HBVdb

Dataset for protein HBe of genotype RF

[Download (right click)] [Edit] [Sequences] [Repertoires]

649 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


MH481862_HBe_P-RF-DE      IQLFHLCLIIYVASCPTVQASKLCLGWLWGMDSDPYKEFGATMELLSFLP
FJ904425_HBe_P-RF-DE      IQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVQLLSFLP
MK052969_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MF488699_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDLDPYKEFGATVELLSFLP
AB674434_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KJ647351_HBe_P-RF-DE      IQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLP
KX357632_HBe_P-RF-DE      LQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVQLLSFLP
FN594767_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLP
HE981179_HBe_P-RF-FG      MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HE981180_HBe_P-RF-GF      MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ586803_HBe_P-RF-AF      MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ803788_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVEIPFFLP
FJ904409_HBe_P-RF-DE      LQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
HM146131_HBe_P-RF-AD      MQLFHLCLIV-SCTCPTSQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY161140_HBe_P-RF-AD      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPHKEFGATVELLSFLP
AY161141_HBe_P-RF-AD      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPHKEIGATVELLSFLP
MF488702_HBe_P-RF-DE      MRLFHLCLII-SCACPTVQASKLCLRWIWGMDIDTYKEFGATVEILSFLS
KJ803785_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLP
HQ700520_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLP
EU589339_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDINTYKEFGASVELLSFLP
AB453985_HBe_P-RF-AC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELISFLP
AY206374_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLSFLP
KU679945_HBe_P-RF-CB      XQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLSFLP
FJ562336_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF873538_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLP
AB367419_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLP
GQ377613_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLP
EU881995_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLP
KC774482_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLP
KC774487_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLP
KC774492_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLP
KC774497_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLP
FJ386643_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLP
AB014375_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLP
JN664935_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLP
KC774449_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774178_HBe_P-RF-BC      MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GU357843_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU871985_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY817512_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU787435_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLSFLP
EU871981_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU871983_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU871984_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU871986_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU871987_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU871988_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU871989_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU871990_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU871999_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JQ707714_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774442_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774453_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLP
KC774485_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700530_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700531_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700532_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700523_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HM750147_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU882006_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLP
GQ377633_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
Y18857_HBe_P-RF-CB        MQIFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KX660685_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLP
KU577083_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB493842_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
DQ478898_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU871992_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU871993_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU871995_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU871996_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU872014_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU872015_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU939589_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDVYKEFGASVELLSFLP
FJ715345_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ715346_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ715347_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377590_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLP
HM750142_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HM750148_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700485_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700557_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JF828933_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JF828934_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JF828935_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JF828936_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JF828938_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774364_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774454_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774461_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774463_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774479_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774484_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774494_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964006_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU679946_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKQCLEWLWGMDIDPYKEFGASVELLSFLP
AB367800_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB367400_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KY670781_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLSFLP
KJ803772_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF917451_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF873523_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLP
KF873543_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF873540_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLSFLP
KF873542_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377602_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF873530_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KP148337_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU679955_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLP
KJ803827_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU679954_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLSFLP
MF925389_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLP
KU695745_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU679940_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLXXMDIDPYKEFGASVELLSFLP
KU679943_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWXMDIDXYKEFGASVELLSFLP
KF873518_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF873519_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF873521_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF873522_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLP
KU679941_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU679956_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLP
EU939623_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLP
EF494378_HBe_P-RF-CA      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVQLLSFLP
KJ803822_HBe_P-RF-CB      MQLFHLLLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLP
MF925397_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU833891_HBe_P-RF-GC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ882613_HBe_P-RF-GC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ882612_HBe_P-RF-GC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ882617_HBe_P-RF-GC      MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLSFLP
FJ882618_HBe_P-RF-GC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ803804_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU939577_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY862865_HBe_P-RF-DC      MLLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MK052970_HBe_P-RF-BD      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MG893561_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MG826151_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JX661486_HBe_P-RF-CB      MQLFHLCLVI-SCSCPTVYWRELCLGWLWGMDIDPYKEFGASVELLSFLP
FJ562287_HBe_P-RF-CB      KQLFHLCLII-SCSSPTVQAFKVCLGGLWGMGLDPYKEFGAFGELLFFLP
JN104438_HBe_P-RF-CB      MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JN104442_HBe_P-RF-CB      MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ410506_HBe_P-RF-CB      MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KY470843_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLSFLP
KY470844_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLSFLP
KY470846_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLSFLP
KY470847_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLSFLP
KY470849_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLSFLP
KY470850_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLSFLP
KY470854_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLSFLP
KY470855_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLSFLP
KY470856_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLSFLP
KC774414_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JX661487_HBe_P-RF-CB      MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JX661498_HBe_P-RF-CB      MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU916239_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU916241_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU916232_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU916228_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFFA
EU871997_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY057948_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVEVLSFLP
AB493838_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ562263_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASXELLSFLP
KT991424_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KT991427_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ562229_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDTYKEFGASVELLSFLP
EU939581_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLP
JX026887_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLP
EU939627_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLSFLP
FJ349241_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ386633_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JN400086_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KY470853_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLSFLP
JX661485_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQGLQLCLGWLWGMDIDPYKEFGASVELLSFLP
JQ040148_HBe_P-RF-CB      MQIFHLCLII-SCSCPTVQASKLXLGWLWGMDIDPYKEFGASXELLSFLP
JF436923_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377611_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FR714496_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSILP
FJ882614_HBe_P-RF-GC      MXLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB367393_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AF461361_HBe_P-RF-CB      MHLSHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLP
FJ882610_HBe_P-RF-GC      MHLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JQ040146_HBe_P-RF-CB      MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JQ040174_HBe_P-RF-CB      MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JQ040175_HBe_P-RF-CB      MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
Y18856_HBe_P-RF-CB        MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLP
EU939629_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLP
MK052976_HBe_P-RF-BD      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MF925401_HBe_P-RF-DB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KX660689_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KX660684_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964010_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU695742_HBe_P-RF-CB      MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KT991420_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLP
KP148442_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVALLSFLP
KJ803802_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ803782_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ410520_HBe_P-RF-CB      MQLFHLGIII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ410497_HBe_P-RF-BC      MQLFHLCLII-SGSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLP
KJ173358_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGAFVELLSFLP
JQ040130_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLP
KJ803798_HBe_P-RF-CB      MQLLHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JF436919_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700526_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377516_HBe_P-RF-CB      RQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU939565_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY123424_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB031265_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB033557_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB105172_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB195939_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB195940_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB195941_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB195950_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB195951_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB195955_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB195956_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB195957_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB198084_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFMP
AB241109_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB493837_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB493840_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB493847_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB670303_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AB674504_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AP011102_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AP011103_HBe_P-RF-CB      MQLFHLCLII-SCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AP011104_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AP011105_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AP011108_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY040627_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY123041_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY167095_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY247030_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY800249_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY817510_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY817511_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY817513_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY817515_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY862864_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY862866_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
DQ144601_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
DQ478886_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLP
DQ478887_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
DQ478889_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
DQ478890_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
DQ478892_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
DQ478897_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU522070_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU787434_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU835240_HBe_P-RF-GC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU916240_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
EU939606_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ023659_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ023664_HBe_P-RF-GC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ023667_HBe_P-RF-GC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ023670_HBe_P-RF-GC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ023673_HBe_P-RF-GC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ386578_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ386585_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ386649_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ562302_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLP
FJ562305_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLP
FJ562314_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ715384_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ715385_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ715387_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ715411_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ715412_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ715413_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ715414_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ787446_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ787480_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FR714490_HBe_P-RF-GB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ358155_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ358156_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377520_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377534_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377539_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377544_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377548_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377549_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377560_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377564_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377565_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377573_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377581_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377594_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377595_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377596_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377614_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377626_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377630_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377634_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ377635_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
GQ924618_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HM750133_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HM750143_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HM750144_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKQCLGWLWGMDIDPYKEFGASVELLSFLP
HM750145_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HM750146_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HM750149_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HM750150_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700498_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700499_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700505_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700507_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700508_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700509_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700518_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700519_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700521_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700527_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700528_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700542_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700547_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
HQ700560_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JF491448_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JF491449_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JF491451_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JF491455_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JF491456_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JQ732168_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JQ801476_HBe_P-RF-CG      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ386581_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
FJ562278_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLP
KT991417_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLP
KT991419_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYEEFGASVELLSFLP
KT991423_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLP
MK052967_HBe_P-RF-BD      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSSLP
FJ882611_HBe_P-RF-GC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLSFLP
MH746813_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MG826145_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
M38454_HBe_P-RF-CB        MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KX660674_HBe_P-RF-DC      MQLFHLCLII-SCSCPTXQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KX660680_HBe_P-RF-DC      MQLFHLCLII-SCSCPTXQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF873533_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDXYKEFGASVELLSFLP
KX660682_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLP
X75656_HBe_P-RF-CB        MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MK321265_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MK052968_HBe_P-RF-BD      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MH746812_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MH746811_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MH094410_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MG893559_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MG893555_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MG893554_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MG826148_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MG826147_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MG826146_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MG826144_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
MF925370_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
LC458432_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
LC416040_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLP
LC279267_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
LC279266_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
LC279265_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
LC279264_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
LC279263_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KY881840_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KY470893_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGTSVELLSFLP
KY363263_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLP
KY363262_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLSFLP
KX660677_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLSFLP
KX660675_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KX354997_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964317_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964316_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964315_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964314_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964313_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964312_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964311_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964310_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964309_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964308_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964307_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964306_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964305_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964304_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964303_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964009_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964008_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964007_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964005_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964003_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU964001_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU963999_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU963998_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU963995_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU963994_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU963993_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU963991_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU963990_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU695746_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU695744_HBe_P-RF-CB      MQLFHLCLII-SCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU695743_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU695741_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU679953_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU679948_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLSFLP
KU679944_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU679942_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU679939_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU519423_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KU519422_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KT991421_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KT003704_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KR013816_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KP276256_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KP276255_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KP276254_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KP276253_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KP148352_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KM875422_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ803753_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLSFLP
KJ173350_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ173349_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ173330_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ173329_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ173326_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ173325_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ173322_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ173320_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ173300_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ173299_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ173280_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KJ173279_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF873534_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF873532_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF873531_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF873527_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF873524_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF873517_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF873515_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KF873513_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLSFLP
KF873511_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774499_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774495_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774490_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQAPKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774489_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774480_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774471_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774470_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774458_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774457_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774456_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774455_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774452_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774448_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774447_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774426_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774425_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774424_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774423_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774349_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774344_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774341_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774332_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774328_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774324_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774322_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774317_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774305_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774294_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774258_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774234_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774212_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774201_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774198_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774186_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC774183_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC315400_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
