HBVdb

Dataset for protein HBx of genotype RF

[Download (right click)] [Edit] [Sequences] [Repertoires]

969 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Y18856_HBx_P-RF-CB        MAARLCCQLDPARDILCLRPCGAESRGRPVSGSLGDLPSPSPS-VPADHG
Y18857_HBx_P-RF-CB        MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPAFS-VPADHG
KC774246_HBx_P-RF-CB      MVARVCCQVDHWRDVGSLRAVGPESRGRPVSPPWGRLRSPCSFAVPADHG
JN664943_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPYPSAVPTDHG
KC774461_HBx_P-RF-DC      MAARSCCQLDPARDVLFLRPVAVVSGRRPVSGPDGSFRSRLCFAVPAAHG
KC774475_HBx_P-RF-DC      MAARVFCQLDPAGDVLCLRPVAVVSRRWPMSGPVGSFRSPSSFAVPANHG
KC774433_HBx_P-RF-DC      MAGRMGGQLDPARDVLCLRPVGGESRGRPFPGPFGFLRSPSSSAVPPDPG
JQ272887_HBx_P-RF-GF      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
EU833890_HBx_P-RF-GA      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB933279_HBx_P-RF-AG      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB933280_HBx_P-RF-AG      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB933281_HBx_P-RF-AG      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981179_HBx_P-RF-FG      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
HE981180_HBx_P-RF-GF      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHE
JQ272886_HBx_P-RF-GF      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KP274926_HBx_P-RF-GA      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KF219922_HBx_P-RF-GH      VAAGLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
AB933282_HBx_P-RF-AG      MAARLYCQLDPSRDVLCLRPVGAESRGRPLAGPLGPISSPSPSAVPADHG
AB933283_HBx_P-RF-AG      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPXDHG
JQ707469_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPFPSAVPADHG
JQ707468_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
EU833889_HBx_P-RF-GA      MAARLCCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707421_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707424_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707426_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707430_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707432_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707441_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707448_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707450_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707456_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707457_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707458_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707459_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707460_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707461_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707462_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707463_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707464_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707465_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707466_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPIGTLSSPSPSAVPADHG
JQ707467_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707470_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707471_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707472_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707473_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707475_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
JQ707445_HBx_P-RF-GA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY161140_HBx_P-RF-AD      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSGSPSAVPVDHG
AY161141_HBx_P-RF-AD      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSGSPSAVPVDHG
AY161147_HBx_P-RF-DA      MAARLYCQLDSSRDVLCLRPVGAESRGRPLARPLGAVSSPSPSAVQYDHG
AY161145_HBx_P-RF-AD      MAARLYCQLDTSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAVPADHG
AY161146_HBx_P-RF-AD      MAARLYCQLDTSRDVLCLRPVGAESRGRPLARPLGTVSSPSPSAIPSDHG
KF214656_HBx_P-RF-AC      MAARMYCQLDSSRDVLCIRPVGAESRGRPLAGPLGAVSSPSPSAVPSDHG
GQ161753_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPSDHG
AY233277_HBx_P-RF-AC      MAARLYCQLDSSRDVLCLRSVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
KJ586810_HBx_P-RF-AF      MAARLYCQLDSSRDVLCLRPVGAESRGRPLAGPLGTLSSPSPSAVPSDHG
AB674412_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFAGPLGTLSSPSLSAVSTDHG
GQ377630_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPPCVPTDHG
KJ803782_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLRALPPASPPVVPTDHG
KC774178_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPPSPPVVPTDHG
KC774364_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGAVPPPSPPVVPTDHG
GQ377635_HBx_P-RF-BC      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803791_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
KJ803802_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
HQ684848_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173279_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KJ173280_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPLVVPTDYG
KP148337_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDYG
EU939629_HBx_P-RF-BC      MAARLRCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ173350_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGALPPASPPVVPTVHG
MF925370_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF925402_HBx_P-RF-BD      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ173358_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTFHG
KJ173349_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
JF436923_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
FJ386674_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPAVPTDHG
AF233236_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU660227_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
EU939631_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803778_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPVVPTDHG
KJ803803_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPPLVPTDHG
KJ803772_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGSLGALPPASPSAVSTDNG
HQ700531_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPTDHG
AB031265_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRRRPLPGPLGALPPAPPSAVPTDHG
HM146131_HBx_P-RF-AD      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
JF440003_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440002_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440017_HBx_P-RF-DA      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
DQ464165_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHG
DQ464166_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHG
DQ464167_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHG
DQ464164_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSAVPTDHG
EU185780_HBx_P-RF-AD      MAARLYCQLDPARDVLCXRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
JF440011_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440015_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCRRPFSGSLGTLSSPSPSAVPTDHG
JF440006_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AB210819_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AJ627221_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JX898686_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JX898690_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JX898693_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTAHG
JX898695_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTAHG
JX898696_HBx_P-RF-DE      MAARLXCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTAHG
JF439994_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF439995_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF439996_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF439998_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF439999_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440000_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440001_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440004_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440005_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440007_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440008_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440009_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440010_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440012_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JF440013_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSSSAVPTDHG
JF440014_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AJ344117_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSSSPSAVPTDHG
FJ349221_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JX898688_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN040803_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JX898687_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
HQ700554_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPIGDLPSPSSSAVPANYG
HM750150_HBx_P-RF-DC      MAARLCCQLDPARDVLCLCPVGAESRGRPFSGPPRSLPSPSSSAVPADHG
GQ377592_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGTLPPASPSVVPTDHG
MF925392_HBx_P-RF-DB      MAARLFHSLAAARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
KJ586811_HBx_P-RF-DF      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KJ173299_HBx_P-RF-CB      MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADYG
KJ173300_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADYG
KC875338_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ205379_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGSLSSSPPSAVPTDHG
AB493842_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANYG
EF103284_HBx_P-RF-AD      MAARLCCQLDPARDVLCLRPLSAESRGRPFSGSLGTLSSPSPSAVPTDHG
EU594435_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MG826150_HBx_P-RF-BC      MAARVGCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPSPSSPAVPADHG
KF214680_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSPSSPAVPAVHG
EU939627_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB105172_HBx_P-RF-CB      MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGDLPSPTSSAVPANHG
KC774222_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLPSPSSSAVPTDHG
HQ700498_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPTNNG
HQ700499_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPTNNG
HQ700462_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPPSSAVPANHG
FJ386646_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPLPGPLGALPSPSSSAVPADHG
FJ361772_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPFGTLPSPSPSAVPANHG
FJ349212_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AP011108_HBx_P-RF-CB      MAARLCCQLDTSRDVLCLRPVGAESRGRPVSGPFVPLPSSSSSAVPADHG
KC875339_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ205377_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ205378_HBx_P-RF-DE      MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ205387_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
JN664925_HBx_P-RF-DE      MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
DQ315779_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLRSLSSSPPSAVPTDHG
GQ205386_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
JN664934_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSPPSAVPTDHG
KT366505_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSPPSAVPTDHG
MF925360_HBx_P-RF-DB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPAPPSAVPTDHG
KU679952_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVXRPLGDLPSPSSPAVPADHG
KR905422_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT366503_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF873527_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLPSPSPSAVPADHG
KC774447_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPAHLG
JN688717_HBx_P-RF-DE      MAARLXCQLDPXRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
JN664929_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSPPSAVPTDHG
JN664915_HBx_P-RF-DE      MAARLCCQLDPARGVLCLRPVGAESRGRPFSGSLGSLSSSHPSAVPTDHG
JN642160_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLTSPSPSAVSTDHG
JN104438_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN040798_HBx_P-RF-DE      MAARLCCQLDSARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
HQ700532_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPTDHG
HQ700523_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPIGDLPSPSSSAVPADHG
HQ700519_HBx_P-RF-CB      MAARLCCQLDTTRDVLCLRPVGAESSGRSVSGPLGDLSSPSPPAVPADHG
HQ700507_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLSSPSLSAVPADHG
HQ700505_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVAGPPGDLPSPSLPAVPADHG
GQ358156_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
GQ161788_HBx_P-RF-AE      MAARLCCQLDSSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
GQ161837_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
HF571060_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
GQ161767_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
FR714496_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESCRRPLSGPLGDLSSSSASAVPPVHG
FN594770_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPPLPAVPADHG
EU594436_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EF103283_HBx_P-RF-AD      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
DQ315780_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
JN664940_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPPGSLSSSPPSAVPTDHG
AY373430_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
AY057948_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
AP011105_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AJ627217_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ111987_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KT366504_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AF297619_HBx_P-RF-DA      MAARLYCQLDPSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPADHG
AB674436_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674432_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KJ803827_HBx_P-RF-BC      MAARLCCQLDPTRDVLCLRPVSAESRGRPLSGPLGALPSPSSSAVPTDHG
AB583679_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTVTSPSPSAVSTDHG
AB194949_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVSAESRGRPLSGPFGTLSSPSPSAVPTDHG
AB188245_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSLSAVPTDHG
EF103282_HBx_P-RF-AD      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KJ803771_HBx_P-RF-DB      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
KM524357_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KC172106_HBx_P-RF-GB      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGPLGDLPSSSSSAVPPVHG
FJ023667_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPFGDLPSPSPSAVPAVHG
EU833891_HBx_P-RF-GC      MAARLCCQLDHARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
AP011102_HBx_P-RF-CB      MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGGLPSPSSSAVPADHG
AF297620_HBx_P-RF-DA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AP011104_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AY817509_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
GQ924618_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSTSAVPADHG
HM750133_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JN104442_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774482_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KC774439_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
FR714490_HBx_P-RF-GB      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGPLGDLPSSSSSAVPPVHG
FJ882610_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
KP276256_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KP276253_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KC774456_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
HM750149_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLPSPSSSAVPAAHG
HM750148_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
HM750147_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
HM750144_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
HM750143_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
HM750142_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
FJ882618_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ882614_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ882617_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
DQ478890_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLPSPSSSAVPADHG
EU835240_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSPSSSAVPAVHG
FJ023664_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ023665_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ023666_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ023668_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ023670_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ023673_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ882611_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ882612_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
FJ882613_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPFGDLPSPSPSAVPAVHG
HQ700527_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHG
HQ700528_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
KF873531_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHG
KF873532_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHG
KF873533_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHG
KF873534_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSRPLGDIPSPSSSAVPAAHG
KF873511_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873513_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873515_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873517_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KU679939_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPPSSAVPADHG
KF873521_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
HQ700560_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
HQ700530_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVAGPLGDLPSPSSSAVPADHG
HQ700521_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESGGRSVSGPLGDLPSPSPPTVPADHG
HQ700518_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRSVGAESRGRPVSGPLGDLPSPSSPAVPADHG
HQ700508_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLSSPSLSAVPADHG
AY233295_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGSLSSPSPSAVPTDHG
DQ315777_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHG
EF103285_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVPTDHG
GQ183486_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
GU563560_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JN664933_HBx_P-RF-DA      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KM359442_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLPSPSPSAVPTDHG
KF679991_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVPTDHG
KM386676_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLPSPSPSAVPTDHG
GQ161806_HBx_P-RF-EA      MAARLXCQLDXSRDVLCLRPVSAESXGRPLSGSLGDLSSPSPSAVPTDHG
FJ562263_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KT991424_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KT991427_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
AB493837_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPTGALPSPSSSAVPADHG
AB493838_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGALPSPSSSAVPADHG
AB493840_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSSAVPADHG
AB493847_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGALPSPSSSAVPADHG
AP011103_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPAAHG
GQ358155_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSSSSSAVPADHG
KF873535_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHG
HQ700485_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPANHG
HQ700557_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGPLGDLPSPSPSAVPANHG
KU679940_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSSSAVPADHG
AY040627_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSFSAVPTAHG
EU594406_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257210_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
KJ803753_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSSSSSAVPTDHG
MF925384_HBx_P-RF-DB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF925382_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPPASPSAVPTDHG
MF488702_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU679955_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPXSSAVPADHG
KU679953_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873522_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVPSPSSSTVPADHG
KC012653_HBx_P-RF-AD      MAARLYCQLDPARDVLCXRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
JN257189_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
KF873523_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGXVPSPSSSTVPADHG
KF873524_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVPSPSSSTVPADHG
MG826148_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
KY881840_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSPSSLPVVPADHG
KY363263_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLSSPASSAVPADHG
KY363262_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVAGPFGTLSSPASSAVPADHG
KU679948_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLAALPSPSSSAVPADHG
KU679944_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KT366492_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KJ647349_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KF471643_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGSLGTVSSPSPSAVSTDHG
FJ023662_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
DQ089798_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AY800249_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATLG
AF411409_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB270538_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLASPSPSAVPPDHG
KU679950_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KU679946_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873518_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
KF873519_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
MH481859_HBx_P-RF-DE      MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHG
MG826144_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADYG
KX765835_HBx_P-RF-GC      MAARLCCQLDPSRDVLCLRPVSAESSGRPLPGPFGALSPPSPSAVPADHG
KX660685_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KX357629_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGTLGTLSSPSLPAVPPDHG
KU695744_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRSVAGPFGDVPSPSLSAVPADHG
KC774426_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLG
KC774420_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLG
MH481861_HBx_P-RF-DE      MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHG
MH481860_HBx_P-RF-DE      MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHG
MH481858_HBx_P-RF-DE      MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHG
MH464852_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRRRPLSGSLGTLSSPSPSAVPTDHG
