQ700492_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700493_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRKETAPVFPSHHPGLS
HQ700497_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700500_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700501_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700524_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700525_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700534_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700535_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700537_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700538_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700539_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700540_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700541_HBSP_P-RF-DE      NLNDHQPPARDPAGPARLLLKEPLCIPPVVVQNLRTETAPVFPSHHPGLS
HQ700579_HBSP_P-RF-DE      NLNDHRPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700581_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700582_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700583_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700584_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700585_HBSP_P-RF-DE      NLNDHRPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
KF779353_HBSP_P-RF-DA      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHRPGLS
MH481858_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
MH481860_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
MH481861_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
MH481862_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
MH481859_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
JX429898_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774434_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774463_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCFPPVAVQNLRTEIAPVFPSHHPGLS
KC774472_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774489_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774497_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774499_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KP276254_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPHVAVQNLRTEIAPVFPSHHPGLS
KP276255_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPHVAVQNLRTEIAPVFPSHHPGLS
AY057948_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AY817511_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
DQ478890_HBSP_P-RF-DC      NLNDLQPPARDPAEPARRLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
FJ349241_HBSP_P-RF-DC      NLNDLQPPARDPAKPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
HM750142_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
HM750143_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
HM750145_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
HM750146_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
HM750149_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
HM750150_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774456_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774485_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KP276253_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAHVFPSHHPGLS
KP276256_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KX354997_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KX660686_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRKEIAPVFPSHHPGLS
DQ991753_HBSP_P-RF-DE      NLTDLQPPARDHAEPARLLLKEPLCIPLVAVQNLRMETAPVFPSHHPGLS
FJ904407_HBSP_P-RF-DE      NLTDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
AB674432_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AB674433_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
FJ904444_HBSP_P-RF-DE      NPNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
JF754616_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JN257164_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JN257174_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KY629632_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
EU594436_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLS
FJ904405_HBSP_P-RF-DE      NLNDLQPPARDHAEPARHLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
AB674436_HBSP_P-RF-DE      NLNDLRPPARDHAEPARLLHKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AM494716_HBSP_P-RF-DE      NLNDLQPPAGDHAEPARLLLKEPLCIPLVAVQNFRMETAPVFPSHHPGLS
FJ904394_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904403_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCFPPVAVQNLRMETAPVFPSHHPGLS
FJ904404_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904406_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904425_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904428_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904436_HBSP_P-RF-DE      NLNDLQPPARDHAEPARHLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904440_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904398_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904416_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPHVAVQNLRMETAPVFPSHHPGLS
FJ904417_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPHVAVQNLRMETAPVFPSHHPGLS
KY470854_HBSP_P-RF-DC      NLNDLRPPARDPAEPARLLLKTSLCIPPVAVQNLRPEIAPVFPSHHPGLS
KX660680_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AB270535_HBSP_P-RF-DC      NLNELQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AB674504_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AY800249_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AY817509_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIALVFPSHHPGLS
AY817510_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKDPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AY817515_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AY862864_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AY862865_HBSP_P-RF-DC      NLNDLQPTAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AY862866_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
DQ478886_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
DQ478887_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
DQ478892_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
DQ478897_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
EU787434_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
FJ562278_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
JF491449_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
JF491451_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774420_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774422_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774423_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774424_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774425_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774426_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774432_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774433_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774435_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774439_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774443_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774447_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774448_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRPEIAPVFPSHHPGLS
KC774452_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774453_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774454_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMEIAPVFPSHHPGLS
KC774455_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774457_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774461_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774466_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774470_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774471_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774474_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774475_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774476_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774478_HBSP_P-RF-DC      NLNDLQPPARDLAEPARLLLKEPLCIPPVAVQNLRMEIAPVFPSHRPGLS