KC172106_HBe_P-RF-GB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JX661494_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JX429898_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JQ801477_HBe_P-RF-BC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JX429896_HBe_P-RF-CB      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
JF440017_HBe_P-RF-DA      MQLFXXCLII-SCSCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KF214656_HBe_P-RF-AC      MQLFPLCLII-SSSCPTLQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
X68292_HBe_P-RF-DA        MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MF925386_HBe_P-RF-AC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MF488705_HBe_P-RF-AD      MQLFHLRLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
EF494376_HBe_P-RF-CA      MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
GQ161806_HBe_P-RF-EA      MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AB194949_HBe_P-RF-AE      MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KJ586810_HBe_P-RF-AF      MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AY233277_HBe_P-RF-AC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLP
AY161147_HBe_P-RF-DA      MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AB222708_HBe_P-RF-AD      MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AB330368_HBe_P-RF-DA      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JN664933_HBe_P-RF-DA      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MF925404_HBe_P-RF-AC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AF297619_HBe_P-RF-DA      MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AF297620_HBe_P-RF-DA      MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
GQ331048_HBe_P-RF-AE      MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF440012_HBe_P-RF-DE      MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF440007_HBe_P-RF-DE      MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF439995_HBe_P-RF-DE      MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF439996_HBe_P-RF-DE      MQLFEEHELS-GRANPTVQASKPCLGWLWGMDIDPYKEFGATVELLSFLP
JF439998_HBe_P-RF-DE      MQLFEEHELS-GRANPTVQASKPCLGWLWGMDIDPYKEFGATVELLSFLP
JF440000_HBe_P-RF-DE      MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF440001_HBe_P-RF-DE      MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF440004_HBe_P-RF-DE      MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF440005_HBe_P-RF-DE      MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF440006_HBe_P-RF-DE      MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF440008_HBe_P-RF-DE      MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF440009_HBe_P-RF-DE      MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF440010_HBe_P-RF-DE      MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF440013_HBe_P-RF-DE      MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF440014_HBe_P-RF-DE      MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF440015_HBe_P-RF-DE      MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF440003_HBe_P-RF-DE      VQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF439999_HBe_P-RF-DE      MQFFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MF925360_HBe_P-RF-DB      MQLFHLCLII-FCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLP
KX827302_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATLELLSFLP
KX357628_HBe_P-RF-DE      IQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVQLLSFLP
FJ904440_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFLP
DQ464167_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JN664943_HBe_P-RF-DE      MELFHLCLII-FCSCPTVQVSKLCLGWLWGMDIDPYKEFGATVELLSFLP
GQ205377_HBe_P-RF-DE      MQLFDLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KC875338_HBe_P-RF-DE      MQLFDLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KC875339_HBe_P-RF-DE      MQLFDLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
GQ205378_HBe_P-RF-DE      MQLFDLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
GQ205379_HBe_P-RF-DE      MQLFDLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
GQ205387_HBe_P-RF-DE      MQLFDLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MF925396_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JN664929_HBe_P-RF-DE      MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
GQ161753_HBe_P-RF-AE      MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JN664915_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JN664925_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KM386676_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLP
KF192840_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDLDPYKEFGATVELLSFLP
KF192838_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLP
KF192835_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AM494716_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLSFLP
KM606750_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KM606751_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KP995112_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MH481858_HBe_P-RF-DE      AQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MH481859_HBe_P-RF-DE      MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MH481860_HBe_P-RF-DE      AQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MH481861_HBe_P-RF-DE      AQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
FJ692536_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KX357634_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
DQ315779_HBe_P-RF-DE      MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
DQ315780_HBe_P-RF-DE      MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JN664940_HBe_P-RF-DE      MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KT366505_HBe_P-RF-DE      MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KF192833_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KF192837_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDLDPYKEFGATVELLSFLP
KF192839_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDLDPYKEFGATVELLSFLP
KF192841_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDLDPYKEFGATVELLSFLP
MF618346_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MF618347_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDLDPYKEFGATVELLSFLP
KU668440_HBe_P-RF-DE      MQLFHLCLEF-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
HQ700582_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AB048702_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KJ470888_HBe_P-RF-DE      RQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KJ470887_HBe_P-RF-DE      RQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KJ470886_HBe_P-RF-DE      RQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KJ470884_HBe_P-RF-DE      RQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
HQ700538_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AB033559_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
HQ700497_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
HQ700501_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
HQ700503_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
HQ700524_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
HQ700525_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
HQ700584_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
HQ700583_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
HQ700581_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
HQ700535_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLSFLP
HQ700537_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLSFLP
HQ700541_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KJ470890_HBe_P-RF-DE      RQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JN257216_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AY233293_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AY161145_HBe_P-RF-AD      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AY161146_HBe_P-RF-AD      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
GQ377627_HBe_P-RF-CD      LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JN257174_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGATVELLSFLP
FN594771_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KU736921_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KU736922_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JN257191_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLSFLP
EU185780_HBe_P-RF-AD      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KC012653_HBe_P-RF-AD      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MF925392_HBe_P-RF-DB      MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KC774450_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF440011_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
GQ161837_HBe_P-RF-AE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSVLP
FN594770_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLSFLP
EU594435_HBe_P-RF-DE      MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
EF103282_HBe_P-RF-AD      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
DQ315777_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KM524336_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KM524337_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MH464846_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MH464851_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MH464852_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AJ344117_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AY233295_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AY236161_HBe_P-RF-DA      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
GU563560_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JF440002_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JX898686_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JX898687_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JX898688_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JX898690_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JX898693_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JX898695_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JX898696_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JX898698_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JX898699_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KM524357_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KR905422_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KT366503_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KT366504_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MF925371_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MF967563_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
U95551_HBe_P-RF-DE        MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KU736916_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KX357630_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MH685719_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
JQ687532_HBe_P-RF-DE      MQFFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
EF103285_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
GQ161754_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AB583679_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
AY373430_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
DQ111987_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
EU594406_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
EU594436_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
X80925_HBe_P-RF-DE        MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
MF925388_HBe_P-RF-DC      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
LK995391_HBe_P-RF-ED      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KX827299_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KX357623_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KU736923_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KU736917_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KU736914_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KT366492_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KP168418_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KP168417_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KP168416_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KM577664_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KM577663_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KM524359_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
KF170740_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
GU177079_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
GQ183486_HBe_P-RF-DE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
GQ161838_HBe_P-RF-AE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
HF571060_HBe_P-RF-AE      MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLP
                            :          : .     :  *  :  *. : ::*:*:   :   :.

MH481862_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
FJ904425_HBe_P-RF-DE      SDFYPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
MK052969_HBe_P-RF-DE      SDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLAT
MF488699_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSSHHTALRQSVLCWRELMTLAT
AB674434_HBe_P-RF-DE      TDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLAT
KJ647351_HBe_P-RF-DE      TDFYPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGDLMNLAT
KX357632_HBe_P-RF-DE      SDFFPSVRDLLDTAAALFRDALESPEHCSPHHTALRQAILCWGDLMTLAT
FN594767_HBe_P-RF-DE      HDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAIVCWGNIMTLAT
HE981179_HBe_P-RF-FG      SDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLAS
HE981180_HBe_P-RF-GF      SDFFPSVRDLLDTASALYRDALESPEHCTPSHTALRQAILCWGELMTLAS
KJ586803_HBe_P-RF-AF      SDFFPSVRDLLDTASALYRDALESPEHCTPNHTAFRQAILCWGELMTLAS
KJ803788_HBe_P-RF-CB      SDFFPSIRDLLYTTSVLYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ904409_HBe_P-RF-DE      HDFFPSVRDLLDTATALFRDALESPEHCSPHHTALRQAILCWGDVMNIAT
HM146131_HBe_P-RF-AD      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGT
AY161140_HBe_P-RF-AD      SDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
AY161141_HBe_P-RF-AD      SDFFPSARDLLDTASALYREGLESPEHCSPHHTALRQAILCWGELMTLAT
MF488702_HBe_P-RF-DE      PDFFPSLRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KJ803785_HBe_P-RF-CB      SDFFPSIRDLLDTASALCRDALESPEHVSAHHTALRQAILCWGELMNLAT
HQ700520_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAVLCWGELMNLAT
EU589339_HBe_P-RF-CB      SDFFPSIRDLLDTATALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
AB453985_HBe_P-RF-AC      PDFFPSIRDLLDTASALYREALESSEHCSAHHTALRQAILCWGELMTLAN
AY206374_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU679945_HBe_P-RF-CB      SDFFPSIRDLLDTALALYRDALESPEXCSAHHTALRQAIVCWGELMNLAT
FJ562336_HBe_P-RF-CB      SDFFPSVRDLVDTATALYREALESPEHCSPHHTALRQAIVCWGELTNLAT
KF873538_HBe_P-RF-CB      SDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLAT
AB367419_HBe_P-RF-CB      SDFFPSIRDLLDTAAALYREALESPEHCTPHHTALRQAILCWGELMNLAT
GQ377613_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU881995_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774482_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774487_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774492_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774497_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386643_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