MH464846_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRRRPLSGSLGTLSSPSPSAVPTDHG
MH094410_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
MG893561_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTIPSPSSSAVPADHG
MG826141_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MF925381_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSASPSAVPTDHG
LC279267_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHG
LC279266_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHG
LC279265_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHG
LC279264_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHG
LC279263_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHG
KY363273_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KX774505_HBx_P-RF-BC      MAARLYCQLDPARDVLCLRPVGAESRGRPLSGPTGALPPASPSALPADHG
KX660675_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPITGPSGSLPSPSSSAVPADHG
KX357636_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTFSSPSLPAVPPDHG
KX357631_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDDG
KU695742_HBx_P-RF-CB      MAARMCCQLDPSRDVLCLRPVGAESRGRPVAGPLGALPSPSSSAVPADHG
KU679941_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVPSPSSSTVPADHG
KC774485_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADLG
HM750146_HBx_P-RF-DC      MAARLRCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADLG
AY817511_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSSSAVPADHG
MG826147_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGDLPSPSLSAVPADHG
MF593359_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU963938_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963936_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
JX898698_HBx_P-RF-DE      MAARLXCQLDPARDVLCLRPVGAESCGRPFSGSLGTPSSPSPSAVPTDHG
JX898699_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTPSSPSPSAVPTDHG
X65259_HBx_P-RF-DA        MAARLYCQLDPSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPADHG
MH685719_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESCGRPFSGSLGTLSSPSLPAVPTDHG
KY470855_HBx_P-RF-DC      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHG
KY470854_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHG
KY470853_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVDAESRGRPVSGPFGSLSSPSSSAVPADHG
KY470850_HBx_P-RF-DC      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHG
KY470849_HBx_P-RF-DC      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHG
KY470847_HBx_P-RF-DC      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHG
KY470846_HBx_P-RF-DC      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHG
KY470844_HBx_P-RF-DC      IAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPTDHG
KY470843_HBx_P-RF-DC      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPTDHG
KX827299_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGDLSSPSLPAVPTDHG
KX357627_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPNHG
KU736922_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGTLGTLPSPSLLAVPPNHG
KU736921_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGTLGTLPSPSLLAVPPNHG
KU711666_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVSTDHG
KU679943_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALPSPSPSAVPADHG
X68292_HBx_P-RF-DA        MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
U95551_HBx_P-RF-DE        MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MK321265_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
MK052967_HBx_P-RF-BD      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHG
MH464851_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464835_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPISRSLGTLSSPSPSAVPTDHG
MG893555_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MG893554_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
MG826151_HBx_P-RF-BC      MAARLYCQLDPARDVLCLRPVGAESRGRPLPGPFGTLPSSSSSAIPADHG
MG826146_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPIGGLPSPSVSAVPADHG
MF967563_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MF618346_HBx_P-RF-DE      MAARMCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVPTDHG
MF488705_HBx_P-RF-AD      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MF488699_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
M38454_HBx_P-RF-CB        MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
LC458432_HBx_P-RF-CB      MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY629632_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPAAHG
KY470893_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY363272_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KX827302_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX660682_HBx_P-RF-DC      MAAXVCCQLDPARDVLCLRPVGAESRGRPXSGPFGSLPSPSSSAVPADHG
KX660680_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
KX660677_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
KX660674_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
KX096713_HBx_P-RF-CA      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KU964351_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU964317_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964316_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964315_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964314_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964313_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964312_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964311_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964310_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964309_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964308_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964307_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964306_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964305_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964304_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964303_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964010_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964009_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964008_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964007_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964006_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU964005_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KU963883_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963870_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963869_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963868_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963867_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963866_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963865_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963864_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963863_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963862_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963861_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963860_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963859_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963858_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963857_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU963856_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAIPADHG
KU695746_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPLGDLPSPSASAVPADHG
KU679958_HBx_P-RF-CB      MAARLRCQLDPARDVLCLRPVGAESRGRPFSGPLGDVPSPSSSTVPADHG
KU679942_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSPSAVPADHG
X80925_HBx_P-RF-DE        MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSPSAVSSDHG
MK052968_HBx_P-RF-BD      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHG
MK052957_HBx_P-RF-DE      MAARLCCQLGPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHG
MH481862_HBx_P-RF-DE      MAARLCCQLDPARNVLCLRPVGAESCGRPFSGPLGALSSSSLPAVPADHG
MF925404_HBx_P-RF-AC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925397_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925396_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925388_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
MF925386_HBx_P-RF-AC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALPSPASSAVPADHG
MF925371_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGALPSPASSAVPADHG
KY470858_HBx_P-RF-GC      MAVRLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KU963944_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963943_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963942_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963941_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963940_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963939_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963935_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963934_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963933_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963932_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963931_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
KU963930_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSTSSSAVPADHG
MK052969_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MG893559_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALPSPSSAAVPADHG
KX357641_HBx_P-RF-DE      MAARLYCQLDPARDVLCLRPVCAESCGRPFSGPIGDLPSPSPPAVPTDHG
KX357635_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357634_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357633_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357632_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVDAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357630_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357628_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357626_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDYG
KX357625_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPNHG
KX357624_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357623_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KU736923_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KU736917_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVCAESGGRPFSGPLGDLPSPSLPAVPTDHG
KU736916_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESCGRPFSGPLGDLSSPSLPAVPADHG
KU736915_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVCAESGGRPFSGPLGDLPSSSLPAVPTDHG
KU736914_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVCAESGGRPFSGPLGDLPSSSLPAVPTDHG
KU695745_HBx_P-RF-CB      MAARLCCQLDPSXDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHG
X75656_HBx_P-RF-CB        MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGDLPSPSSSAVPANHG
MK052976_HBx_P-RF-BD      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGSLSSPSPSAVPPDHG
MK052970_HBx_P-RF-BD      MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHG
MH746813_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
MH746812_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
MH746811_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
MG826149_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
MG826145_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
MG826142_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSSAVPADHG
MF925401_HBx_P-RF-DB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPTDHG
MF925389_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHG
LC416040_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY670781_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGSLPSPSSSAVPANHG
KY471007_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY471006_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY471005_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY471004_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY471003_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY471002_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY471001_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPPGDLPSSSSSAVPTVHG
KY471000_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY470999_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY470998_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPPGDLPSSSSSAVPTVHG
KY470997_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KY470996_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KU695743_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSLSAVPADHG
KU695741_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSLSAVPADHG
KY470871_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KX354997_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KY470865_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGGLPSSSSSAVPTVHG
MH368022_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPTVHG
KX660689_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLPSPSSSAVPADHG
KX660686_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLPSPSSSAVPADHG
KX660684_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU964380_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU964379_HBx_P-RF-DC      MAAGLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU964374_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU964372_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU964370_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU964367_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU679956_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSPSAXPADBG
KU964366_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU679945_HBx_P-RF-CB      MAARLCCELDPTRDVLRLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF873538_HBx_P-RF-CB      MAARLCCELDPARDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF873537_HBx_P-RF-CB      MAARLCCELDPARDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF873543_HBx_P-RF-CB      MAARLCCELDPTRDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF873540_HBx_P-RF-CB      MAARLCCXLDPTRDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KF873542_HBx_P-RF-CB      MAARLCCELDPTRDVLCLRPVGAEPRGRPVSRPLGDLPSPSSSAVPADHG
KJ803788_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVSAESRGRPVPGSLGALPAASSSAVSTDHG
KF873530_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAEPRGRPVSGPLGDLXSPSSPAVPADHG
KP148441_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGDLPSSSSSAVPSVHG
KP148442_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGDLPSSSSSAVPSVHG
KP148447_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGDLPSSSSSAVPSVHG
KP148449_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGDLPSSSSSAVPSVHG
KP148450_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLGDLPSSSSSAVPSVHG
JN688689_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGXLGTLSSPSPSAVPTDHG
HQ700520_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRSVAGPLGTLPSPSSPAVPAHHG
KP148586_HBx_P-RF-GC      MAARLCCQLDPARDVLCLRPVGAESCGRPLPGPLEDLPSSSSSAVPSVHG
KF192833_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
GQ331048_HBx_P-RF-AE      MAARLYCQLDSSRDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPADHG
FJ904406_HBx_P-RF-DE      MAARMCCQLDPARDVLCLRPVGAESCGRPFSGPLGDISSPSLPAVPTDHG
KP168416_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPVGVESCGRPVSGPLGAFSSPSLPAVPTDHG
KC774432_HBx_P-RF-DC      MAARVCCQLDPARDILCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADNG
HQ700542_HBx_P-RF-CB      MAARLCCQLDPTRNVLCLRPVSAESRGRPVSRSLGDLPSPSSSAVPADHG
EU787434_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLG
KC774422_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPVPSPSTSAVPANLG
KC774458_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLG
KC774474_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLG
KC774495_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANLG
HQ700494_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGXLGXLSSPSLPAVPADHG
HQ700500_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
KJ586803_HBx_P-RF-AF      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
KC774476_HBx_P-RF-DC      MAGRVWCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JQ027310_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVSAESRGRPISGPXGTLPSPSSSAVPTDHG
FN594767_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPANHG
KJ410497_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPADHG
KJ598675_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPFGALPSPSLSAVPAAHG
HQ700580_HBx_P-RF-CB      MAARLCCQLDPSRDVLCLRPVGAESRGRPISGPLGDLPSPASSAVPADHG
FJ023659_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLPSSSSSAVPAVHG
FJ349241_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSSSAVPADHG
KU679954_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSPSAVPADHG
HM750145_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLPSPSSFAVPANHG
FJ904442_HBx_P-RF-DE      MAARLCCQLDPARDVLYLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904430_HBx_P-RF-DE      MAARLCCQLDTARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
KJ470897_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
FJ904397_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGDLSSSSXPAVPADHG
FJ904417_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
KP168420_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPFCAESCGRPFSGPIGDLSSPSLPAVPTDHG
KP168421_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPFCAESCGRPFSGPLGDLSSPSLPAVPTDHG
FJ349207_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLPSPSPPAVPTDHG
FJ904425_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGDLSSPSLPVVPTDHG
GQ377522_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPTDHG
GQ377626_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSSSAVPTDHG
KM606750_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
KJ803804_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPIGAESRGRPLSGPFGTLPSPSSSAVPADHG
KF192839_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192836_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192835_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192837_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192838_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192840_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192841_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KU668440_HBx_P-RF-DE      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KC774198_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGTLPSPSPSAVPTDHG
KC774201_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGTLPSPSPSAVPTDHG
JQ801476_HBx_P-RF-CG      MAARLCCQLDTSRDVLCLRPVSAESSGRPLSGPLGAFSPPSSSAVPADHG
HQ700533_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGALSSPSLPAVPADHG
HQ700536_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGALSSPSLPAVPADHG
GQ161754_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
FN594771_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLSAVPTDHG
FN594769_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGDESCGRPFSGPLGDLPSPSLPAVPTDHG
FJ904444_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPADHG
FJ904440_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
FJ904428_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPIGAESCGRPVSGPLGDLSSSSLPAVPADHG
FJ904416_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904409_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSSSLPAVPADHG
KJ470898_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
FJ904408_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904407_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPFGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904404_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904396_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904401_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904436_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
HQ700492_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
DQ991753_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPTDHG
AY341335_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
JN664946_HBx_P-RF-DA      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
AM494716_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPTNHG
AB241109_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVAGSLGALSSPSPSAVPADHG
AB048702_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPPAVPTDHG
AB048703_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPPAVPTDHG
FJ692536_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSSSLPAVPTDHG
FJ904400_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
FJ904441_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
GU177079_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPTDHG
KF170740_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESCGRPFSGPPGDLSSPSLPAVPTDHG
KJ470891_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPTDHG
KM606741_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
KM606751_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSLPAVPTDHG
AB188243_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
JN642141_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642152_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754613_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSPSAVSTDHG
JN257174_HBx_P-RF-DE      MAARLCCQLDPXRDVLCLRPVGAESCGRPVSGPLGTLSSPSPSAVSTDHG
JN257191_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSPSAVSTDHG
JN642137_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257206_HBx_P-RF-DE      MAARLCCQLDPXRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257207_HBx_P-RF-DE      MAARLCCQLDPXRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257216_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
KT003704_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSAAVPAPHG
KJ470887_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTLSSPSLPAVPADHG
KC774450_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPLGAESRGRPFQGPLGTLSSPSPSAVPTDHG
FJ904398_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLSAVPTDHG
AY233293_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
AB330368_HBx_P-RF-DA      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB033558_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSSPSAVPTDHG
AB674433_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754616_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGPLSSPSPSAVSTDHG
JN257154_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGPLGTLSSPSPSAVSTDHG
JN257164_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257204_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
JN642127_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN642139_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
KJ803785_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTDHG
KJ470892_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSLPAVPADHG
JQ687532_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
KP995112_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSLPAVPTDHG
KP168418_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSLPAVPPDHG
KP168417_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSLPAVPPDHG
KP148352_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPFGAESRGRPVSGPFGALPSPSSSAVPADHG