KC774479_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774480_HBSP_P-RF-DC      NLNDLQPPARDLAEPARLLLKEPLCIPPVAVQNLRMEIAPVFPSHRPGLS
KC774481_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPLVAVQNLRTEIAPVFPSHHPGLS
KC774483_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774484_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774486_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPHVAVQNLRTEIAPVFPSHHPGLS
KC774488_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774490_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774493_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774495_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774498_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KJ470884_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KJ470886_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KY470856_HBSP_P-RF-DC      NLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRPEIAPVFPSHHPGLS
KY470855_HBSP_P-RF-DC      NLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRSEIAPVFPSHHPGLS
KY470850_HBSP_P-RF-DC      NLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRSEIAPVFPSHHPGLS
KY470849_HBSP_P-RF-DC      NLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRSEIAPVFPSHHPGLS
KY470847_HBSP_P-RF-DC      NLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRSEIAPVFPSHHPGLS
KY470846_HBSP_P-RF-DC      NLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRSEIAPVFPSHHPGLS
KY470843_HBSP_P-RF-DC      NLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRSEIAPVFPSHHPGLS
KX660682_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KX660677_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KX660675_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KX660674_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KU736917_HBSP_P-RF-DE      NLNDLQPPARDHADPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KU736915_HBSP_P-RF-DE      NLNDLQPPARDHAXPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KU736914_HBSP_P-RF-DE      NLNDLQPPARDHADPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KU519423_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KU519422_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KT991423_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KT991421_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KT991420_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KT991419_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KT991417_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KP168421_HBSP_P-RF-DE      NLNDLQPPARDLAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KP168420_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KJ470897_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KJ470892_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLCFPPVAVQNLRMETAPVFPSHHPGLS
KJ470891_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KJ470890_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KJ470887_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLXIPPVAVQNLRMEIAPVFPSHHPGLS
KJ470888_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904400_HBSP_P-RF-DE      DLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KC774449_HBSP_P-RF-DC      DPNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
FN594769_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPHVAVQNLRMETAPVFPSHHHGLS
KM606741_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAHVFPSHHHGLS
AB674412_HBSP_P-RF-DE      NLNDLQRPARDHAEPARPLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLS
KY670781_HBSP_P-RF-DC      DLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHHGLS
FJ904447_HBSP_P-RF-DE      DLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHHGLS
FJ904396_HBSP_P-RF-DE      DLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904441_HBSP_P-RF-DE      DLNDLQPPARDHAEPARLLLKEPLCFPPVAVQNLRMETAHVFPSHHPGLS
JF754613_HBSP_P-RF-DE      DLNDLQRPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLS
JN040803_HBSP_P-RF-DE      DLNDLQRPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KX357628_HBSP_P-RF-DE      DLNDLQLPARDHAEPARLLLKAPLCIPPVAVQNLRMETAPVFPSHHPGLS
                                       *  *. *    :  .  .* * .   * ****.  *  

KC774323_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KF053166_HBSP_P-RF-BC      QDSYGSGPQSVSLGSVY-
KJ803827_HBSP_P-RF-BC      QDSYGSGPQSVSLGSVY-
EU787444_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AB493840_HBSP_P-RF-CB      QDSYGSGPQSVSLGSVY-
KJ717814_HBSP_P-RF-CB      QNSYGSGPQSVSLGSVY-
KJ803802_HBSP_P-RF-CB      QNSYGSGPQSVSLGSVY-
FJ386643_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ386586_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EF494378_HBSP_P-RF-CA      QNSYGSGPQSVSPGSVY-
AB493842_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963930_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963931_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963932_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963933_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963934_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963935_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963936_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963938_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963939_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963940_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963941_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963942_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963943_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963944_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ410520_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ475335_HBSP_P-RF-CB      QNSYGSGPQSVSHGSVY-
EU881995_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AF233236_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
AB195940_HBSP_P-RF-CB      QDSYGSGPQSVSHGSVY-
AB195941_HBSP_P-RF-CB      QDSYGSGPQSVSHGSVY-
AB195956_HBSP_P-RF-CB      QDSYGSGPQSVSHGSVY-
AB195957_HBSP_P-RF-CB      QDSYGSGPQSVSHGSVY-
AB033557_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
AB195939_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AB195955_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AY167095_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AY206374_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AB014375_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ032337_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
JN400086_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774193_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774198_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774201_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774291_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774307_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377560_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ803822_HBSP_P-RF-CB      QDTYGSGPQSVSPGSVY-
JX504540_HBSP_P-RF-CB      QDSYGSGPQSVSPGPVY-
EU939621_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EF494376_HBSP_P-RF-CA      QDSYGSGPQSVSPGSVY-
AP011102_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
HQ700519_HBSP_P-RF-CB      QDSYGSGPQSVSLGSVY-
GQ377592_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ562223_HBSP_P-RF-CD      QDSYGSGPQSVSPGSVS-