AB014375_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
JN664935_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774449_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRNAIVCWGELMNLAT
KC774178_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GU357843_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871985_HBe_P-RF-CB      SDFFPSIRDLLDTASALCREALESPEHCSPHHTALRQAILCWGELMNLAT
AY817512_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU787435_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871981_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871983_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871984_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871986_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871987_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871988_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871989_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871990_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871999_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ707714_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774442_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774453_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774485_HBe_P-RF-DC      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HQ700530_HBe_P-RF-CB      SDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700531_HBe_P-RF-CB      SDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700532_HBe_P-RF-CB      SDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700523_HBe_P-RF-CB      SDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMNLAT
HM750147_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU882006_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377633_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
Y18857_HBe_P-RF-CB        ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX660685_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU577083_HBe_P-RF-BC      SDFFPSIRELLDTASALYRDALESPEHCSPHHTALRQAILCWVELMSLAT
AB493842_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
DQ478898_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871992_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871993_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871995_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU871996_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU872014_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU872015_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939589_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715345_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTAVRQAILCWGELMNLAT
FJ715346_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTAVRQAILCWGELMNLAT
FJ715347_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTAVRQAILCWGELMNLAT
GQ377590_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750142_HBe_P-RF-DC      SDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750148_HBe_P-RF-DC      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HQ700485_HBe_P-RF-CB      SDFFPSIRDLLDTAXALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700557_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
JF828933_HBe_P-RF-CB      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828934_HBe_P-RF-CB      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828935_HBe_P-RF-CB      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828936_HBe_P-RF-CB      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF828938_HBe_P-RF-CB      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774364_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774454_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774461_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774463_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774479_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774484_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774494_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964006_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU679946_HBe_P-RF-BC      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB367800_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLAT
AB367400_HBe_P-RF-CB      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY670781_HBe_P-RF-DC      SDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
KJ803772_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF917451_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873523_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQXILCWGELMNLAT
KF873543_HBe_P-RF-CB      SDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLAT
KF873540_HBe_P-RF-CB      SDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAXLCWGELMNLAT
KF873542_HBe_P-RF-CB      SDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377602_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873530_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESAEHCSPHHTALRQAVLCWGELMNLAT
KP148337_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU679955_HBe_P-RF-CB      XDFFPSIRDLLDTAAALYREALESPEHCSAHHTALRQAILCWGELMNLAT
KJ803827_HBe_P-RF-BC      SDFFPSIRDLLDTATALYREALESPEHCSPHHTAIRQAVLCWGELMNLAT
KU679954_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF925389_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU695745_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMNLAT
KU679940_HBe_P-RF-CB      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU679943_HBe_P-RF-BC      SDFFPSIRDLLDTAXALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873518_HBe_P-RF-CB      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873519_HBe_P-RF-CB      SDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873521_HBe_P-RF-BC      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873522_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU679941_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU679956_HBe_P-RF-CB      XDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELMNLAT
EU939623_HBe_P-RF-CB      SDFFPNIRDLLDTASALYREALESPEHCSPHHTAIRQAIVCWGELMNLAT
EF494378_HBe_P-RF-CA      SDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQTILCWGELVNLAT
KJ803822_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
MF925397_HBe_P-RF-DC      SDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
EU833891_HBe_P-RF-GC      SDFSPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
FJ882613_HBe_P-RF-GC      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
FJ882612_HBe_P-RF-GC      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
FJ882617_HBe_P-RF-GC      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
FJ882618_HBe_P-RF-GC      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
KJ803804_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMNLAT
EU939577_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY862865_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MK052970_HBe_P-RF-BD      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG893561_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG826151_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX661486_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562287_HBe_P-RF-CB      FDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN104438_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN104442_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ410506_HBe_P-RF-CB      SDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470843_HBe_P-RF-DC      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
KY470844_HBe_P-RF-DC      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
KY470846_HBe_P-RF-DC      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
KY470847_HBe_P-RF-DC      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
KY470849_HBe_P-RF-DC      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
KY470850_HBe_P-RF-DC      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
KY470854_HBe_P-RF-DC      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
KY470855_HBe_P-RF-DC      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
KY470856_HBe_P-RF-DC      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
KC774414_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
JX661487_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX661498_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU916239_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU916241_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU916232_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU916228_HBe_P-RF-CB      SDLFPSVRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
EU871997_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY057948_HBe_P-RF-DC      SDFFPSNRDLLDTASALDREALESPEHCSPHHTALRQAILCWGELMNLAT
AB493838_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
FJ562263_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT991424_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT991427_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562229_HBe_P-RF-CB      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
EU939581_HBe_P-RF-CB      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
JX026887_HBe_P-RF-CB      SDFFPSIRDLLDTATALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
EU939627_HBe_P-RF-BC      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
FJ349241_HBe_P-RF-DC      SDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
FJ386633_HBe_P-RF-CB      SDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JN400086_HBe_P-RF-CB      SDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470853_HBe_P-RF-DC      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
JX661485_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040148_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF436923_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELVNLAT
GQ377611_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FR714496_HBe_P-RF-CB      SDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
FJ882614_HBe_P-RF-GC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
AB367393_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AF461361_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRHAILCWGELMNLAT
FJ882610_HBe_P-RF-GC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
JQ040146_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040174_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040175_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
Y18856_HBe_P-RF-CB        SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939629_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MK052976_HBe_P-RF-BD      SDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLAT
MF925401_HBe_P-RF-DB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWAELMNLAT
KX660689_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX660684_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964010_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHGSPHHTALRQAILCWGELMNLAT
KU695742_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
KT991420_HBe_P-RF-DC      SDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148442_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
KJ803802_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ803782_HBe_P-RF-CB      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGEVMNLAT
KJ410520_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ410497_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPQHTALRQAIVCWGELMNLAT
KJ173358_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ040130_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
KJ803798_HBe_P-RF-CB      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGEVMNLAT
JF436919_HBe_P-RF-CB      SDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
HQ700526_HBe_P-RF-CB      SDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377516_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939565_HBe_P-RF-CB      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGEXMNLAT
AY123424_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNPAT
AB031265_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB033557_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB105172_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
AB195939_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB195940_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB195941_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB195950_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB195951_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB195955_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB195956_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB195957_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB198084_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB241109_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AB493837_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
AB493840_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
AB493847_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
AB670303_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
AB674504_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AP011102_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
AP011103_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
AP011104_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AP011105_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AP011108_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY040627_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY123041_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY167095_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY247030_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY800249_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY817510_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY817511_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY817513_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY817515_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY862864_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
AY862866_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ144601_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ478886_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ478887_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ478889_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ478890_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ478892_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
DQ478897_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU522070_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
EU787434_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU835240_HBe_P-RF-GC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU916240_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
EU939606_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ023659_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAFLCWGELMTLAT
FJ023664_HBe_P-RF-GC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
FJ023667_HBe_P-RF-GC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
FJ023670_HBe_P-RF-GC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