KJ803798_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ647356_HBx_P-RF-DE      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
KJ647351_HBx_P-RF-DE      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPFGTLSSPSPSAVPADHG
AB033559_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
FJ904394_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904403_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGDLSSSSLPAVPADHG
FJ904405_HBx_P-RF-DE      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPANHG
FJ904414_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904437_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSPPAVPADHG
FJ904447_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
HQ700493_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPANHG
HQ700497_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700501_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700503_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700524_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700525_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPAXHG
HQ700534_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700535_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700537_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700538_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700540_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700541_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGALSSPSLPAVPADHG
HQ700579_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700581_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700582_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700583_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700584_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700585_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
KP288875_HBx_P-RF-DE      MAARLXCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
KJ470890_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470888_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470886_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470884_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSLPAVPADHG
KM577667_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KM577666_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVPTDHG
KM577665_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KM577664_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KM577663_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KM524359_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KM524337_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHG
KM524336_HBx_P-RF-DE      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHG
JQ801477_HBx_P-RF-BC      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPTDHG
KU519423_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
JN688715_HBx_P-RF-DE      MAARLXCQLDPXRDVLCLRPVGAESRGRPXSGXXGTLSSPSPSAVPXDHG
KJ410506_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPFGTLPSPSSSAVPADHG
EU939547_HBx_P-RF-CB      MAGRVCCQLDPARDVLCLRPVGDESRGRPVSGPFGPLSSPSSFAVPADLG
FJ562302_HBx_P-RF-CB      MAARMCCQLDPALDVLCLRPVSAESRGRSLSGRFGTLPSPCSSAVPADHG
FJ562247_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPSGTLPSPSSSAVPADHG
KC315400_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSASAVPPDHG
AB367393_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGPESRGRPVSGSFGTLPSPSSSAVPADHG
KJ173320_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPADHG
KJ173322_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPLPGPLGALPAASPPVVPADHG
GQ377595_HBx_P-RF-BC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KY470845_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPFGAESRGRPVSRPFGSLPSPSSSAVPADHG
KY470848_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPFGAESRGRPVSRPFGSLPSPSSSAVPADHG
KY470851_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPFGAESRGRPVSRPFGSLPSPSSSAVPADHG
KY470852_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPFGAESRGRPVSRPFGSLPSPSSSAVPADHG
KM875422_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPFGTLPSPSFSAVPADHG
KC774349_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVSVESRGRPVSGPFGTLPSPSSSAVPAYHG
JF436922_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSPAVPADHG
JF436919_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
GU357843_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377596_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562317_HBx_P-RF-CB      MAARVCCQLDTARDVLCLRPVGAESRGRSVSGPSGPLPSPSSSAVPADHG
FJ562267_HBx_P-RF-CB      MAARVCCQLDTARDVLCLRPVGDESRGRPVSGPFGTLPSPSSSAVPADHG
EU939620_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRSVSGPFGSLSSPSSSAVPADHG
EU589337_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLSSPSSSAVPADHG
FJ032343_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGTLSSPSSSAVPADHG
AY862865_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATHG
AY817515_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGSLPSPSSSAVPANLG
KC774457_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPIGAESRGRPVSGPFGSLPSPSSSAVPANLG
AY817510_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGVESRGRPVSGPFGSLPSPSSSAVPAAHG
AY236161_HBx_P-RF-DA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
AY123041_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSLAFSAVPADHG
KC774430_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPASSAVPANHG
AB195950_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
AB195951_HBx_P-RF-CB      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPAYHG
AB049609_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
EU939565_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGTESRGRPVARPFGTLPSPSASAVPADHG
GQ377534_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGTESRGRPVARPFGTLPSPSASAVPADHG
EU939589_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGTESRGRPVPRPFGTLPSPSDSAVPAAHG
KC774188_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPAAHG
KC774481_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVPGPFGSLPSPSSSAVPADHG
FJ562287_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADYG
EU939630_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU872014_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871983_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871981_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871999_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871986_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
JX661494_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGVESRGRPISGPFGTLPSPSSSAVPADHG
FJ562336_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGPESRGRPVSRPFGTLPSPSASAVPADHG
GQ377634_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
AF461361_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562305_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
GU385774_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774294_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EF494376_HBx_P-RF-CA      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGSFGTLPSPSSTAVPADHG
FJ562278_HBx_P-RF-DC      MAARVCCQLDPTRDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHG
KT991419_HBx_P-RF-DC      MAARVCCQLDPTRDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHG
KT991421_HBx_P-RF-DC      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGSFGSLPSPSSSAVPADHG
HQ700509_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGDLPSPSLSAVPADHG
KJ173329_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KJ173330_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KU963990_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963991_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963993_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963994_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963995_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963998_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU963999_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU964001_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KU964003_HBx_P-RF-CB      MAARVCCQLDPARDILCLRPVGTESRGRPVSGPFGTLPSPSSSAVPADHG
KT991417_HBx_P-RF-DC      MAARVCCQLDPTRDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHG
KT991420_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHG
KT991423_HBx_P-RF-DC      MAARVCCQLDPTRDVLCLRPVGAESCGRPVSGSFGSLPSPSSSAVPADHG
KC774497_HBx_P-RF-DC      MAARVCCQLDPARDILCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
KC774453_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
KC774425_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSAAVPAAHG
KC774323_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRSVSRPFGTLPSPSPSAVPADHG
JX429898_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JX429896_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGVESRGRPISGPFGTLPSPSSSAVPADHG
JQ040146_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JQ040148_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JN664935_HBx_P-RF-DC      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPTDHG
JF828935_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JF828934_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
GQ377560_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
GQ377544_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGSESRGRPVSRPFGTLPSPSASAVPAAHG
GQ377516_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGTESRGRPVSRPFGTLPSPSASAVPADHG
KC774344_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGTESRGRPVSGPFGTLPSPSASAVPADHG
FJ562328_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JF828933_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JF828936_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JF828938_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ562271_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLPSPSSSAVPADHG
FJ562229_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
FJ386593_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
FJ386581_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPPDHG
EU939668_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTVPSPSSSAVPADHG
EU939577_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPTVHG
EU919166_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
EU919167_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSSSSSAVPADHG
FJ386586_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGPLSSPSSSAVPADHG
KC774470_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU871995_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPFPSAVPADHG
EU871987_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871988_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871990_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871994_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHR
EU882006_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLSSPSASAVPANHG
FJ562226_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU871984_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871985_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871989_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871991_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871992_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871993_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU871996_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSPSAVPADHG
EU872015_HBx_P-RF-CB      MAARVCCQLDPARGVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
EU589339_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPLGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU522070_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSVSAVPANHG
EF494378_HBx_P-RF-CA      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
DQ478897_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
DQ478889_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JF491448_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGSLPSPSSSAVPADHG
KC774424_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774478_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774480_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
DQ478887_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774479_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013843_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGPLPSPSSSAVPADHG
DQ478886_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPPSSAVPANHG
AY862866_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATHG
AY817512_HBx_P-RF-DC      MAAGVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSCSAVPAHHG
AY206374_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGDLPSPSPSAVPADHG
AY123424_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
EU871997_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSTVPADHG
EU939621_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPISGPFGTLPSPSSSAVPADHG
JX661498_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSYSAVPADHG
KC774498_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB642096_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPFGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB453985_HBx_P-RF-AC      MAARLYCQLDPSRDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPADHG
FJ032337_HBx_P-RF-CB      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLPSPSSSAVPADHG
AB300369_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSFSAVPADHG
KM213033_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
AB195956_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB195957_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB195939_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB195940_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB195941_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB014375_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
AB670303_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
EU939551_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPANHG
KJ803822_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSRPFGPLSSPSASAVPADHG
KC774499_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPIGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774487_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
KC774431_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGALPSPSLSAVPADHG
FJ562314_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSSAAVPADHG
EU916239_HBx_P-RF-CB      MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU916241_HBx_P-RF-CB      MAVRVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
KC774486_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSAFAVPADHG
AB198084_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
AY167095_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
DQ478892_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
EU787444_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU916228_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
EU916232_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
EU916240_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
EU939581_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386578_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPANHG
FJ386585_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPANHG
FJ386649_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSSSSSAVPANHG
FJ787446_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ787480_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377548_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPLSGPFGTLPSPSSSAVPANHG
GQ377549_HBx_P-RF-CB      MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377565_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
HQ700526_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLPSPSLSAVPADHG
HQ700547_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPLGTLPSPSSSAVPADHG
JF491449_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JF491451_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JF491456_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
JN400086_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
JQ040142_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JX026887_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSASAVPADHG
JX661487_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVDAESRGRPISGPFGTLPSPSSSAVPADHG
KC774186_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774193_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774230_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774234_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KC774258_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774263_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774291_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSRPFGTLPSPSPSAVPADHG
KC774307_HBx_P-RF-CB      MAAWVCCQLDPARDVLCLRPVSAESRGRPVSRPFGSLPSPSPSAVPADHG
KC774317_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KC774322_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KC774324_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774328_HBx_P-RF-CB      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KC774434_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774435_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774442_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774443_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774448_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774452_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774455_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774463_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774468_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774472_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPSGSLPSPSSSAVPADHG
KC774483_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
KC774489_HBx_P-RF-DC      MAARVCCQLDPTRDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774490_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVSAESRGRPVSGPFGSLPSPSSSAVPADHG
KF917451_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KJ173325_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ173326_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPANHG
KJ410520_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KP276254_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KP276255_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KR013806_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
KR013816_HBx_P-RF-CB      MAARVCCQLDPARNVLCLRPVDAESRGRPVSGPFGTLPSPSSSAVPADHG
JF491455_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSTAVPANHG
KC774488_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRRRPVSGPFGSLPSPSSSAVPATHG
JQ040174_HBx_P-RF-CB      MAARXCCQLDPARDVLCLRPVGAESRXRPVSGPFGXLPSPSSSAVPADHG
JQ040175_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU787435_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
GQ475335_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGPLSSPSSSAVPADHG
AB033557_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
AB674504_HBx_P-RF-DC      MAARMCCQLDPARNVLCLRPVSAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386635_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSSSSSAVPADHG
KU519422_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVSAESRGRPVSGPFGSLPSPSFSAVPAAHG
KC774492_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
KC774341_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
KC774332_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JX504540_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPSGTLPSPSSSAVPADHG
FJ562227_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
JQ732168_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPACHG
AB205152_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB270535_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLPSPSSSAVPATHG
AB367400_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AB367419_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSASAVPADHG
AF330110_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLPSPSSSAVPADHG
AY247030_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
AY862864_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATHG
DQ478898_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
EU717211_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPATHG
EU881995_HBx_P-RF-CB      MAARVSCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPADHG
EU939602_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPANHG
EU939606_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGNLPSSSSSAVPADHG
EU939632_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLSSPSSSAVPADHG
FJ386633_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ386643_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPANHG
FJ562277_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
FJ562294_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
GQ377556_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
GQ377564_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377581_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377590_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377604_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377611_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGXLPSPSSSAVPADHG
GQ377614_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377627_HBx_P-RF-CD      MAARVCCQLDPARNVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
GQ377633_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
JX661485_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
JX661486_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
KC774183_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774305_HBx_P-RF-CB      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGALSSPSSSAVPADHG
KC774414_HBx_P-RF-BC      MAARVCCQLDPARDVLCLRPVGAESCGRPISGPSGTLPSPSSSAVPADHG
KC774423_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774428_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPAAHG
KC774449_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774454_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSASAVPADHG
KC774466_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPANHG
KC774471_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774484_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774494_HBx_P-RF-DC      MAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPADHG
KC774212_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSFGALPSPSSSAVPADHG
JQ707714_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPLGAESRGRPVSGPFGALPSPSSSAVPADHG
AB195955_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
AB367800_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGPLSSPSSSAVPADHG
FJ562223_HBx_P-RF-CD      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGILSSPSSSAVPADHG
GQ377539_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
KC774493_HBx_P-RF-DC      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGSLPSPSSSAVPATHG
GQ377607_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPSPSSSAVPADHG
GQ377594_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGALPSPSSSAVPXDHG
GQ377602_HBx_P-RF-CB      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSSSAVPADHG
                          :.      :    .:    .    .  ..         .           