AB105172_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AB493837_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AB493838_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AB493847_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AP011103_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ358155_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ358156_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AB049609_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU939668_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AB642096_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774212_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU589337_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377556_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ562277_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377604_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
MG826146_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
MG826148_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
MG826144_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
MG826141_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
M38454_HBSP_P-RF-CB        QDSYGSGPQSVSPGSVY-
KU964313_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KP148352_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ717794_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ803788_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ598675_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ173350_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
KF917451_HBSP_P-RF-DC      QNSYGSGPQPVSPGSVY-
JQ732168_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
HQ684849_HBSP_P-RF-BC      QDSYGSGPQSVSPGSVY-
HQ700523_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
HQ684848_HBSP_P-RF-CB      QNTYGSGPQSVSLGSVY-
HM750133_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377564_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377565_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377581_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377590_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377596_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377607_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377614_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377627_HBSP_P-RF-CD      QNSYGSGPQPVSPGSVY-
FR714496_HBSP_P-RF-CB      QDSYGSGPQPVSPGSVY-
FJ562302_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVH-
FJ386674_HBSP_P-RF-BC      QDSYGSGPQSVSHGSVY-
EU916228_HBSP_P-RF-CB      QDSYGSWPQSVSHGSVY-
EU589339_HBSP_P-RF-CB      QNSYGSGPQSVSHGSVY-
EU522070_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AB367400_HBSP_P-RF-CB      QDSYGSGPQSVSHGSVY-
AB367393_HBSP_P-RF-CB      QDSYGIGPQSVSHGSVY-
AB195950_HBSP_P-RF-CB      QNSYGSGPQSVSHGSVY-
AB195951_HBSP_P-RF-CB      QNSYGSGPQSVSHGSVY-
AB367419_HBSP_P-RF-CB      QDSYGSGPQSVSHGSVY-
AB367800_HBSP_P-RF-CB      QDSYGSGPQSVSHGSVY-
FJ386649_HBSP_P-RF-CB      QDSYGIGPQSVSHGSVY-
FJ562226_HBSP_P-RF-CB      QNSYGSGPQSVSHGSVY-
FJ562294_HBSP_P-RF-CB      QDSYGSGPQSVSHGSVY-
FJ787446_HBSP_P-RF-CB      QDSYGIGPQSVSHGSVY-
FJ787480_HBSP_P-RF-CB      QDSYGIGPQSVSHGSVY-
JF828933_HBSP_P-RF-CB      QDSYGSGPQSVSHGSVY-
JF828934_HBSP_P-RF-CB      QDSYGSGPQSVSHGSVY-
JF828936_HBSP_P-RF-CB      QDSYGSGPQSVSHGSVY-
JF828938_HBSP_P-RF-CB      QDSYGSGPQSVSHGSVY-
JF828935_HBSP_P-RF-CB      QDSYGSGPQSVSHGSVC-
KF053179_HBSP_P-RF-BC      QDSYGSGPQSVSPGSVY-
KJ803772_HBSP_P-RF-BC      QDSYGSGPQSVSPGSVY-
HQ700527_HBSP_P-RF-CB      QNTYGSGPQSVSPGSVY-
HQ700528_HBSP_P-RF-CB      QNTYGSGPQSVSPGSVY-
KX096713_HBSP_P-RF-CA      QNTYGSGPQSVSPGSVY-
KF873535_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
KU679939_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
FJ562317_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774183_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774186_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774230_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AP011104_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AP011105_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU939620_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377548_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
LC416040_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AF411409_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KX357624_HBSP_P-RF-DE      QNSYGSGPQPVSPGSVY-
MG826147_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
Y18856_HBSP_P-RF-CB        QDSYGSGPQSVSPGSVY-
MG893561_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
MF925384_HBSP_P-RF-DB      ENSYGSGPQPVSPGSVY-
KR013816_HBSP_P-RF-CB      QDSYGSGPQSVSLGSVY-
KM213033_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ803785_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ717832_HBSP_P-RF-CB      QDSYGSGPQSVSHGSVY-
KJ173330_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ173329_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
JQ801476_HBSP_P-RF-CG      QDSYGSGPQSVSPGSVY-
JF436922_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
HQ700526_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
HQ700520_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GU357843_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377602_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU939623_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU939581_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU939547_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AP011108_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377539_HBSP_P-RF-CB      QDSYGSGPQSVSPRSVH-
AB198084_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU916232_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU939630_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
HQ700530_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
HQ700531_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
HQ700532_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774234_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774305_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964005_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964006_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964007_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964008_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964009_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964010_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964303_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964304_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964305_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964306_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964307_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964308_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964309_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964310_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964311_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964312_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964314_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964315_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964316_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964317_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KY363262_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KY363263_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ562247_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU916239_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU916240_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU916241_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377522_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774222_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774246_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774258_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KR013843_HBSP_P-RF-CB      QDSYGSGPQSVSPYSVY-