FJ023673_HBe_P-RF-GC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
FJ386578_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386585_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386649_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562302_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562305_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562314_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715384_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715385_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715387_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715411_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715412_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715413_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ715414_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787446_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ787480_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FR714490_HBe_P-RF-GB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
GQ358155_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
GQ358156_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
GQ377520_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377534_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377539_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377544_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377548_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377549_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377560_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377564_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377565_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377573_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377581_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377594_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377595_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377596_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377614_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377626_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377630_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377634_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ377635_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
GQ924618_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750133_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750143_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750144_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750145_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750146_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750149_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HM750150_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HQ700498_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700499_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700505_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HQ700507_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HQ700508_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HQ700509_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700518_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700519_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700521_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HQ700527_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700528_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700542_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
HQ700547_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
HQ700560_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
JF491448_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF491449_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF491451_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF491455_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF491456_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ732168_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801476_HBe_P-RF-CG      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ386581_HBe_P-RF-CB      SDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ562278_HBe_P-RF-DC      SDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT991417_HBe_P-RF-DC      SDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT991419_HBe_P-RF-DC      SDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT991423_HBe_P-RF-DC      SDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MK052967_HBe_P-RF-BD      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
FJ882611_HBe_P-RF-GC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
MH746813_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
MG826145_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
M38454_HBe_P-RF-CB        SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWRELMNLAT
KX660674_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX660680_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873533_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALEXPEHCSPHHTALRQAILXWGELMNLAT
KX660682_HBe_P-RF-DC      SDFFPSIRDLXDTASALYREALEXPEHCSPHHTALRQAIXCWGELMNLAT
X75656_HBe_P-RF-CB        SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
MK321265_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MK052968_HBe_P-RF-BD      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MH746812_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
MH746811_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
MH094410_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG893559_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG893555_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG893554_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG826148_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG826147_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG826146_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MG826144_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
MF925370_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC458432_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC416040_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279267_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279266_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279265_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279264_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
LC279263_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY881840_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY470893_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY363263_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KY363262_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX660677_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX660675_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KX354997_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964317_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964316_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964315_HBe_P-RF-CB      ADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964314_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964313_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964312_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964311_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964310_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964309_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964308_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964307_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964306_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964305_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964304_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964303_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964009_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964008_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964007_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964005_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964003_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU964001_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963999_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963998_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963995_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963994_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963993_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963991_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU963990_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU695746_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
KU695744_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
KU695743_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
KU695741_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
KU679953_HBe_P-RF-BC      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU679948_HBe_P-RF-CB      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU679944_HBe_P-RF-BC      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU679942_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU679939_HBe_P-RF-CB      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU519423_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KU519422_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT991421_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KT003704_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KR013816_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP276256_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP276255_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP276254_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP276253_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KP148352_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KM875422_HBe_P-RF-CB      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILSWGELMNLAT
KJ803753_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173350_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173349_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173330_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173329_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173326_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173325_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173322_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173320_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173300_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173299_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KJ173280_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALKSPEHCSPHHTALRQAILCWGELMNLAT
KJ173279_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873534_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873532_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873531_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873527_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873524_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873517_HBe_P-RF-BC      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873515_HBe_P-RF-CB      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873513_HBe_P-RF-CB      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KF873511_HBe_P-RF-CB      SDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774499_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774495_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774490_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774489_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774480_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774471_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774470_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774458_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774457_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774456_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774455_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774452_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774448_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774447_HBe_P-RF-DC      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
KC774426_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774425_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774424_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774423_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774349_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774344_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774341_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774332_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774328_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774324_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774322_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774317_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774305_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774294_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774258_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774234_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774212_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774201_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774198_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774186_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC774183_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC315400_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
KC172106_HBe_P-RF-GB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
JX661494_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX429898_HBe_P-RF-DC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JQ801477_HBe_P-RF-BC      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JX429896_HBe_P-RF-CB      SDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
JF440017_HBe_P-RF-DA      SDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQDILCWGELMTLAT
KF214656_HBe_P-RF-AC      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
X68292_HBe_P-RF-DA        SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAS
MF925386_HBe_P-RF-AC      SDFFPSVGDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
MF488705_HBe_P-RF-AD      SDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
EF494376_HBe_P-RF-CA      SDFFPSVRDLLDTASALYREALESPEHRSPHHTALRQAILCWGELMTLAT
GQ161806_HBe_P-RF-EA      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
AB194949_HBe_P-RF-AE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMTLAT
KJ586810_HBe_P-RF-AF      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
AY233277_HBe_P-RF-AC      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
AY161147_HBe_P-RF-DA      SDFFPSDRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
AB222708_HBe_P-RF-AD      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
AB330368_HBe_P-RF-DA      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JN664933_HBe_P-RF-DA      PDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAVLCWVELMTLAT
MF925404_HBe_P-RF-AC      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
AF297619_HBe_P-RF-DA      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
AF297620_HBe_P-RF-DA      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