Y18856_HBx_P-RF-CB        AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
Y18857_HBx_P-RF-CB        AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNGR--RGLPKVLHKRTL
KC774246_HBx_P-RF-CB      AHGRTRGLPVRPLASAGLPALRLTSAPCMETTVKTP--RAPPQAPRKRTS
JN664943_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH---QLPKVLHKRTL
KC774461_HBx_P-RF-DC      AHLSLRGLTVRSLFSPGPCALRFTCARCMETTVNAH--QVLPKVTHKRTI
KC774475_HBx_P-RF-DC      AHLPIRGLPVCALASPGPCSLRFTCARCMETTVNAH--QVLPKVLHKRTS
KC774433_HBx_P-RF-DC      APLSFRGLPVCAFSSAGPCAFRFTSARRMETTVNAH--QVLPKVLLKRIL
JQ272887_HBx_P-RF-GF      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
EU833890_HBx_P-RF-GA      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
AB933279_HBx_P-RF-AG      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
AB933280_HBx_P-RF-AG      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
AB933281_HBx_P-RF-AG      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
HE981179_HBx_P-RF-FG      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
HE981180_HBx_P-RF-GF      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMSTS--HHLPRQLYKRTL
JQ272886_HBx_P-RF-GF      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
KP274926_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
KF219922_HBx_P-RF-GH      AHLSLRGLPVCSFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
AB933282_HBx_P-RF-AG      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAH--QILPKVLHKRTL
AB933283_HBx_P-RF-AG      AHLSLRGLPVCAFSSAGPCALRFTSARCMATTVNAH--QILPKVLHKRTL
JQ707469_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707468_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYERTL
EU833889_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HPLPRQLYKRTL
JQ707421_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707424_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707426_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707430_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707432_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707441_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707448_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707450_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707456_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HPLPRQLYKRTL
JQ707457_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707458_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707459_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707460_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707461_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707462_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707463_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HPLPRQLYKRTL
JQ707464_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707465_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707466_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707467_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707470_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707471_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HPLPRQLYKRTL
JQ707472_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707473_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707475_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
JQ707445_HBx_P-RF-GA      AHLSLRGLPVCAFSSAGPCALRFTSARYMETAMNTS--HHLPRQLYKRTL
AY161140_HBx_P-RF-AD      EHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QVLPRVLHKRTL
AY161141_HBx_P-RF-AD      EHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QVLPRVLHKRTL
AY161147_HBx_P-RF-DA      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QVLPKVSHKRTL
AY161145_HBx_P-RF-AD      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QILPKVLHKRTL
AY161146_HBx_P-RF-AD      VHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QILPKVLHKRTL
KF214656_HBx_P-RF-AC      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QILPKVLHKRTL
GQ161753_HBx_P-RF-AE      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAR--QILPKILHKRTL
AY233277_HBx_P-RF-AC      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QILPKVLHKRTL
KJ586810_HBx_P-RF-AF      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QILPKVLHKRTL
AB674412_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSACHMETTVNAH--QFLPKVLYKRTL
GQ377630_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNDH--RNLPKVLHKRTL
KJ803782_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--GNLPKVLHKRTL
KC774178_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--GNLPKVLHKRTL
KC774364_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--GNLPKVLHKRTL
GQ377635_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARSMETTVNAH--RNLPKVLHKRTL
KJ803791_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
KJ803802_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--GNLPKVLHKRTL
HQ684848_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNPH--RNLPKVLHKRTL
KJ173279_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
KJ173280_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
KP148337_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
EU939629_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAP--RNLPKVLHKRTL
KJ173350_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
MF925370_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
MF925402_HBx_P-RF-BD      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
KJ173358_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
KJ173349_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--GNLPKVLHKRTL
JF436923_HBx_P-RF-CB      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAH--GNLPKVLHKRTL
FJ386674_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVIAH--RNLPKVLHQRTL
AF233236_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
EU660227_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
EU939631_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
KJ803778_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
KJ803803_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
KJ803772_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
HQ700531_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
AB031265_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--WNLPKVLHKRTL
HM146131_HBx_P-RF-AD      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HFLPKVLHKRTL
JF440003_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRYTSARRMETTVNAH--RMLPKVLHKRTL
JF440002_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRYTSARRMETTVNAH--RMLPKVLHKRTL
JF440017_HBx_P-RF-DA      AHLSLRGLPVCAFSSAGPCALRYTSARRMETTVNAH--RMLPKVLHKRTL
DQ464165_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSVRRMETTVNAH--QILPKVLYKRTL
DQ464166_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSVRRMETTVNAH--QILPKVLYKRTL
DQ464167_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSVRRMETTVNAH--QILPKVLYKRTL
DQ464164_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSVRRMETTVNAH--QILPKVLYKRTL
EU185780_HBx_P-RF-AD      AHLSLRGLPVCAFSSAGPXALXFTSARRMETTVNAH--RMLPKVLHKRTL
JF440011_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JF440015_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JF440006_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
AB210819_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
AJ627221_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JX898686_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JX898690_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JX898693_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JX898695_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JX898696_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JF439994_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JF439995_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JF439996_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JF439998_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JF439999_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JF440000_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JF440001_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JF440004_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFASARRMETTVNAH--RMLPKVLHKRTL
JF440005_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFASARRMETTVNAH--RMLPKVLHKRTL
JF440007_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JF440008_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JF440009_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JF440010_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JF440012_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JF440013_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JF440014_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
AJ344117_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
FJ349221_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVSAH--LMLPKVLHKRTL
JX898688_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JN040803_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RFLPKVLHKRTL
JX898687_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
HQ700554_HBx_P-RF-CB      AHLSLRSLPVCAFSSAGPCALRFTSARRMETTVNAH--MXLPKVLHKRTL
HM750150_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
GQ377592_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
MF925392_HBx_P-RF-DB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--WNLPKVLHKRTL
KJ586811_HBx_P-RF-DF      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HILPKVLHKRTF
KJ173299_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRLTSARRMETTVNAR--QVLPKVLHKRTL
KJ173300_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRLTSARRMETTVNAR--QVLPKVLHKRTL
KC875338_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKILHKRTL
GQ205379_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HILPKLLHKRTL
AB493842_HBx_P-RF-CB      AHLSLRGLPVCAFSSADPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
EF103284_HBx_P-RF-AD      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
EU594435_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
MG826150_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNDH--WNLPKVLHKRTL
KF214680_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNDH--LTLPKVLHKRTL
EU939627_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
AB105172_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MILPKVLHKRTL
KC774222_HBx_P-RF-CB      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
HQ700498_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
HQ700499_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
HQ700462_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
FJ386646_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RBLPKVLHKRTL
FJ361772_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTI
FJ349212_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRLTSARRMETTVNAH--RMLPKVLYKRTL
AP011108_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC875339_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKILHKRTL
GQ205377_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKILHKRTL
GQ205378_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKILHKRTL
GQ205387_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKILHKRTL
JN664925_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKILHKRTL
DQ315779_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKILHKRTL
GQ205386_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKILHKRTL
JN664934_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKILHKRTL
KT366505_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKILHKRTL
MF925360_HBx_P-RF-DB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLITVLHKRTL
KU679952_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MILPKVLHKRTL
KR905422_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HFLPKVLHKRTL
KT366503_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HFLPKVLHKRTL
KF873527_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTH--LILPKVLHKRTL
KC774447_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JN688717_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QILPKVLHKRTL
JN664929_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RILPKILHKRTL
JN664915_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKILHKRTL
JN642160_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLYKRTL
JN104438_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
JN040798_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HFLPKVLHKRTL
HQ700532_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
HQ700523_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
HQ700519_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--MILPKVLHKRTL
HQ700507_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
HQ700505_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
GQ358156_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
GQ161788_HBx_P-RF-AE      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QSLPKVLHKRTL
GQ161837_HBx_P-RF-AE      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QILPKVLHKRTL
HF571060_HBx_P-RF-AE      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QILPKVLHKRTL
GQ161767_HBx_P-RF-AE      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVKAH--QILPKVLHKRTL
FR714496_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
FN594770_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSACRMETTVNAH--HVLPKVLHKRTL
EU594436_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--CILPKVLHKRTL
EF103283_HBx_P-RF-AD      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HFLPKVLHKRTL
DQ315780_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKILYKRTL
JN664940_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKILHKRTL
AY373430_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HFLPKVLHNRTL
AY057948_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTFARRMETTVNAH--QVLPKVLHKRTL
AP011105_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AJ627217_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
DQ111987_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KT366504_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
AF297619_HBx_P-RF-DA      AHLSLRRLPVCAFSSAGPCTLRFTSARCMETTVNAH--QILPKVLHKRTL
AB674436_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HCLPKVLHKRTL
AB674432_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KJ803827_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QDLPKVLHKRTL
AB583679_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
AB194949_HBx_P-RF-AE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
AB188245_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
EF103282_HBx_P-RF-AD      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HFLPKVLHKRTL
KJ803771_HBx_P-RF-DB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HFLPKVLHKRTL
KM524357_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HFLPKVLHKRTL
KC172106_HBx_P-RF-GB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
FJ023667_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
EU833891_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
AP011102_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
AF297620_HBx_P-RF-DA      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QILPKVLHKRTL
AP011104_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AY817509_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ924618_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAC--QVLPKVLHKRTL
HM750133_HBx_P-RF-CB      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JN104442_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KC774482_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
KC774439_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
FR714490_HBx_P-RF-GB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
FJ882610_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
KP276256_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
KP276253_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
KC774456_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
HM750149_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
HM750148_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
HM750147_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
HM750144_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFASARRMETTVNAH--LVLPKALHKRTL
HM750143_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
HM750142_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
FJ882618_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
FJ882614_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
FJ882617_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
DQ478890_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
EU835240_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LTLPKVLHKRTL
FJ023664_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
FJ023665_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
FJ023666_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
FJ023668_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
FJ023670_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
FJ023673_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
FJ882611_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
FJ882612_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
FJ882613_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
HQ700527_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTLNAH--MVLPKVLHKRTL
HQ700528_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTLNAH--MVLPKVLHKRTL
KF873531_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MILPKVLHKRTL
KF873532_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MILPKVLHKRTL
KF873533_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MILPKVLHKRTL
KF873534_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MILPKVLHKRTL
KF873511_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTH--MILPKVLHKRTL
KF873513_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTH--MILPKVLHKRTL
KF873515_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTH--MILPKVLHKRTL
KF873517_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTH--MILPKVLHKRTL
KU679939_HBx_P-RF-CB      AHLSLRGLPVCAFSSSGPCALRFTSARRMETTVNAH--MILPKVLHKRTL
KF873521_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MILPKVLHKRTL
HQ700560_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--MVLPKVLHKRTL
HQ700530_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
HQ700521_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MILPKVLHKRTL
HQ700518_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
HQ700508_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
AY233295_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
DQ315777_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
EF103285_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
GQ183486_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
GU563560_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLYKRTL
JN664933_HBx_P-RF-DA      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QXLPKVLHKRTL
KM359442_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLYKRTL
KF679991_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVSAH--QILPKVLYKRTL
KM386676_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLYKRTL
GQ161806_HBx_P-RF-EA      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QILPKVLHKRTL
FJ562263_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLYKRTL
KT991424_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLYKRTL
KT991427_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
AB493837_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
AB493838_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
AB493840_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
AB493847_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
AP011103_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
GQ358155_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
KF873535_HBx_P-RF-CB      AHLSLRGLPVCAFSSSGPCALRFTSARRMETTVNAH--MSLPKVLHKRTL
HQ700485_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
HQ700557_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCXLRFTSARRMETTVNAH--MVLPKVLHKRTL
KU679940_HBx_P-RF-CB      AHLSLRGLPVCAFSSSGPCALRFTSARRMETTVNAH--MILPKVLHKRTL
AY040627_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU594406_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
JN257210_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
KJ803753_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
MF925384_HBx_P-RF-DB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
MF925382_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--WNLPKVLHKRTL
MF488702_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KU679955_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MILPKVLHKRTL
KU679953_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTXARRMETTVNTH--MILPKVLHKRTL
KF873522_HBx_P-RF-CB      AXLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--MILPKVLHKRTL
KC012653_HBx_P-RF-AD      AHLSLRGLPVCAFSSAGPXALXFTSARRMETTVNAH--RMLPKVLHKRTL
JN257189_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HFLPKVLHKRTL
KF873523_HBx_P-RF-CB      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MILPKVLHKRTL
KF873524_HBx_P-RF-CB      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MILPKVLHKRTL
MG826148_HBx_P-RF-CB      AHLSLRGLPVWAFSSAGPCPFRFTFARRMETTVNAR--QVLPKVLHKRTL
KY881840_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KY363263_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KY363262_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KU679948_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTH--MILPKVLHKRTL
KU679944_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTH--MILPKVLHKRTL
KT366492_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HFLPKVLHKRTL
KJ647349_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RILPKVLYKRTL
KF471643_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RFLPKVLHKRTL
FJ023662_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
DQ089798_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETSVNAH--QVLPKVLHKRTL
AY800249_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AF411409_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB270538_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KU679950_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTH--MVLPKVLHKRTL
KU679946_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTH--MILPKVLHKRTL
KF873518_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTH--MILPKVLHKRTL
KF873519_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTH--MILPKVLHKRTL
MH481859_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
MG826144_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KX765835_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNSS--QVLPKVLHKRTL
KX660685_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KX357629_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QSLPKVLHKRTL
KU695744_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
KC774426_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774420_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
MH481861_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
MH481860_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
MH481858_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
MH464852_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
MH464846_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
MH094410_HBx_P-RF-BC      AHLSLRGLPICAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
MG893561_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
MG826141_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTFARRMETTVNAQ--QVLPKVLHKRTL
MF925381_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
LC279267_HBx_P-RF-CB      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
LC279266_HBx_P-RF-CB      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
LC279265_HBx_P-RF-CB      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
LC279264_HBx_P-RF-CB      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLRKRTL
LC279263_HBx_P-RF-CB      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KY363273_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMEATVNAH--QVLPKVLYKRTL
KX774505_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RTLPKVLHKRTI
KX660675_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KX357636_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KX357631_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QCLPKVLHKRTL
KU695742_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
KU679941_HBx_P-RF-CB      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--MILPKVLHKRTL
KC774485_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLYKRTL
HM750146_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
AY817511_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
MG826147_HBx_P-RF-CB      AHSSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
MF593359_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HILPKVLHKRTL
KU963938_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963936_HBx_P-RF-CB      AHLSLRGLPVCAVSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JX898698_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
JX898699_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
X65259_HBx_P-RF-DA        AHLSLRGLPVCAFSSAGPCALRFTSAHCMETTVNAH--QIMPKVLHKRTL
MH685719_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KY470855_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KY470854_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KY470853_HBx_P-RF-DC      AHLSLRGLPICAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KY470850_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KY470849_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KY470847_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KY470846_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KY470844_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KY470843_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KX827299_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KX357627_HBx_P-RF-DE      AHLSLRGLPVCAFTSAGPCALRFTSARRMETTVNAH--HFLPKVLHKRTL