KU963856_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963857_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963858_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963859_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963860_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963861_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963862_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963863_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963864_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963865_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963866_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963867_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963868_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963869_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963870_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU919166_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU919167_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ386593_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871999_HBSP_P-RF-CB      QDSYGSGPQSVSPGPVY-
EU717211_HBSP_P-RF-CB      QDSYGSGPQSVSPGSAY-
AY123424_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AY247030_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU939602_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ386646_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377549_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377626_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377633_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ924618_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
JF436923_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KF873537_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
KF873533_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
KF873532_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
KF873531_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
KF873530_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
JX661487_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
MF925389_HBSP_P-RF-DC      QNSYGSGPQSVSPGSVY-
KU679952_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
KU679940_HBSP_P-RF-CB      QNSYGSGPQXVSPGXVY-
KU679945_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
Y18857_HBSP_P-RF-CB        QNSYGSGPQSVSPGSVY-
MF925382_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
MF925381_HBSP_P-RF-CB      QDSYGSGPQSVSPGSIY-
MF925370_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964351_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
KJ803804_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ803798_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ803753_HBSP_P-RF-CB      QDSYGSGPQPVSPGSVY-
KJ410506_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KF053160_HBSP_P-RF-CB      QDSYGSGPQPVSPGSVY-
KC774324_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
JQ027310_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
JX661498_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774344_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVH-
JQ040146_HBSP_P-RF-CB      QDSYGXGPQSVSXGSVY-
JQ040148_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
JQ040174_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
JQ707714_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
MK321265_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
MG893559_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
MG893555_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
MG893554_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
MG826149_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
MG826142_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
LC458432_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
LC279267_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
LC279266_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
LC279265_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
LC279264_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
LC279263_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KY881840_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KY470893_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964003_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU964001_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963999_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963998_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963995_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963994_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963993_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963991_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963990_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU963883_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KU695742_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KM875422_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ173358_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ173349_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ173326_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ173325_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ173322_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ173320_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ173300_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ173299_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ173280_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KJ173279_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774349_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774341_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774332_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774328_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774322_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774317_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774294_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774263_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KC774188_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
JX661494_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
JX661486_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
JX661485_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
JX429896_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
JX026887_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
JQ040142_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
JQ040130_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
HQ700547_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
GU385774_HBSP_P-RF-CB      QESYGSGPQSVSPGSVY-
GQ377634_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377613_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
GQ377611_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377594_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377544_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377534_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377520_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
GQ377516_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ715414_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ715413_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ715412_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ715411_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ715387_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ715385_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ715384_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ715347_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ715346_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ715345_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ562336_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ562314_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ562305_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ562287_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ562271_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ562267_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ562229_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ562227_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ386635_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ386633_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ386585_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ386581_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