GQ331048_HBe_P-RF-AE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF440012_HBe_P-RF-DE      TDFFPSVRDLLDTASALYREALEPPEHWSPHHTALRQAILCWGELMTLAT
JF440007_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF439995_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF439996_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF439998_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF440000_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF440001_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF440004_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF440005_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF440006_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF440008_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF440009_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF440010_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF440013_HBe_P-RF-DE      TDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF440014_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF440015_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF440003_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF439999_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
MF925360_HBe_P-RF-DB      ADFFPSVRALLDTASALYREALESPEHCSSHHTALRQAILCWGELMNLAT
KX827302_HBe_P-RF-DE      SDFYPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KX357628_HBe_P-RF-DE      ADFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGDVLSLAT
FJ904440_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLAT
DQ464167_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JN664943_HBe_P-RF-DE      TDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
GQ205377_HBe_P-RF-DE      SDFFPSVRDFLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KC875338_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KC875339_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
GQ205378_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTFAT
GQ205379_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
GQ205387_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
MF925396_HBe_P-RF-DC      TDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
JN664929_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLITLST
GQ161753_HBe_P-RF-AE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JN664915_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTFAT
JN664925_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTFAT
KM386676_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
KF192840_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
KF192838_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
KF192835_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
AM494716_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KM606750_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KM606751_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KP995112_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
MH481858_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
MH481859_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
MH481860_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
MH481861_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
FJ692536_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KX357634_HBe_P-RF-DE      SDFFPSVRALLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
DQ315779_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
DQ315780_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESSEHCSPHHTALRQAILCWGELMTLAT
JN664940_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KT366505_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KF192833_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
KF192837_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
KF192839_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
KF192841_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
MF618346_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
MF618347_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
KU668440_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
HQ700582_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
AB048702_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
KJ470888_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KJ470887_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KJ470886_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KJ470884_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
HQ700538_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
AB033559_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
HQ700497_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
HQ700501_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
HQ700503_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
HQ700524_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
HQ700525_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
HQ700584_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
HQ700583_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
HQ700581_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
HQ700535_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGXLMTLAT
HQ700537_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGXLMTLAT
HQ700541_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KJ470890_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
JN257216_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
AY233293_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
AY161145_HBe_P-RF-AD      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
AY161146_HBe_P-RF-AD      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
GQ377627_HBe_P-RF-CD      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JN257174_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIQCWGXLMTLAT
FN594771_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGEFTSHST
KU736921_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALXSPEHCSPHHTALRQAILCWGELMTLAT
KU736922_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
JN257191_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
EU185780_HBe_P-RF-AD      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
KC012653_HBe_P-RF-AD      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
MF925392_HBe_P-RF-DB      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
KC774450_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF440011_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
GQ161837_HBe_P-RF-AE      FGFFPSVRDXLDTASXLYRDALESXEHCSPHHTALRQAILCWGELMTLAT
FN594770_HBe_P-RF-DE      SDFFPSVRDLLDTASALFRDALESPEHCSPHHTAFRQAILCWGELMTLAT
EU594435_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
EF103282_HBe_P-RF-AD      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
DQ315777_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
KM524336_HBe_P-RF-DE      SDFFPSVRDLLDTASAVYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
KM524337_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
MH464846_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
MH464851_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
MH464852_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
AJ344117_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
AY233295_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRRAILCWGELMTLAT
AY236161_HBe_P-RF-DA      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
GU563560_HBe_P-RF-DE      SDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JF440002_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JX898686_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JX898687_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JX898688_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JX898690_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JX898693_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JX898695_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JX898696_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JX898698_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
JX898699_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
KM524357_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
KR905422_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
KT366503_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
KT366504_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
MF925371_HBe_P-RF-DC      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
MF967563_HBe_P-RF-DE      SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
U95551_HBe_P-RF-DE        SDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
KU736916_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMSLAT
KX357630_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
MH685719_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
JQ687532_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
EF103285_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
GQ161754_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
AB583679_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
AY373430_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
DQ111987_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
EU594406_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
EU594436_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
X80925_HBe_P-RF-DE        SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
MF925388_HBe_P-RF-DC      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
LK995391_HBe_P-RF-ED      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KX827299_HBe_P-RF-DE      SDFFPSVRHLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KX357623_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KU736923_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KU736917_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KU736914_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KT366492_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KP168418_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KP168417_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KP168416_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KM577664_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KM577663_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KM524359_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
KF170740_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMTLAT
GU177079_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
GQ183486_HBe_P-RF-DE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
GQ161838_HBe_P-RF-AE      SDFFPSVRDXLDTASXLYRDXLESXXHXSPHHTALRQAILCWGELMTLAT
HF571060_HBe_P-RF-AE      SDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
                           .: *       *:  : *: *      :  ***.*.    *    . ..

MH481862_HBe_P-RF-DE      WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLV
FJ904425_HBe_P-RF-DE      WVGSNL-DPVSRDLVVSYVNDNMGLKFRQILWFHISCLTFGRETVIEYLV
MK052969_HBe_P-RF-DE      WVGANL-DPVSRDLVVSYVNTNMGLKFRQLLRFHYSCLTFGRDTVLNYLV
MF488699_HBe_P-RF-DE      WVGTNLEDPASRDLVVSYVDTNMGLKFRQLLWFHISCLTFGRDTFLEYLV
AB674434_HBe_P-RF-DE      WVGGNLEDPTSRDLVVSYVNTHMGLKLRQLLWFHISCLTFGRETVLEYLV
KJ647351_HBe_P-RF-DE      WVGANLEDPASRDLVVSYVNTNIALKFRQLXWFHVSCLTFGRETVIEYLV
KX357632_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGREIVLEYLV
FN594767_HBe_P-RF-DE      WVGVNLEDQASRDLLVSYVNTXMGLKFRQLLWFHISCLTFGRQIVIEYLV
HE981179_HBe_P-RF-FG      WVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
HE981180_HBe_P-RF-GF      WVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ586803_HBe_P-RF-AF      WGGNNLEDPAARDLVVNYVNTNMGLKIRQLLGFHISSLTFGRETVFEYLV
KJ803788_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ904409_HBe_P-RF-DE      WVGVNLQDQASRDQVVNYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLV
HM146131_HBe_P-RF-AD      WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY161140_HBe_P-RF-AD      WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
AY161141_HBe_P-RF-AD      WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
MF488702_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
KJ803785_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700520_HBe_P-RF-CB      WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHLSCLMFGRETVLEFLV
EU589339_HBe_P-RF-CB      WVGSNLEDPASGELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB453985_HBe_P-RF-AC      WVGNNLQDPASRDLVVNYVNTNMGLKLRQILWFHVSCLTFGRETVLEYLV
AY206374_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRDTVIEYLV
KU679945_HBe_P-RF-CB      WVGSNLEDQASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ562336_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873538_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB367419_HBe_P-RF-CB      WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHLSCLMFGRETVLEYLV
GQ377613_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU881995_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774482_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774487_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774492_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774497_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ386643_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB014375_HBe_P-RF-CB      WVGSNLEDPASREAVVSYVNVNMGLKLRQILWFHVSCLTFGRDTVLEYLV
JN664935_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
KC774449_HBe_P-RF-DC      WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774178_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
GU357843_HBe_P-RF-CB      WVGNNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
EU871985_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
AY817512_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU787435_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHVSCLTFGRETVLEYLV
EU871981_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
EU871983_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
EU871984_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
EU871986_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
EU871987_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
EU871988_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
EU871989_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
EU871990_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
EU871999_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
JQ707714_HBe_P-RF-CB      WVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLV
KC774442_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
KC774453_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
KC774485_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
HQ700530_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700531_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700532_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700523_HBe_P-RF-CB      WVGSNLEDPASRELXVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HM750147_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU882006_HBe_P-RF-CB      WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
GQ377633_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
Y18857_HBe_P-RF-CB        WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KX660685_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLV
KU577083_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB493842_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
DQ478898_HBe_P-RF-DC      WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