KU736922_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KU736921_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KU711666_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QSLPKVLHKRTL
KU679943_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
X68292_HBx_P-RF-DA        AHLSLRGLTVCAFSSAGPCALRFTSARRMETTVNAH--QSLPKVLHKRTL
U95551_HBx_P-RF-DE        AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
MK321265_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
MK052967_HBx_P-RF-BD      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
MH464851_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
MH464835_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HVLPKVLYKRTL
MG893555_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
MG893554_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFASARRMETTVNAH--QVLPKVLHKRTL
MG826151_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
MG826146_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
MF967563_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RMLPKVLHKRTL
MF618346_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
MF488705_HBx_P-RF-AD      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
MF488699_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
M38454_HBx_P-RF-CB        AHLSLRGLPVCAFSSAGPCALPFTSARRMETTVNAH--QVLPKVLHKSTL
LC458432_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KY629632_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
KY470893_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KY363272_HBx_P-RF-CB      AHLPLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
KX827302_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KX660682_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KX660680_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KX660677_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KX660674_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KX096713_HBx_P-RF-CA      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKKTL
KU964351_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964317_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964316_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964315_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964314_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964313_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964312_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964311_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964310_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964309_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964308_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALHFTSARRMETTVNAH--QVLPKVLHKRTL
KU964307_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964306_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964305_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964304_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964303_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964010_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964009_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964008_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964007_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964006_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU964005_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963883_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963870_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963869_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963868_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963867_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963866_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963865_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963864_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963863_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963862_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963861_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963860_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963859_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963858_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963857_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963856_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU695746_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
KU679958_HBx_P-RF-CB      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTXNAH--MSLPKVLHKRTL
KU679942_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
X80925_HBx_P-RF-DE        AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HILPKVLHKRAL
MK052968_HBx_P-RF-BD      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RVLPKVLHKRTL
MK052957_HBx_P-RF-DE      AHLPLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
MH481862_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKFLHKRTL
MF925404_HBx_P-RF-AC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
MF925397_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
MF925396_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
MF925388_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
MF925386_HBx_P-RF-AC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
MF925371_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KY470858_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LMLPKVLHKRTL
KU963944_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963943_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963942_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963941_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963940_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCELRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963939_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963935_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963934_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963933_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963932_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963931_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU963930_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
MK052969_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
MG893559_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KX357641_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGTCALRFTSARRMETTVNAH--QILPKVLHKRTL
KX357635_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
KX357634_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
KX357633_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
KX357632_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
KX357630_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
KX357628_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
KX357626_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
KX357625_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
KX357624_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QCLPKVLHKRTL
KX357623_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
KU736923_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KU736917_HBx_P-RF-DE      AHLSLRGLPICAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KU736916_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KU736915_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KU736914_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KU695745_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
X75656_HBx_P-RF-CB        AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
MK052976_HBx_P-RF-BD      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
MK052970_HBx_P-RF-BD      AHLSLRGLPACAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
MH746813_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--LILPKVLHKRTL
MH746812_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--LILPKVLHKRTL
MH746811_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--LILPKVLHKRTL
MG826149_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
MG826145_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--LILPKVLHKRTL
MG826142_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
MF925401_HBx_P-RF-DB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPKVLHKRTL
MF925389_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
LC416040_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KY670781_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KY471007_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--LILPKVLHKRTL
KY471006_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--LILPKVLHKRTL
KY471005_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--LILPKVLHKRTL
KY471004_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--LILPKVLHKRTL
KY471003_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--LILPKVLHKRTL
KY471002_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--LILPKVLHKRTL
KY471001_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--LILPKVLHKRTL
KY471000_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--LILPKVLHKRTL
KY470999_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--LILPKVLHKRTL
KY470998_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--LILPKVLHKRTL
KY470997_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--LILPKVLHKRTL
KY470996_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--LILPKVLHKRTL
KU695743_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
KU695741_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
KY470871_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
KX354997_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
KY470865_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKILHKRTL
MH368022_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
KX660689_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMATTVNAH--LVLPKVLHKRTL
KX660686_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
KX660684_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
KU964380_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKWTL
KU964379_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKWTL
KU964374_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKWTL
KU964372_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKWTL
KU964370_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKWTL
KU964367_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKWTL
KU679956_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
KU964366_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKWTL
KU679945_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSACRMATTVNAH--MILPKVLHKRTL
KF873538_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSACRMATTVNAH--MILPKVLHKRTL
KF873537_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSACRMATTVNAH--MXLPKVLHKRTL
KF873543_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSACRMATTVNAH--MILPKVLHKRTL
KF873540_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSACRMATTVNAH--MILPKVLHKRTL
KF873542_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSACRMATTVNAH--MILPKVLHKRTL
KJ803788_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QDFPSGLHKRTL
KF873530_HBx_P-RF-CB      THLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MMLPKVLHKRTL
KP148441_HBx_P-RF-GC      AHLSLRGLPVCAFPSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
KP148442_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
KP148447_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
KP148449_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
KP148450_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
JN688689_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARXMETTVNAH--QILPKVLHKRTL
HQ700520_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--IVLPKVLHKRTL
KP148586_HBx_P-RF-GC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
KF192833_HBx_P-RF-DE      AHLSLRGLPVCALSSAGPCALRFTYARCMETTVNAH--RILPKVLHKRTL
GQ331048_HBx_P-RF-AE      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QSLPKVLHKRTL
FJ904406_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KP168416_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KC774432_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
HQ700542_HBx_P-RF-CB      AYLSLRGLPVCAFSSAGPCALRFTSARRMEATMNAH--QVLPKVLHKRTL
EU787434_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774422_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KC774458_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774474_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774495_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
HQ700494_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
HQ700500_HBx_P-RF-DE      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KJ586803_HBx_P-RF-AF      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QILPKVLHKRTL
KC774476_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JQ027310_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAC--QVLPKVLHKRTL
FN594767_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QLLPKVLYKRTL
KJ410497_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KJ598675_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
HQ700580_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
FJ023659_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
FJ349241_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
KU679954_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LILPKVLHKRTL
HM750145_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--LVLPKVLHKRTL
FJ904442_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904430_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
KJ470897_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904397_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904417_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KP168420_HBx_P-RF-DE      AHLSLRGLPVCAFSFAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
KP168421_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
FJ349207_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
FJ904425_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
GQ377522_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377626_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QXLPKVLHKRTL
KM606750_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KJ803804_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KF192839_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RILPKVLHKRTL
KF192836_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RILPKVLHKRTL
KF192835_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RILPKVLHKRTL
KF192837_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RILPKVLHKRTL
KF192838_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RILPKVLHKRTL
KF192840_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RILPKVLHKRTL
KF192841_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RILPKVLHKRTL
KU668440_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALCFTSARRMETTVNAH--RILPKVLHKRTL
KC774198_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774201_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JQ801476_HBx_P-RF-CG      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
HQ700533_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700536_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMATTVNAH--QILPKVLHKRTL
GQ161754_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QISPKVLHKRTL
FN594771_HBx_P-RF-DE      SHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FN594769_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904444_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904440_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904428_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904416_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904409_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KJ470898_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904408_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904407_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904404_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904396_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QXLPKVLHKRTL
FJ904401_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QSLPKVLHKRTL
FJ904436_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700492_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
DQ991753_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RSLPKVLCKRTL
AY341335_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JN664946_HBx_P-RF-DA      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
AM494716_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
AB241109_HBx_P-RF-CB      AHLSLRGLPVCAFSPAGPCALRFTSARCMETTVNAH--QVLPKVLHKRTL
AB048702_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
AB048703_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
FJ692536_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904400_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904441_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
GU177079_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KF170740_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KJ470891_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KM606741_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KM606751_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
AB188243_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HVLPKVLHKRTL
JN642141_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HFLPKVLHKRTL
JN642152_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HFLPKVLHKRTL
JF754613_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QCLPKVLHKRTL
JN257174_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
JN257191_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
JN642137_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLYKRTL
JN257206_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
JN257207_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
JN257216_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
KT003704_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KJ470887_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KC774450_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
FJ904398_HBx_P-RF-DE      AHLSLRGLPVCAFSXAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
AY233293_HBx_P-RF-DE      AHLSLRGLPICAFSSAGPCALRFTSARGMETTVNAH--QILPKVLHKRTL
AB330368_HBx_P-RF-DA      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
AB033558_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKILHKRTL
AB674433_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JF754616_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QCLPKVLHKRTL
JN257154_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLYKRTL
JN257164_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QXLPKVLHKRTL
JN257204_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
JN642127_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
JN642139_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
KJ803785_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLYKRTL
KJ470892_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQIQILPKVLHKRTL
JQ687532_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RFLPKVLHKRTL
KP995112_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KP168418_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KP168417_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KP148352_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KJ803798_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KJ647356_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QILPKVLHKRTL
KJ647351_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QILPKVLHKRTL
AB033559_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904394_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904403_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904405_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904414_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QSLPKVLHKRTL
FJ904437_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
FJ904447_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVTAH--QILPKVLHKRTL
HQ700493_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700497_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700501_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700503_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700524_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700525_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700534_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700535_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700537_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700538_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700540_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700541_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700579_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
HQ700581_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700582_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700583_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700584_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
HQ700585_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
KP288875_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KJ470890_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KJ470888_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KJ470886_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KJ470884_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KM577667_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KM577666_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KM577665_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KM577664_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KM577663_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KM524359_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QFLPKVLHKRTL
KM524337_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
KM524336_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QILPKVLHKRTL
JQ801477_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KU519423_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JN688715_HBx_P-RF-DE      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QILPKVLHKRTL
KJ410506_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
EU939547_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
FJ562302_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
FJ562247_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVVHNRTL
KC315400_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--GNLPKVLHKRTL
AB367393_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KJ173320_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QNLPKVLHKRTL
KJ173322_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QNLPKVLHKRTL
GQ377595_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--RNLPEVLHKRTL
KY470845_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRIETTVNAH--QVLPKVLHKRTL
KY470848_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRIETTVNAH--QVLPKVLHKRTL
KY470851_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRIETTVNAH--QVLPKVLHKRTL
KY470852_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRIETTVNAH--QVLPKVLHKRTL
KM875422_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774349_HBx_P-RF-CB      AHLSLRGFPVCALSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
JF436922_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPRALRFTSARRMETTVNAH--QVLPKVLHKRTL
JF436919_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGLCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GU357843_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYNRTL
GQ377596_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
FJ562317_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
FJ562267_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU939620_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU589337_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRLTSARRMETTVNAH--QVLPKVLYKRTL
FJ032343_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRLTSARRMETTVNAH--QVLPKVLYKRTL
AY862865_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AY817515_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774457_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AY817510_HBx_P-RF-DC      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNVH--QVLPKVLHKRTL
AY236161_HBx_P-RF-DA      AHLSLRGLPVCAFSSAGPCARRFTSARCMETTVNAH--QILPKVLHKRTL
AY123041_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNGH--QVLPKLLHKRTL
KC774430_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTH--QVLPKVLHKRTL
AB195950_HBx_P-RF-CB      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB195951_HBx_P-RF-CB      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB049609_HBx_P-RF-CB      AHLSVRGLPVCAISSPGPCALRFTSARRMETTVNAH--QALPKVLHKRTL
EU939565_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
GQ377534_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU939589_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
KC774188_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTH--QVLPKVLHKRTL
KC774481_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
FJ562287_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
EU939630_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARHMETTVNAH--QVLPKVLHKRTL
EU872014_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU871983_HBx_P-RF-CB      AHLSLRGLPVCASPSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU871981_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETAVNAH--QVLPKVLYKRTL
EU871999_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETAVNAH--QVLPKVLYKRTL
EU871986_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
JX661494_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
FJ562336_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377634_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AF461361_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
FJ562305_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLXKRTL
GU385774_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