FJ386578_HBSP_P-RF-CB      QDSYGSGPQSVSPDSVY-
FJ032343_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU939606_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU939589_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU939551_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU872015_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU872014_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871997_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871996_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871995_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871994_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871993_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871992_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871991_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871990_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871989_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871988_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871987_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871986_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871985_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871984_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871983_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
EU871981_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AY123041_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AY040627_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AF461361_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AF330110_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AB670303_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AB205152_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
AB300369_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KF873534_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
KF873538_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
KF873540_HBSP_P-RF-CB      QNSYGSGPQXVSPGSVY-
KF873542_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
KF873543_HBSP_P-RF-CB      QNSYGSGPQSVSPGSVY-
MG826151_HBSP_P-RF-BC      QNTYGSGPQSVSLGSVY-
JF440021_HBSP_P-RF-AG      QNTYGSGPQSVSHGSVY-
MG826145_HBSP_P-RF-BC      QNTYGSGPQSVSLGSVY-
MH746813_HBSP_P-RF-BC      QNTYGSGPQPVSPGSVY-
MH746811_HBSP_P-RF-BC      QNTYGSGPQSVSPGSVY-
MH746812_HBSP_P-RF-BC      QNTYGSGPQPVSPGSVY-
MK052970_HBSP_P-RF-BD      QNTYGSGPQSVSLGSVY-
KF053188_HBSP_P-RF-CB      QNTYGSGPQSVSLGSVY-
KJ803782_HBSP_P-RF-CB      QNTYGSGPQSVSLGSVY-
GQ377595_HBSP_P-RF-BC      QNTYGSGPQSVSLGSVY-
KJ717800_HBSP_P-RF-CB      QNSYGSGPQSVSLGSVY-
KJ803791_HBSP_P-RF-CB      QNSYGSGPQSVSLGSVY-
EU660227_HBSP_P-RF-BC      QNTYGSGPQSVSLGSVY-
MG826150_HBSP_P-RF-BC      QNTYGSGPQSVSLGSVY-
KC774414_HBSP_P-RF-BC      QNTYGSGPQSVSLGSVY-
JQ801477_HBSP_P-RF-BC      QNSYGSGPQSVSLGSVY-
MK052967_HBSP_P-RF-BD      QNTYGSGPQSVSLGSVY-
EU939627_HBSP_P-RF-BC      QNTYGSGPQSVSLGSVY-
GQ377630_HBSP_P-RF-BC      QNTYGSGPQSVSLGSVY-
KP148337_HBSP_P-RF-BC      QNTYGSGPQSVSLGSVY-
MK052968_HBSP_P-RF-BD      QNTYGSGPQSVSLGSVY-
GQ377635_HBSP_P-RF-BC      QNTYGSGPQSVSLGSVY-
KC315400_HBSP_P-RF-CB      QNTYGSGPQSVSLGSVY-
KJ717815_HBSP_P-RF-CB      QNTYGSGPQSVSLGSVY-
KJ717816_HBSP_P-RF-CB      QNTYGSGPQSVSLGSVY-
KJ803803_HBSP_P-RF-CB      QNTYGSGPQSVSLGSVY-
KJ410497_HBSP_P-RF-BC      QNTYGSGPQSVSLGSVY-
AB241109_HBSP_P-RF-CB      QNTYGSGPQSVSLGSVY-
KC774178_HBSP_P-RF-BC      QNTYGSGPQSVSLGSVY-
KC774364_HBSP_P-RF-BC      QNTYGSGPQSVSLGSVY-
MH094410_HBSP_P-RF-BC      QNTYGSGPQSVSLGSVY-
EU882006_HBSP_P-RF-CB      QNTYGSGPQSVSLGSVY-
AF297619_HBSP_P-RF-DA      QNTYGSGPQSVSLGSVY-
AB194949_HBSP_P-RF-AE      QNTYGSGPQSVSPGSVY-
GQ331048_HBSP_P-RF-AE      QNTYGNGPQSVSHGSVH-
JF439776_HBSP_P-RF-AG      QNTYGTGPQSVSHGSVY-
JF440019_HBSP_P-RF-AG      QNTYGTGPQSVSHGSVY-
JF440022_HBSP_P-RF-AG      QNTYGTGPQSVSHGSVY-
AB222708_HBSP_P-RF-AD      QNTYGSGPQSVSPGSVY-
AB453985_HBSP_P-RF-AC      QNTYGSGPQSVSLGSVY-
AB933282_HBSP_P-RF-AG      QNTYGSGPQSVSLGSVY-
AB933283_HBSP_P-RF-AG      QNTYGSGPQSVSLGSVY-
MF925386_HBSP_P-RF-AC      QNSYGSGPQSVSLGSVY-
GQ161788_HBSP_P-RF-AE      QNSYGSGPQSVSPGSVY-
GQ161767_HBSP_P-RF-AE      QNTYGGGPQSVSPGSVY-
GQ161837_HBSP_P-RF-AE      XNTYGSGPQSVSPGSVY-
GQ161838_HBSP_P-RF-AE      XNTYGSGPQSVSPGSVY-
HF571060_HBSP_P-RF-AE      QNTYGSGPQSVSPGSVY-
KP148450_HBSP_P-RF-GC      QNSYGSGPQPVSPGSVY-
EU939631_HBSP_P-RF-BC      QNTYGSGPQSVSLGSVY-
HM146131_HBSP_P-RF-AD      QNTYGSGPQSVSLGSVY-
AY161147_HBSP_P-RF-DA      QNTYGSGPQSVSLGSVYL
KJ586810_HBSP_P-RF-AF      QNTYGSGPQSVSLGSVY-
MF488705_HBSP_P-RF-AD      QNTYGSGPQSVSLGSVY-
AY161140_HBSP_P-RF-AD      QNTYGSGPQSVSLGSVY-
AY161141_HBSP_P-RF-AD      QNTYGSGPQSVSLGSVY-
AY233277_HBSP_P-RF-AC      QNTYGSGPQSVSLGSVY-
AY236161_HBSP_P-RF-DA      QNTYGSGPQSVSLGSVY-
AY161145_HBSP_P-RF-AD      QNTYGSGPQSVSHGSVY-
AY161146_HBSP_P-RF-AD      QNTYGSGPQSVSHGSVY-
KF214656_HBSP_P-RF-AC      QNTYGSGPQPVSLGSVY-
EF103283_HBSP_P-RF-AD      QNTYGSGPQPVSPGSVY-
EF103282_HBSP_P-RF-AD      QNTYGSGPQSVSLGSVY-
MF925404_HBSP_P-RF-AC      QNTYGSGPQSVSLGSVY-
EU833889_HBSP_P-RF-GA      QNTYGSGPQSVSHGSVY-
EU185780_HBSP_P-RF-AD      QNTYGSGPQPVSPGSVY-
KC012653_HBSP_P-RF-AD      QNTYGSGPQPVSPGSVY-
EU833890_HBSP_P-RF-GA      QNTYGSGPQSVSHGSVY-
AB933279_HBSP_P-RF-AG      QNTYGSGPQSVSLGSVY-
AB933280_HBSP_P-RF-AG      QNTYGSGPQSVSLGSVY-
AB933281_HBSP_P-RF-AG      QNTYGSGPQSVSLGSVY-
JQ707474_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707426_HBSP_P-RF-GA      QNSYGSGPQSVSLGSVY-
JQ707421_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707430_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707432_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707441_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707445_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707448_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707450_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707456_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707457_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707458_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707460_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707461_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707462_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707463_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707464_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707465_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707466_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707467_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707468_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707469_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707470_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707471_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707472_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707473_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707475_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707424_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
JQ707459_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
EF464099_HBSP_P-RF-AG      QNTYGSGPQSVSHGSVY-
HE981180_HBSP_P-RF-GF      QNTYGSGPQSVSHGSVY-
FJ361772_HBSP_P-RF-GC      QNTYGSGPQSVSLGSVY-
JQ272886_HBSP_P-RF-GF      QNTYGSGPQSVSLGSVY-
JQ272887_HBSP_P-RF-GF      QNTYGSGPQSVSLGSVY-
KF219922_HBSP_P-RF-GH      QNTYGSGPQSVSLGSVY-
KP274926_HBSP_P-RF-GA      QNTYGSGPQSVSLGSVY-
KY470998_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
KY471001_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