EU871992_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
EU871993_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
EU871995_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
EU871996_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
EU872014_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
EU872015_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
EU939589_HBe_P-RF-CB      WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
FJ715345_HBe_P-RF-CB      WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ715346_HBe_P-RF-CB      WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ715347_HBe_P-RF-CB      WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377590_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HM750142_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HM750148_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700485_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700557_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLV
JF828933_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JF828934_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JF828935_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JF828936_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JF828938_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774364_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
KC774454_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774461_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774463_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774479_HBe_P-RF-DC      WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774484_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774494_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964006_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFLISCLTFGRETVLEYLV
KU679946_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB367800_HBe_P-RF-CB      WVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB367400_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KY670781_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKITQLLWFHISCLTFGRETVLEYLV
KJ803772_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF917451_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873523_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873543_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873540_HBe_P-RF-CB      WVGSNLEDPASRELVXSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873542_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377602_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873530_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLV
KP148337_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU679955_HBe_P-RF-CB      WVGSNLEDXASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
KJ803827_HBe_P-RF-BC      WVGSNLEDPASRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLV
KU679954_HBe_P-RF-CB      WVGSNLEDPASRELVVXYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLV
MF925389_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU695745_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNINMGLKLRQILWFHVSCLTFGRETVLEYLV
KU679940_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQXLWFHISCLTFGXXTVLEYLV
KU679943_HBe_P-RF-BC      WVGSNLEDPASRELVVXYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873518_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873519_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873521_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873522_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU679941_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU679956_HBe_P-RF-CB      WVGSNLEDPASRELVVXYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLV
EU939623_HBe_P-RF-CB      WVGGNLDDPASRELIVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLV
EF494378_HBe_P-RF-CA      WVGSNLDDPASRELVVGYVNGNMGLKIRHLLWFHISCLTFGRETVLEYLV
KJ803822_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MF925397_HBe_P-RF-DC      WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLV
EU833891_HBe_P-RF-GC      WVGSNLDDPGSRDLVVTYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLV
FJ882613_HBe_P-RF-GC      WVGSNLEDPSSRDLVVTYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLV
FJ882612_HBe_P-RF-GC      WVGSNLXDPGSRDLVVTYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLV
FJ882617_HBe_P-RF-GC      WVGSNLEDPGSRDLVVTYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ882618_HBe_P-RF-GC      WVGSNLEDPGSRDLVVTYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLV
KJ803804_HBe_P-RF-CB      WVGSNLEDPASREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVPEYLV
EU939577_HBe_P-RF-CB      WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLV
AY862865_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MK052970_HBe_P-RF-BD      WVGSNLEDPASRKLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLKYLV
MG893561_HBe_P-RF-CB      WVGSNLEDPASGKLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MG826151_HBe_P-RF-BC      WVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JX661486_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ562287_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JN104438_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JN104442_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ410506_HBe_P-RF-CB      WVGSNLEDPASRELVVRYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KY470843_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KY470844_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KY470846_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KY470847_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KY470849_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KY470850_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KY470854_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KY470855_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KY470856_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774414_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JX661487_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JX661498_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU916239_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVDVNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU916241_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVDVNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU916232_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU916228_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU871997_HBe_P-RF-CB      WVASNLEGPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY057948_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB493838_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLGFHISCLTFGRETVLEYLV
FJ562263_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRGTVLEYLV
KT991424_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRGTVLEYLV
KT991427_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRGTVLEYLV
FJ562229_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU939581_HBe_P-RF-CB      WVGSNLEDPASRELVVNYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
JX026887_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU939627_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKIXQLLWFHISCLTFGRETVLEYLV
FJ349241_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ386633_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLV
JN400086_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KY470853_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JX661485_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ040148_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JF436923_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKTRQLLWFHISCLTFGRETVLEYLV
GQ377611_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FR714496_HBe_P-RF-CB      WVGSNLEDPASRDLVVRYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ882614_HBe_P-RF-GC      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB367393_HBe_P-RF-CB      WVGSNLEDQASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
AF461361_HBe_P-RF-CB      WVGSNLEDQASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
FJ882610_HBe_P-RF-GC      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ040146_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ040174_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ040175_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
Y18856_HBe_P-RF-CB        WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLAFGRETVLEYLV
EU939629_HBe_P-RF-BC      WVGTNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
MK052976_HBe_P-RF-BD      WVGTNLEDPASRDLIVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLV
MF925401_HBe_P-RF-DB      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLV
KX660689_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KX660684_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964010_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU695742_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KT991420_HBe_P-RF-DC      WVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KP148442_HBe_P-RF-BC      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ803802_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ803782_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ410520_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ410497_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ173358_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ040130_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNXNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ803798_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNGNMGLKIRQLLWFHISCLTFGRETVLEYLV
JF436919_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700526_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377516_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU939565_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY123424_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB031265_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB033557_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB105172_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB195939_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB195940_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB195941_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB195950_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB195951_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB195955_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB195956_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB195957_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB198084_HBe_P-RF-CB      WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
AB241109_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB493837_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB493840_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB493847_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB670303_HBe_P-RF-CB      WVGSNLEDPASRELVVXYXNVNMGLKXRQLLWFHISCLTFGRETVLEYLV
AB674504_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AP011102_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AP011103_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AP011104_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AP011105_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AP011108_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY040627_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY123041_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY167095_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY247030_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY800249_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY817510_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY817511_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY817513_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLV
AY817515_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY862864_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRKTVLEYLV
AY862866_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
DQ144601_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
DQ478886_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
DQ478887_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
DQ478889_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
DQ478890_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
DQ478892_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
DQ478897_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU522070_HBe_P-RF-CB      WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
EU787434_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU835240_HBe_P-RF-GC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
EU916240_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFERETVLEYLV
EU939606_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRKTVLEYLV
FJ023659_HBe_P-RF-BC      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ023664_HBe_P-RF-GC      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ023667_HBe_P-RF-GC      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ023670_HBe_P-RF-GC      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ023673_HBe_P-RF-GC      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ386578_HBe_P-RF-CB      WVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ386585_HBe_P-RF-CB      WVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ386649_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ562302_HBe_P-RF-CB      WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
FJ562305_HBe_P-RF-CB      WVGSNLEDQASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
FJ562314_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ715384_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ715385_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ715387_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWLHISCLTFGRETVLEYLV
FJ715411_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ715412_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ715413_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ715414_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ787446_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ787480_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FR714490_HBe_P-RF-GB      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ358155_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ358156_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377520_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377534_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377539_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377544_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377548_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377549_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377560_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377564_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377565_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377573_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377581_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377594_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377595_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377596_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377614_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377626_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377630_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377634_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ377635_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ924618_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HM750133_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HM750143_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HM750144_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HM750145_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HM750146_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HM750149_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HM750150_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700498_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700499_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700505_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700507_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700508_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700509_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700518_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700519_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700521_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700527_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700528_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700542_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700547_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
HQ700560_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLV
JF491448_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JF491449_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JF491451_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JF491455_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JF491456_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ732168_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ801476_HBe_P-RF-CG      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ386581_HBe_P-RF-CB      WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ562278_HBe_P-RF-DC      WVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KT991417_HBe_P-RF-DC      WVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KT991419_HBe_P-RF-DC      WVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KT991423_HBe_P-RF-DC      WVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MK052967_HBe_P-RF-BD      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
FJ882611_HBe_P-RF-GC      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MH746813_HBe_P-RF-BC      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MG826145_HBe_P-RF-BC      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
M38454_HBe_P-RF-CB        WVGSNLEDPASRELVVSYVNVNIGLKIRQLLWFHISCLTFGRETVLEYLV
KX660674_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KX660680_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873533_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KX660682_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
X75656_HBe_P-RF-CB        WVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLV
MK321265_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MK052968_HBe_P-RF-BD      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MH746812_HBe_P-RF-BC      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MH746811_HBe_P-RF-BC      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MH094410_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MG893559_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MG893555_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MG893554_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MG826148_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MG826147_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MG826146_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MG826144_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
MF925370_HBe_P-RF-CB      WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
LC458432_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
LC416040_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
LC279267_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
LC279266_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
LC279265_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
LC279264_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
LC279263_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KY881840_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KY470893_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KY363263_HBe_P-RF-CB      WVGSNLEDQASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
KY363262_HBe_P-RF-CB      WVGSNLEDQASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
KX660677_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KX660675_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KX354997_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964317_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964316_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964315_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964314_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964313_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964312_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964311_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964310_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964309_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964308_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964307_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964306_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964305_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964304_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964303_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964009_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964008_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964007_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964005_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964003_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU964001_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU963999_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU963998_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU963995_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU963994_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU963993_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU963991_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU963990_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU695746_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU695744_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU695743_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU695741_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU679953_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU679948_HBe_P-RF-CB      WVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU679944_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNXNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU679942_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU679939_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU519423_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KU519422_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KT991421_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KT003704_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KR013816_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KP276256_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KP276255_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KP276254_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KP276253_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KP148352_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KM875422_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ803753_HBe_P-RF-CB      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ173350_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ173349_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ173330_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ173329_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ173326_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ173325_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ173322_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ173320_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ173300_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ173299_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ173280_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ173279_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873534_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873532_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873531_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873527_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873524_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873517_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873515_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873513_HBe_P-RF-CB      WVGSNLEDPASRELVVXYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KF873511_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774499_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774495_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774490_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774489_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774480_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774471_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774470_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774458_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774457_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774456_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774455_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774452_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774448_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774447_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774426_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774425_HBe_P-RF-DC      WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774424_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774423_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774349_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774344_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774341_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774332_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774328_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774324_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774322_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774317_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774305_HBe_P-RF-CB      WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLV
KC774294_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774258_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774234_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774212_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774201_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774198_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774186_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC774183_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC315400_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
KC172106_HBe_P-RF-GB      WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JX661494_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JX429898_HBe_P-RF-DC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JQ801477_HBe_P-RF-BC      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLV
JX429896_HBe_P-RF-CB      WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETALEYLV
JF440017_HBe_P-RF-DA      WVGTNLEDPASRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLV
KF214656_HBe_P-RF-AC      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLV
X68292_HBe_P-RF-DA        WVGDNLEDPASRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
MF925386_HBe_P-RF-AC      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLV
MF488705_HBe_P-RF-AD      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLV
EF494376_HBe_P-RF-CA      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ161806_HBe_P-RF-EA      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AB194949_HBe_P-RF-AE      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
KJ586810_HBe_P-RF-AF      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY233277_HBe_P-RF-AC      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AY161147_HBe_P-RF-DA      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLV
AB222708_HBe_P-RF-AD      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCITFGRDTVLEYLV
AB330368_HBe_P-RF-DA      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
JN664933_HBe_P-RF-DA      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
MF925404_HBe_P-RF-AC      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AF297619_HBe_P-RF-DA      WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
AF297620_HBe_P-RF-DA      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLV
GQ331048_HBe_P-RF-AE      WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLV
JF440012_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF440007_HBe_P-RF-DE      WVGVNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF439995_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF439996_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF439998_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF440000_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF440001_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF440004_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF440005_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF440006_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF440008_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF440009_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF440010_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF440013_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF440014_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF440015_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF440003_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
JF439999_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKSRQLLWFHISCLTFGRETVIEYLV
MF925360_HBe_P-RF-DB      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLDYLV
KX827302_HBe_P-RF-DE      WVGANLEDPASRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVVEYLV
KX357628_HBe_P-RF-DE      WVGVNLEDPASRDLVVGYVNNNMGLKFRQLLWFHLSCLMFGRETVVEYLV
FJ904440_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLMFGRETVVEYLV
DQ464167_HBe_P-RF-DE      WVGGNLEDQASRDLIVSYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLV
JN664943_HBe_P-RF-DE      WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLV
GQ205377_HBe_P-RF-DE      WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLV
KC875338_HBe_P-RF-DE      WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVMEYLV
KC875339_HBe_P-RF-DE      WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVMEYLV
GQ205378_HBe_P-RF-DE