KC774294_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EF494376_HBx_P-RF-CA      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HVLPKVLYKRTL
FJ562278_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KT991419_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KT991421_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
HQ700509_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--MVLPKVLHKRTL
KJ173329_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HVLPKVLHKRTL
KJ173330_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--HVLPKVLHKRTL
KU963990_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KU963991_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KU963993_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KU963994_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KU963995_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KU963998_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KU963999_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KU964001_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KU964003_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KT991417_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KT991420_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KT991423_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774497_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774453_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRLTSARRMETTVNAH--QVLPKVLHKRTL
KC774425_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774323_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JX429898_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JX429896_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JQ040146_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QALPKVLHKRTL
JQ040148_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JN664935_HBx_P-RF-DC      AHLSLRGLPVCAFTSAGPCALRFTSARRMETTVNAR--QVLPKVLYKRTL
JF828935_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMEATVNAH--QVLPKVLYKRTL
JF828934_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTH--QVLPKVLYKRTL
GQ377560_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNNR--QVLPKVLHKRTL
GQ377544_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377516_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774344_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
FJ562328_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QALPKVLHKRTL
JF828933_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
JF828936_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
JF828938_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
FJ562271_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
FJ562229_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
FJ386593_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTMNAH--QVLPKVLHKRTL
FJ386581_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU939668_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU939577_HBx_P-RF-CB      ENLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU919166_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU919167_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
FJ386586_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSVRRMETTVNAH--QVLPKVLHKRTL
KC774470_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU871995_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU871987_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU871988_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU871990_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU871994_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU882006_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
FJ562226_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU871984_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU871985_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU871989_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU871991_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU871992_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU871993_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU871996_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU872015_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU589339_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU522070_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EF494378_HBx_P-RF-CA      AHLSLRGLPVCAFPSAGPCALRFTSARCMETTVNAH--QILPKVLHKRTL
DQ478897_HBx_P-RF-DC      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
DQ478889_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTI
JF491448_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774424_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774478_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774480_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
DQ478887_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774479_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KR013843_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETSVNAH--QVLPKVLYKRTL
DQ478886_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
AY862866_HBx_P-RF-DC      ARLSLRGLPVCAFSSAGPCAPRFTSARRMETTVNAH--QVLPKVLHKRTL
AY817512_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AY206374_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTR--QVLPKVLHKRTL
AY123424_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU871997_HBx_P-RF-CB      AHLSLRGLPVCAFPSAGPCALRFTSTRRMETTVNAH--QVLPKVLHKRTP
EU939621_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QALPKVLHKRTL
JX661498_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774498_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB642096_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB453985_HBx_P-RF-AC      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAH--QVLPKVLHKRTL
FJ032337_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB300369_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
KM213033_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB195956_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB195957_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB195939_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB195940_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB195941_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB014375_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB670303_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU939551_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KJ803822_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARHMATTVNAH--QALPKVLHKRTL
KC774499_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774487_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774431_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTH--QVLPKVLHKRTL
FJ562314_HBx_P-RF-CB      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU916239_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU916241_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774486_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB198084_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AY167095_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
DQ478892_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU787444_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU916228_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU916232_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU916240_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU939581_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
FJ386578_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
FJ386585_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
FJ386649_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
FJ787446_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
FJ787480_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377548_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETPVNAH--QVLPKVLHKRTL
GQ377549_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377565_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
HQ700526_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
HQ700547_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JF491449_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JF491451_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JF491456_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JN400086_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JQ040142_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JX026887_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
JX661487_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774186_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774193_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774230_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774234_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774258_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774263_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774291_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774307_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774317_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KC774322_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KC774324_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774328_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774434_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774435_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774442_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774443_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774448_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774452_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774455_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774463_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774468_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774472_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774483_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774489_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774490_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KF917451_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KJ173325_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KJ173326_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
KJ410520_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALHFTSARRMETTVNAR--QVLPKVLHKRTL
KP276254_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KP276255_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KR013806_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KR013816_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JF491455_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774488_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JQ040174_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JQ040175_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU787435_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ475335_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB033557_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB674504_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLHKRTL
FJ386635_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KU519422_HBx_P-RF-DC      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774492_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774341_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774332_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JX504540_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
FJ562227_HBx_P-RF-CB      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
JQ732168_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB205152_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
AB270535_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSTRRMETTVNAH--QVLPKVLYKRTL
AB367400_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB367419_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QALPKVLYKRTL
AF330110_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
AY247030_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AY862864_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
DQ478898_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU717211_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
EU881995_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU939602_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU939606_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
EU939632_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAR--QVLPKVLYKRTL
FJ386633_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
FJ386643_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLXKRTL
FJ562277_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
FJ562294_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
GQ377556_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377564_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377581_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377590_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377604_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377611_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377614_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377627_HBx_P-RF-CD      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377633_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JX661485_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
JX661486_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774183_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774305_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMATTVNAH--QILPKVLHKRTL
KC774414_HBx_P-RF-BC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774423_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774428_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
KC774449_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
KC774454_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774466_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
KC774471_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774484_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774494_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774212_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAN--QVLPKVLHKRTL
JQ707714_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLYKRTL
AB195955_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
AB367800_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
FJ562223_HBx_P-RF-CD      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377539_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
KC774493_HBx_P-RF-DC      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377607_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377594_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
GQ377602_HBx_P-RF-CB      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAH--QVLPKVLHKRTL
                               * :.  .   ..      : .  : :.              :   

Y18856_HBx_P-RF-CB        GLSAMSTTDPEAYFKDCVFTYWRELGAEGRLKVFVLGGCRHKLVRSPAPC
Y18857_HBx_P-RF-CB        GLSAMSTTDPEAYFKDCVFTYWRELGAEGRLKVFVLGGCRHKLVRSPAPC
KC774246_HBx_P-RF-CB      GLLAGSKSCRQAYFQASKIKEWEELGEEIRLRICVLGGCRHKLVCSPAPC
JN664943_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPW
KC774461_HBx_P-RF-DC      GLSARLTTLLESYFKACLLKDWEEFGEEIRLKVRGLGGCRHKLVCSPAPC
KC774475_HBx_P-RF-DC      GLSAMLTTVLEAYFKACLFKEREELGEERRLKVLVLGGCRHKLVCAPAPC
KC774433_HBx_P-RF-DC      GLSAMSTPDLEAYLKDCVFKDGEELGEEIRLKVFVLGGCRHKLVCSPAPC
JQ272887_HBx_P-RF-GF      GLFVMSTTGVEKYFKDCVFADWEELGNESRLMTFVLGGCRHKLVCAPAPC
EU833890_HBx_P-RF-GA      GLFVMSTTGVEKYFRDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPS
AB933279_HBx_P-RF-AG      GLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPC
AB933280_HBx_P-RF-AG      GLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPC
AB933281_HBx_P-RF-AG      GLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPC
HE981179_HBx_P-RF-FG      GLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPC
HE981180_HBx_P-RF-GF      GLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPC
JQ272886_HBx_P-RF-GF      GLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPC
KP274926_HBx_P-RF-GA      GLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPC
KF219922_HBx_P-RF-GH      GLFVMSTTGVEKYFKDCVFAEWEELGNESRLXTFVLGGCRHKLVCAPAPC
AB933282_HBx_P-RF-AG      GLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPC
AB933283_HBx_P-RF-AG      GLFVMSTTGVEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCAPAPC
JQ707469_HBx_P-RF-GA      GLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707468_HBx_P-RF-GA      GLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
EU833889_HBx_P-RF-GA      GLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCAPAPC
JQ707421_HBx_P-RF-GA      GLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707424_HBx_P-RF-GA      GLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707426_HBx_P-RF-GA      GLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707430_HBx_P-RF-GA      GLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707432_HBx_P-RF-GA      GLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707441_HBx_P-RF-GA      GLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIFVLGGCRHKLVCSPAPC
JQ707448_HBx_P-RF-GA      GLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707450_HBx_P-RF-GA      GLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707456_HBx_P-RF-GA      GLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707457_HBx_P-RF-GA      GLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707458_HBx_P-RF-GA      GLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707459_HBx_P-RF-GA      GLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707460_HBx_P-RF-GA      GLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707461_HBx_P-RF-GA      GLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707462_HBx_P-RF-GA      GLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707463_HBx_P-RF-GA      GLFVMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707464_HBx_P-RF-GA      GLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707465_HBx_P-RF-GA      GLFGMSTTGMEKYFKDCVFTEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707466_HBx_P-RF-GA      GLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707467_HBx_P-RF-GA      GLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707470_HBx_P-RF-GA      GLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707471_HBx_P-RF-GA      GLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707472_HBx_P-RF-GA      GLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707473_HBx_P-RF-GA      GLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707475_HBx_P-RF-GA      GLFGMSTTGMEKYFKDCVFAEWEELGNESRLMIYVLGGCRHKLVCSPAPC
JQ707445_HBx_P-RF-GA      GLFVMSTTGMEKYFKDCVFAEWEELGNESRLMTFVLGGCRHKLVCSPAPC
AY161140_HBx_P-RF-AD      GLSAMSTTDLEAYFKDCLFRDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AY161141_HBx_P-RF-AD      GLSAMSTTDLEAYFKDCLFRDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AY161147_HBx_P-RF-DA      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPC
AY161145_HBx_P-RF-AD      GLPAMSTTDLEAYFKDCVFRDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AY161146_HBx_P-RF-AD      GLPAMSTTDLEAYFKDCVFRDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KF214656_HBx_P-RF-AC      GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
GQ161753_HBx_P-RF-AE      GLPAMSTTDLEAYFRDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSC
AY233277_HBx_P-RF-AC      GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KJ586810_HBx_P-RF-AF      GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSSC
AB674412_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEETRLQLFVLGGCRHKLVRAPAPC
GQ377630_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFNEWEESGEEVRLKIFVLGGCRHKLVCSPAPC
KJ803782_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFTEWEELGEEIKVKVFVLGGCWHKLVCSPAPC
KC774178_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPC
KC774364_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPC
GQ377635_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFNEWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KJ803791_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KJ803802_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFNEWEELGEEMRLKIFVLGGCRHKLVCSPAPC
HQ684848_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFTEWEEEGEEIRLKVFVLGGCRHKLVCSPAPC
KJ173279_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KJ173280_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KP148337_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU939629_HBx_P-RF-BC      GLSTMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KJ173350_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MF925370_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MF925402_HBx_P-RF-BD      GLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KJ173358_HBx_P-RF-CB      GLLAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KJ173349_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFNDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
JF436923_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFNEWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ386674_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPLPC
AF233236_HBx_P-RF-CB      GLSAMSTNDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU660227_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU939631_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFTEWEELGEEMRLKVFVLGGCRHKLVCSPPPC
KJ803778_HBx_P-RF-BC      GLSAMPTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCMHKLVCSPAPC
KJ803803_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPC
KJ803772_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFTEWEELGEESRLMIFVIGGCRHKLVCSPAPC
HQ700531_HBx_P-RF-CB      GLCAMSTTDLEAYFKDCVFKDWKELGEEIRLKVFVLGGCRHKLVCSPAPC
AB031265_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HM146131_HBx_P-RF-AD      GLSVMSTTDLEAYFKDCVFKDWEKVGEEIRLKVFVLGGCRHKLVCAPPSC
JF440003_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWGELGEEIRLKVFVLGGCRHKLVCAPAPC
JF440002_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWGELGEEIRLKVFVLGGCRHKLVCAPAPC
JF440017_HBx_P-RF-DA      GLSAMSTTDLEAYFKDCLFKDWGELGEEIRLKVFVLGGCRHKLVCAPAPC
DQ464165_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLQLFVLGGCRHKLVCAPAPC
DQ464166_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLQLFVLGGCRHKLVCAPAPC
DQ464167_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLQLFVLGGCRHKLVCAPAPC
DQ464164_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLQLFVLGGCRHKLVCAPAPC
EU185780_HBx_P-RF-AD      GLSTMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF440011_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF440015_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF440006_HBx_P-RF-DE      GLFAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB210819_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AJ627221_HBx_P-RF-DE      GLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JX898686_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JX898690_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JX898693_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JX898695_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JX898696_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF439994_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF439995_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF439996_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF439998_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF439999_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF440000_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF440001_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF440004_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF440005_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF440007_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF440008_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF440009_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF440010_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF440012_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF440013_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF440014_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AJ344117_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLRGCMHKLVCAPAPC
FJ349221_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPC
JX898688_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPC
JN040803_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEETRLKLFVLGGCRHKLVCAPAPC
JX898687_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
HQ700554_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEELRLKIFVLGGCRHKLVCSPVPC
HM750150_HBx_P-RF-DC      GLSALSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
GQ377592_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFNDWEEFGEEIRLMIFVLGGCRHKLVCSPAPC
MF925392_HBx_P-RF-DB      GLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVVGGCRHKLVCSPAPC
KJ586811_HBx_P-RF-DF      GLFAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPC
KJ173299_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KJ173300_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC875338_HBx_P-RF-DE      GLSTMSMTDLEQYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
GQ205379_HBx_P-RF-DE      GLSTMSTTELEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB493842_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPPPC
EF103284_HBx_P-RF-AD      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
EU594435_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
MG826150_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIYVLGGCRHKLVRSPASC
KF214680_HBx_P-RF-GC      GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCAPAPC
EU939627_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFTEWEELGEEVRLMIFVLGGCRHKLVRSPAPC
AB105172_HBx_P-RF-CB      GLSVMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774222_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