KY470996_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
KP148441_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
KP148449_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
KP148586_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
FJ882610_HBSP_P-RF-GC      QNSYGSGPQPVSPGSVY-
FJ882613_HBSP_P-RF-GC      QNSYGSGPQPVSPGSVY-
FJ882614_HBSP_P-RF-GC      QNSYGSGPQPVSPGSVY-
KX765835_HBSP_P-RF-GC      QDSYGSGPQSVSPGSVY-
FJ023662_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
EU835240_HBSP_P-RF-GC      QNTYGSGPQPVSPGSIY-
KF214680_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
MH368022_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVH-
EU833891_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
FJ023659_HBSP_P-RF-BC      QNTYGSGPQPVSPGSVY-
FJ023664_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
FJ023666_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
FJ023667_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
FJ023668_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
FJ023670_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
FJ023673_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
FJ882611_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
FJ882612_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
FJ882617_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
FJ882618_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
FR714490_HBSP_P-RF-GB      QNTYGSGPQPVSPGSVY-
KC172106_HBSP_P-RF-GB      QNTYGSGPQPVSPGSVY-
KY470997_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
KY470999_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
KY471000_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
KY471002_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
KY471003_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
KY471004_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
KY471005_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
KY471006_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
KY471007_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
FJ023665_HBSP_P-RF-GC      QNTYGSGPQPVSPGSVY-
AB330368_HBSP_P-RF-DA      ENSYGSGPQPVSPGSVY-
GU177079_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
X65259_HBSP_P-RF-DA        ENSYGSGPQPVSPGSVY-
KX660685_HBSP_P-RF-DC      ENYYGSGPQPVSLGSVY-
EF103284_HBSP_P-RF-AD      ENSYGSGPQPVSPGSVY-
JN688715_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
MK052957_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
MK052969_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KX660684_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KM577666_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN688689_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
X68292_HBSP_P-RF-DA        ENSYGSGPQPVSPGSVY-
KM577667_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KX827302_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KF679991_HBSP_P-RF-DE      QNSYGSGPQPVSPGSVY-
KC774431_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
FJ904414_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
EU594406_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904397_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904408_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904409_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
DQ464167_HBSP_P-RF-DE      QNSYGSGPQPVSPGSVY-
DQ464166_HBSP_P-RF-DE      QNSYGSGPQPVSPGSVY-
JN688717_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
DQ315777_HBSP_P-RF-DE      ENSYGSGPQPVSPDSVY-
AY373430_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
MK052976_HBSP_P-RF-BD      ENSYGSGPQPVSPGSVY-
MF488702_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KT366492_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KT003704_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KR013806_HBSP_P-RF-CB      QDSYGSGPQSVSPGSVY-
KM524359_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KM524337_HBSP_P-RF-DE      ENSYVSGPQPVSPDSVY-
KM524336_HBSP_P-RF-DE      ENSYGSGPQPVSPDSVY-
KJ803771_HBSP_P-RF-DB      ENSYGSGPQPVSPGSVY-
KJ647351_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KJ647349_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
GU563560_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVH-
AY233293_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
AB270538_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
AB188243_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
AB188245_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
AB583679_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
AJ627217_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
AY233295_HBSP_P-RF-DE      ENSHGSGPQPVSPGSVY-
DQ111987_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
DQ464164_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
DQ464165_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
EF103285_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
EU594435_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
GQ183486_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
MH685719_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
MF925397_HBSP_P-RF-DC      ENSYGSGPQPVSPGSVY-
MF925396_HBSP_P-RF-DC      ENSYGSGPQSVSPGSVY-
KY470844_HBSP_P-RF-DC      ENSYGSGPQPVSLGPVY-
KX357636_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KX357629_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KX357626_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KX357625_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KT366503_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KJ470898_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVH-
KC774442_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVH-
JN664929_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN642160_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN642127_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN257210_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
AB674434_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN664946_HBSP_P-RF-DA      ENSYGSGPQPVSPGSVY-
JN257216_HBSP_P-RF-DE      ENSYGSGPQPVSPGSXY-
MH464835_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
MH464846_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
MH464850_HBSP_P-RF-DA      ENSYGSGPQPVSPGSVY-
MH464851_HBSP_P-RF-DE      ETSYGSGPQPVSPGSVY-
MH464852_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
X80925_HBSP_P-RF-DE        ENSYGSGPQPVSPGSVY-
KX357630_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KU736922_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KM577664_HBSP_P-RF-DE      ENSYGSGTQPVSPGSVY-
KM577663_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KM386676_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KM359442_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JX898696_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JX898695_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JX898693_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN664943_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
MF925402_HBSP_P-RF-BD      ENSYGSGPQPVSPGSVY-
MF925401_HBSP_P-RF-DB      ENSYGSGPQPVSPGSVY-
MF925392_HBSP_P-RF-DB      ENSYGSGPQPVSPGSVY-
MF925388_HBSP_P-RF-DC      ENSYGSGPQPVSPGSVY-
MF925371_HBSP_P-RF-DC      ENSYGSGPQPVSPGSVY-
MF925360_HBSP_P-RF-DB      ENSYGSGPQPVSPGSVY-
KX827299_HBSP_P-RF-DE      ENSYGGGPQPVSPGSVY-
KX357635_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KX357634_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KX357633_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KX357632_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KX357631_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KX357627_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KX357623_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KU736923_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KU736921_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KT366504_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KR905422_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KP995112_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KP168418_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KP168417_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KP168416_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KM606751_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KM606750_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KM577665_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KM524357_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KF471643_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KF170740_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JQ687532_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN642152_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN642141_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN642139_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN642137_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN257207_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN257206_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN257204_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN257189_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN257191_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KY470845_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KY470848_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KY470851_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KY470852_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
J02202_HBSP_P-RF-DE        ENSYGSGPQPVSLGSVY-
FJ349207_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KX660689_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KU964367_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KP288875_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HM750147_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
HM750148_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774482_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
FJ562263_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KT991424_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KT991427_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KX357641_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KU711666_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVH-
JN257154_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
GQ161806_HBSP_P-RF-EA      ENSYGSGPQXVSPGSVY-
FN594771_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVH-
FN594767_HBSP_P-RF-DE      ENSYGSGPQPVSXXSVY-
FJ904430_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
MF618346_HBSP_P-RF-DE      QNSYGSGPQSVSLGSVY-
KU964366_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KU964370_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KU964372_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KU964374_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KU964379_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KU964380_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KJ647356_HBSP_P-RF-DE      EISYGSGPQPVSLGSVY-
KF192833_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KF192835_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KF192836_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KF192837_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KF192838_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KF192839_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KF192841_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
MF618347_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KC774458_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
JF491455_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774450_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
JF491448_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
HQ700503_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700536_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700494_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
GQ161754_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904442_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904437_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
DQ478889_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
AY817512_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
AY817513_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
DQ478898_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
EU787435_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774428_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774430_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774468_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774492_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774494_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
AB033559_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
AB048702_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
AB048703_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
FJ692536_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700492_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700493_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700497_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700500_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700501_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700524_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700525_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700534_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700535_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700537_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700538_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700539_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700540_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVYW
HQ700541_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700579_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700581_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700582_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700583_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700584_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
HQ700585_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KF779353_HBSP_P-RF-DA      ENSYGSGPQPVSLGSVY-
MH481858_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
MH481860_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
MH481861_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
MH481862_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
MH481859_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
JX429898_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774434_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774463_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774472_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774489_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774497_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774499_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KP276254_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KP276255_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
AY057948_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
AY817511_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
DQ478890_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
FJ349241_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
HM750142_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
HM750143_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
HM750145_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
HM750146_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
HM750149_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