HQ700498_HBx_P-RF-CB      GLSALSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HQ700499_HBx_P-RF-CB      GLSALSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HQ700462_HBx_P-RF-CB      GLSTMSTTDLEAYFKDCVFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPC
FJ386646_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLDCPPAPC
FJ361772_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFTDWEELGEESRLMTFVLGGCRHKLVCSPAPC
FJ349212_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLQIFVLGGCRHKLVCAPAPC
AP011108_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC875339_HBx_P-RF-DE      ELSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ205377_HBx_P-RF-DE      GLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ205378_HBx_P-RF-DE      GLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ205387_HBx_P-RF-DE      GLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JN664925_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
DQ315779_HBx_P-RF-DE      GLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ205386_HBx_P-RF-DE      GLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JN664934_HBx_P-RF-DE      GLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KT366505_HBx_P-RF-DE      GLSTMSTTDLEQYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MF925360_HBx_P-RF-DB      GLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU679952_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCSPAPC
KR905422_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
KT366503_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
KF873527_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774447_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPC
JN688717_HBx_P-RF-DE      GLSGMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGWRHKLVCAPAPC
JN664929_HBx_P-RF-DE      GLSTMSTTDLEQYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
JN664915_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JN642160_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFNDWEELGEETRLMIFVLGGCRHKWVCGPAPC
JN104438_HBx_P-RF-CB      GLSAMSTTNLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
JN040798_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700532_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPVPC
HQ700523_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
HQ700519_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMXFVLGGCRHKLVCSPAPC
HQ700507_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEEVGEEIRLKVFVLGGCRHKLVCSPAPC
HQ700505_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
GQ358156_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
GQ161788_HBx_P-RF-AE      GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVYVLGGCRHKLVCAPAPC
GQ161837_HBx_P-RF-AE      GLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVYVLGGCRHKLVCAPAPC
HF571060_HBx_P-RF-AE      GLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161767_HBx_P-RF-AE      GLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
FR714496_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
FN594770_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEXRLMIFVLGGCRHKLVCAPAPC
EU594436_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
EF103283_HBx_P-RF-AD      GLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPC
DQ315780_HBx_P-RF-DE      GLSAMSTTDLEQYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
JN664940_HBx_P-RF-DE      GLSTMSTTDLEQYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
AY373430_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AY057948_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
AP011105_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVRSPAPC
AJ627217_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
DQ111987_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KT366504_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPC
AF297619_HBx_P-RF-DA      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB674436_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEENRLMIYVLGGCRHKLVCAPAPC
AB674432_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
KJ803827_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
AB583679_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB194949_HBx_P-RF-AE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
AB188245_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPC
EF103282_HBx_P-RF-AD      GLSVMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPC
KJ803771_HBx_P-RF-DB      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KM524357_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KC172106_HBx_P-RF-GB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAAC
FJ023667_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU833891_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
AP011102_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
AF297620_HBx_P-RF-DA      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AP011104_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
AY817509_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
GQ924618_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HM750133_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
JN104442_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIXLKVFVLGGCRHKLVCSPAPC
KC774482_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKMVCAPAPC
KC774439_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FR714490_HBx_P-RF-GB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPTPC
FJ882610_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KP276256_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KP276253_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774456_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HM750149_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HM750148_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HM750147_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HM750144_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HM750143_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HM750142_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ882618_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ882614_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ882617_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLXVFVLGGCRHKLVCSPAPC
DQ478890_HBx_P-RF-DC      GLSVMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU835240_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ023664_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ023665_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ023666_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ023668_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ023670_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FJ023673_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ882611_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ882612_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ882613_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HQ700527_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HQ700528_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF873531_HBx_P-RF-CB      GLSXMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF873532_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF873533_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF873534_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF873511_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF873513_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF873515_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF873517_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU679939_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF873521_HBx_P-RF-BC      GLSALSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HQ700560_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEELRLKVFVLGGCRHKLVCSPAPC
HQ700530_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HQ700521_HBx_P-RF-CB      GLSVMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HQ700518_HBx_P-RF-CB      GLSAMSTADLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HQ700508_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
AY233295_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
DQ315777_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
EF103285_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ183486_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GU563560_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JN664933_HBx_P-RF-DA      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KM359442_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEHRLMIFVLGGCRHKLVCAPAPC
KF679991_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
KM386676_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
GQ161806_HBx_P-RF-EA      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPSXC
FJ562263_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPC
KT991424_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPC
KT991427_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPC
AB493837_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
AB493838_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
AB493840_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
AB493847_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
AP011103_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
GQ358155_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF873535_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
HQ700485_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEXRLKVFVLGGCRHKLVCSPAPC
HQ700557_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRXKVXVLGGCRHKLVCSPAPC
KU679940_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
AY040627_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU594406_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
JN257210_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
KJ803753_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
MF925384_HBx_P-RF-DB      GLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPC
MF925382_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MF488702_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGWKHKLVCAPAPC
KU679955_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPC
KU679953_HBx_P-RF-BC      GLSALSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF873522_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KC012653_HBx_P-RF-AD      GLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFILGGCRHKLVCAPAPC
JN257189_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPC
KF873523_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLXXFVLGGCRHKLVCSPAPC
KF873524_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MG826148_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KY881840_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KY363263_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KY363262_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KU679948_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIXVLGGCRHKLVCSPAPC
KU679944_HBx_P-RF-BC      GLSALSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KT366492_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KJ647349_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEXRLMIFVLGGCRHKLVCAPAPC
KF471643_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPC
FJ023662_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
DQ089798_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
AY800249_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
AF411409_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
AB270538_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU679950_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU679946_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF873518_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEXRLXXFVLGGCRHKLVCSPAPC
KF873519_HBx_P-RF-CB      GLSAMATTDLEAYFKDCLFKDWEELGEEIRLKXFVLGGCRHKLVCSPAPC
MH481859_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKASEELGEEIRLKVFVLGGCRHKLVCSPAPC
MG826144_HBx_P-RF-CB      GLSAMSTTGLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KX765835_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KX660685_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEESGEEIRLMIFVLEGCRHKLVSPSAPC
KX357629_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKMVCAPAPC
KU695744_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774426_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774420_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MH481861_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLRVFVLGSCSHKLVCASRSP
MH481860_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCSHKLVCASRSP
MH481858_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCASRSP
MH464852_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH464846_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH094410_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFKEWEELGEEIRLKVFVLGGCRHKLVRSPAPC
MG893561_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MG826141_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
MF925381_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVVGGCRHKLVCSPAPC
LC279267_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
LC279266_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
LC279265_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
LC279264_HBx_P-RF-CB      GLSAMSTTDLEAYSKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
LC279263_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KY363273_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KX774505_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KX660675_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KX357636_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
KX357631_HBx_P-RF-DE      GLSTMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGRRHKMVCAPAPC
KU695742_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU679941_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEXRLXXFVLGGCRHKLVCSPAPC
KC774485_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
HM750146_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
AY817511_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
MG826147_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKDFVLGGCRHKLVCSPAPC
MF593359_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEESGEELRLKVFVLGGCRHKLVCAPAPC
KU963938_HBx_P-RF-CB      GLAAMSTTDLDAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963936_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
JX898698_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JX898699_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
X65259_HBx_P-RF-DA        GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH685719_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KY470855_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KY470854_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KY470853_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGDETRLMIFVLGGCRHKLVCSPAPC
KY470850_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KY470849_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KY470847_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KY470846_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KY470844_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KY470843_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KX827299_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KX357627_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKMVCAPAPC
KU736922_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU736921_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU711666_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU679943_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVXXLGGCRHKLVCSPAPC
X68292_HBx_P-RF-DA        GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
U95551_HBx_P-RF-DE        GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MK321265_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MK052967_HBx_P-RF-BD      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFELGGCRHKLVCSPAPC
MH464851_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MH464835_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
MG893555_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MG893554_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MG826151_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
MG826146_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKDFVLGGCRHKLVCSPAPC
MF967563_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MF618346_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MF488705_HBx_P-RF-AD      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MF488699_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
M38454_HBx_P-RF-CB        GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
LC458432_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KY629632_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KY470893_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KY363272_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KX827302_HBx_P-RF-DE      GLSAMSTADLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPC
KX660682_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGACRHKLVCSPAPC
KX660680_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KX660677_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KX660674_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KX096713_HBx_P-RF-CA      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KU964351_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KU964317_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964316_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964315_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964314_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964313_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964312_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964311_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964310_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964309_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964308_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964307_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964306_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964305_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964304_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964303_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964010_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964009_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964008_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964007_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964006_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964005_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963883_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU963870_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963869_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963868_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963867_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963866_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963865_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963864_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963863_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963862_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963861_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963860_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963859_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963858_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963857_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963856_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU695746_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU679958_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPXPC
KU679942_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLXXFVLGGCRHKLVCSPAPC
X80925_HBx_P-RF-DE        GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MK052968_HBx_P-RF-BD      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCSPAPC
MK052957_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
MH481862_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEENRLKVFELGGCSHKLVCAPAPS
MF925404_HBx_P-RF-AC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MF925397_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MF925396_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MF925388_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MF925386_HBx_P-RF-AC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MF925371_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KY470858_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEEFGEEARLMIYVLGGCRHKLVCSPAPC
KU963944_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963943_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963942_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963941_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963940_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963939_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963935_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963934_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963933_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963932_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963931_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963930_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MK052969_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGGETRLKVFVLGGCRHKLVCSPAPC
MG893559_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KX357641_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KX357635_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KX357634_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPC
KX357633_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KX357632_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPC
KX357630_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVLVLGGCRHKLVCAPAPC
KX357628_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPF
KX357626_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPC
KX357625_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEESRLKVFVLGGCRHKLVCAPAPC
KX357624_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
KX357623_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU736923_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU736917_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU736916_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU736915_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU736914_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU695745_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
X75656_HBx_P-RF-CB        GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
MK052976_HBx_P-RF-BD      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MK052970_HBx_P-RF-BD      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MH746813_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MH746812_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MH746811_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MG826149_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVIGGCRHKLVCSPAPC
MG826145_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MG826142_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
MF925401_HBx_P-RF-DB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
MF925389_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLRIFVLGGCRHKLVCSPAPC
LC416040_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KY670781_HBx_P-RF-DC      GLXAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KY471007_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KY471006_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCMHKLVCSPAPC
KY471005_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KY471004_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KY471003_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCMHKLVCSPAPC
KY471002_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KY471001_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KY471000_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KY470999_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KY470998_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KY470997_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KY470996_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KU695743_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU695741_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KY470871_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEEFGEETRLMIYVLGGCRHKLVCSPAPC
KX354997_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVQERCRHKLVCSPAPC
KY470865_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGDESRLMIYVLGGCRHKLVCSPAPC
MH368022_HBx_P-RF-GC      GLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCAPSPC
KX660689_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KX660686_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KX660684_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964380_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPC
KU964379_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPC
KU964374_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPC
KU964372_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPC
KU964370_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPC
KU964367_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPC
KU679956_HBx_P-RF-CB      GLXXMSTTDLEAYFKDCLFKDWEELGEEXRLKXFVLGGCRHKLVCSPAPC
KU964366_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPC
KU679945_HBx_P-RF-CB      GLSTMSTTDLEAYFKDCVFKDWEELGEETRLXIXVLGGCRHKLVCSPXPX
KF873538_HBx_P-RF-CB      GLSTMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF873537_HBx_P-RF-CB      GLSTXSTTDLEAYFKDCVFKDWEELGEEIRLXIFVXGGCRHKLVCSPAPC