HM750150_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774456_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774485_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KP276253_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KP276256_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KX354997_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KX660686_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
DQ991753_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904407_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
AB674432_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
AB674433_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904444_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JF754616_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN257164_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN257174_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KY629632_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
EU594436_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904405_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
AB674436_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
AM494716_HBSP_P-RF-DE      ETSYGCGPQPVSPGSVY-
FJ904394_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904403_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904404_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904406_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904425_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904428_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904436_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904440_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904398_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904416_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904417_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KY470854_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KX660680_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
AB270535_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
AB674504_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
AY800249_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
AY817509_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
AY817510_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
AY817515_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
AY862864_HBSP_P-RF-DC      ENSYGRGPQPVSLGSVY-
AY862865_HBSP_P-RF-DC      ENSYGRGPQPVSLGSVY-
AY862866_HBSP_P-RF-DC      ENSYGRGPQPVSLGSVY-
DQ478886_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
DQ478887_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
DQ478892_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
DQ478897_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
EU787434_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
FJ562278_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
JF491449_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
JF491451_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774420_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774422_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774423_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774424_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774425_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774426_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774432_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774433_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774435_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774439_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774443_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774447_HBSP_P-RF-DC      ENSYGGGPQPVSLGSVY-
KC774448_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774452_HBSP_P-RF-DC      ENSYGGGPQPVSLGSVY-
KC774453_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774454_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774455_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774457_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774461_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774466_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774470_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774471_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774474_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774475_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774476_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774478_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774479_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774480_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774481_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774483_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774484_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774486_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774488_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774490_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774493_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774495_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KC774498_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KJ470884_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KJ470886_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KY470856_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KY470855_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KY470850_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KY470849_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KY470847_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KY470846_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KY470843_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KX660682_HBSP_P-RF-DC      ENSYGSGPQPVSLGSXY-
KX660677_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KX660675_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KX660674_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KU736917_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KU736915_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KU736914_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KU519423_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KU519422_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KT991423_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KT991421_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KT991420_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KT991419_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KT991417_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
KP168421_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KP168420_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KJ470897_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KJ470892_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KJ470891_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KJ470890_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KJ470887_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KJ470888_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
FJ904400_HBSP_P-RF-DE      ENSYGSGPQPVSLGSVY-
KC774449_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
FN594769_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KM606741_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
AB674412_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KY670781_HBSP_P-RF-DC      ENSYGSGPQPVSLGSVY-
FJ904447_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904396_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
FJ904441_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JF754613_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
JN040803_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
KX357628_HBSP_P-RF-DE      ENSYGSGPQPVSPGSVY-
                              :   .* **      

© 1998-2019