KF873543_HBx_P-RF-CB      GLSTMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF873540_HBx_P-RF-CB      GLSTMSTTDLEAYFKDCVFKDWEELGEEIRLXXFVLGGCRHKLVCSPAPC
KF873542_HBx_P-RF-CB      GLSTMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KJ803788_HBx_P-RF-CB      GLSAMSTTDVEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF873530_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCSPAPC
KP148441_HBx_P-RF-GC      GLSAVSTTDLEAYFKDCVFKDWEGLGEETRLMIFVLGGCRHKLVCAPAPC
KP148442_HBx_P-RF-BC      GLSAVSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
KP148447_HBx_P-RF-GC      GLSAVSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
KP148449_HBx_P-RF-GC      GLSAVSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
KP148450_HBx_P-RF-GC      GLSAVSTTDLEAYFKDCVLKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
JN688689_HBx_P-RF-DE      GLFAKSTTDLEAYFKNCLFKEWEELGEEIRLKVFVLGGCRHKLVWAPAPC
HQ700520_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPVPC
KP148586_HBx_P-RF-GC      GLSAVSTTDLEAYFKDCAFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF192833_HBx_P-RF-DE      GLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ331048_HBx_P-RF-AE      GLSSMSTTDLEAYFKDCVFKDWEESGEEIRLKVYLLGGCRHKLVCAPAPC
FJ904406_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KP168416_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KC774432_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HQ700542_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU787434_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRIMIFELGRCTHTLHCSPEPC
KC774422_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774458_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPC
KC774474_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPC
KC774495_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700494_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLLKDWEELGEELRLKVFVLGGCRHKLVCAPPPC
HQ700500_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLLKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KJ586803_HBx_P-RF-AF      HFFWGSITWIEEYIKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774476_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFTDWEELGEEIRLKALVLGGCRHKLVCAPAPC
JQ027310_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFTEWEELGEEARLKVFVLGGCRHKLVCSPAPC
FN594767_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
KJ410497_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIYVLGGCRHKLVCSPAPC
KJ598675_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
HQ700580_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
FJ023659_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
FJ349241_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KU679954_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
HM750145_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
FJ904442_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
FJ904430_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
KJ470897_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPC
FJ904397_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMXFVLGGCRHKLVCAPAPC
FJ904417_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPC
KP168420_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEXRLQXFVLGGCRHKLVCAPAPC
KP168421_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
FJ349207_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMLFVLGGCRHKLVCAPAPC
FJ904425_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPF
GQ377522_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
GQ377626_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFNDWEELGEEIRLMIFVLGGCRHKLVCSLAPC
KM606750_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
KJ803804_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEGSMLKVFVLGGCRHKLVCSPAPC
KF192839_HBx_P-RF-DE      GLSAMSTTDLEAYFQDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KF192836_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVYAPAPC
KF192835_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KF192837_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KF192838_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KF192840_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KF192841_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KU668440_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELEEEIRLKVFVLGGCRHKLVCAPAPC
KC774198_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774201_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
JQ801476_HBx_P-RF-CG      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HQ700533_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700536_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GQ161754_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FN594771_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FN594769_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FJ904444_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPC
FJ904440_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPC
FJ904428_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEFRLKVFVLGGCRHKLVCAPAPC
FJ904416_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEESRLKVFVLGGCRHKLVCAPAPC
FJ904409_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCVFKDWEELGEELRLKVFVLGGCRHKLVCAPVPC
KJ470898_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPC
FJ904408_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKIFVLGGCRHKLVCAPAPC
FJ904407_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FJ904404_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKEWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FJ904396_HBx_P-RF-DE      GLSTMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
FJ904401_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
FJ904436_HBx_P-RF-DE      GLSTMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
HQ700492_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPC
DQ991753_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPIPC
AY341335_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JN664946_HBx_P-RF-DA      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AM494716_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPC
AB241109_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB048702_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB048703_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FJ692536_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FJ904400_HBx_P-RF-DE      GLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FJ904441_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
GU177079_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KF170740_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KJ470891_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KM606741_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KM606751_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEITLKVFVLGGCRHKLVCAPAPC
AB188243_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPC
JN642141_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPC
JN642152_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPC
JF754613_HBx_P-RF-DE      GLSGMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPC
JN257174_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPC
JN257191_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPC
JN642137_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLELFVLGGCRHKLVCAPAPC
JN257206_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEEXGEEIRLKLFVLGGCRHKLVCAPAPC
JN257207_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEEXGEEIRLKLFVLGGCRHKLVCAPAPC
JN257216_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKLFVLGGCRHKLVCAPAPC
KT003704_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVRSPAPC
KJ470887_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPG
KC774450_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ904398_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPF
AY233293_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCMFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB330368_HBx_P-RF-DA      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLK--VLGGCRHKLVCAPAPC
AB033558_HBx_P-RF-DE      GLSTMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB674433_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JF754616_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JN257154_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JN257164_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVXVLGGCRHKLVCAPAPC
JN257204_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPVPC
JN642127_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPEPC
JN642139_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KJ803785_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEESRLKVFVLGGCRHKLVCSPAPC
KJ470892_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JQ687532_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KP995112_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KP168418_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KP168417_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KP148352_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KJ803798_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEVRLKVFVLGGCRHKLVCSPAPC
KJ647356_HBx_P-RF-DE      GLSVMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPC
KJ647351_HBx_P-RF-DE      GLSGMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPF
AB033559_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FJ904394_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FJ904403_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FJ904405_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FJ904414_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FJ904437_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
FJ904447_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700493_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700497_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700501_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700503_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700524_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700525_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700534_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700535_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVXVLGGCRHKLVCAPAPC
HQ700537_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700538_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700540_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700541_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700579_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPTPC
HQ700581_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700582_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700583_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700584_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
HQ700585_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPTPC
KP288875_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KJ470890_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPG
KJ470888_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPG
KJ470886_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPG
KJ470884_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPG
KM577667_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KM577666_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KM577665_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KM577664_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KM577663_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KM524359_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KM524337_HBx_P-RF-DE      GLSSMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGVCRHKLVCAPAPC
KM524336_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
JQ801477_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU519423_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
JN688715_HBx_P-RF-DE      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KJ410506_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU939547_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEEVGEEIRLKIYVLGGCRHKLVCSPAPC
FJ562302_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPC
FJ562247_HBx_P-RF-CB      GVSSMSTTNLDAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPC
KC315400_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPC
AB367393_HBx_P-RF-CB      GLTAMSTTDLEAYFKDCLFKNWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KJ173320_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KJ173322_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
GQ377595_HBx_P-RF-BC      GLSAMSTTDLEAYFKDCVFTEWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KY470845_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KY470848_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KY470851_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KY470852_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KM875422_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KC774349_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
JF436922_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFTEWEELGEEVRLKVFVLGGCRHKLVCSPAPC
JF436919_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFNEWEELGEEVRLKVFVLGGCRHKLVCSPAPC
GU357843_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
GQ377596_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRYKLVCSQAPC
FJ562317_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPC
FJ562267_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCLFKDWEDLGEETRLMIFVLGGCRHKLVCSPAPC
EU939620_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFTEWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU589337_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
FJ032343_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
AY862865_HBx_P-RF-DC      GLSAMSTTDLEAHFKDCVFKDWEELGEEIRLMIFVQGGCRHKLVCSPAPC
AY817515_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KC774457_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
AY817510_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
AY236161_HBx_P-RF-DA      GLPAMSTTDLEAYFKDCVFKDWEELGEENRLMIYVLGGCRHKLVCAPAPC
AY123041_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774430_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPC
AB195950_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
AB195951_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
AB049609_HBx_P-RF-CB      GLSSMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU939565_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
GQ377534_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU939589_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KC774188_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KC774481_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
FJ562287_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPTPS
EU939630_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
EU872014_HBx_P-RF-CB      GLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMTFVLGGCRHKLVCSPAPC
EU871983_HBx_P-RF-CB      GLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU871981_HBx_P-RF-CB      GLTAMSTTDLEAYFKDCLFKDWGELGEEIRLMIFVLGGCRHKLVCSPAPC
EU871999_HBx_P-RF-CB      GLTAMSTTDLEAYFKDCLFKDWGELGEEIRLMIFVLGGCRHKLVCSPAPC
EU871986_HBx_P-RF-CB      GLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
JX661494_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMILVLGGCRHKLVCSPAPC
FJ562336_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
GQ377634_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEVRLMIFVLGGCKHKLVCSPAPC
AF461361_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEXRLMIFVLGGCRHKLVCSPAPC
FJ562305_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
GU385774_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KC774294_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EF494376_HBx_P-RF-CA      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
FJ562278_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KT991419_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KT991421_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
HQ700509_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KJ173329_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KJ173330_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
KU963990_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963991_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963993_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963994_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963995_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963998_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU963999_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964001_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KU964003_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KT991417_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KT991420_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KT991423_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KC774497_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKMVCAPAPC
KC774453_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCVPAPC
KC774425_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCVPAPC
KC774323_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
JX429898_HBx_P-RF-DC      GFSAMSTTDLEAYFKDCVFKDWEELGEEFRLKVFVLGGCRHKLVCSPAPC
JX429896_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
JQ040146_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
JQ040148_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
JN664935_HBx_P-RF-DC      GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
JF828935_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKIFVLGGCRHKLVCSPAPC
JF828934_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKIFVLGGCRHKLVCSPAPC
GQ377560_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
GQ377544_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
GQ377516_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPG
KC774344_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ562328_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKNWEELGEEIRLMIFVLGGCRHKLVCSPAPC
JF828933_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKIFVLGGCRHKLVCSPAPC
JF828936_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKIFVLGGCRHKLVCSPAPC
JF828938_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKNWEELGEEIRLKIFVLGGCRHKLVCSPAPC
FJ562271_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPC
FJ562229_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSSAPC
FJ386593_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPC
FJ386581_HBx_P-RF-CB      GLSSMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
EU939668_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
EU939577_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKIYVLGGCRHKLVCSPAPC
EU919166_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPC
EU919167_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCSPAPC
FJ386586_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPC
KC774470_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEESRLMIFVLGGCRHKLVCSPAPC
EU871995_HBx_P-RF-CB      GLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU871987_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU871988_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU871990_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU871994_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU882006_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCVFRDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
FJ562226_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU871984_HBx_P-RF-CB      GLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU871985_HBx_P-RF-CB      GLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU871989_HBx_P-RF-CB      GLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU871991_HBx_P-RF-CB      GLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU871992_HBx_P-RF-CB      GLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU871993_HBx_P-RF-CB      GLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU871996_HBx_P-RF-CB      GLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU872015_HBx_P-RF-CB      GLTAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
EU589339_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU522070_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEESGEEIRLKVFVLGGCRHKLVCSPAPC
EF494378_HBx_P-RF-CA      GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
DQ478897_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
DQ478889_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLKVFVLGGCRHKLVCSPAPC
JF491448_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLKVFVLGGCRHKLVCSPAPC
KC774424_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLKVFVLGGCRHKLVCSPAPC
KC774478_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLKVFVLGGCRHKLVCAPAPC
KC774480_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLKVFVLGGCRHKLVCAPAPC
DQ478887_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLKIFVLGGCRHKLVCSPAPC
KC774479_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEEFGEEIRLMIFVLGGCRHKLVCAPAPC
KR013843_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEEFGEEIRLMIFVLGGCRHKLVCSPAPC
DQ478886_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
AY862866_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
AY817512_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCSPAPC
AY206374_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
AY123424_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU871997_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU939621_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
JX661498_HBx_P-RF-CB      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774498_HBx_P-RF-DC      GLAAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB642096_HBx_P-RF-CB      GLSSMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
AB453985_HBx_P-RF-AC      GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIYVLGGCRHKLVCAPVPC
FJ032337_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
AB300369_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KM213033_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
AB195956_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVYSPAPC
AB195957_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVYSPAPC
AB195939_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
AB195940_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
AB195941_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCSPAPC
AB014375_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
AB670303_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
EU939551_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEETRLMIFVLGGCRHKLVCSPAPC
KJ803822_HBx_P-RF-CB      GLPAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774499_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
KC774487_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKMVCAPAPC
KC774431_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFTDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ562314_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU916239_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU916241_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774486_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPC
AB198084_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
AY167095_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
DQ478892_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU787444_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU916228_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU916232_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU916240_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
EU939581_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ386578_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ386585_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ386649_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ787446_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
FJ787480_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
GQ377548_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
GQ377549_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
GQ377565_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HQ700526_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
HQ700547_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
JF491449_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
JF491451_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
JF491456_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
JN400086_HBx_P-RF-CB      GLSSMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
JQ040142_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
JX026887_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
JX661487_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774186_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774193_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774230_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774234_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774258_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPC
KC774263_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774291_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774307_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774317_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPC
KC774322_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPC
KC774324_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774328_HBx_P-RF-CB      GLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPC
KC774434_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774435_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPC
KC774442_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPC
KC774443_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCSPAPC
KC774448_HBx_P-RF-DC      GLSAMSTTDLEAYFKDCVFKDWEELGEEIRLMVFVLGGCRHKLVCVPAPC
KC774452_HBx_P-RF-DC      GLSAMSTTDL