HBVdb

Dataset for protein LHBs of genotype RF

[Download (right click)] [Edit] [Sequences] [Repertoires]

889 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


JN664935_LHBs_P-RF-DC      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
DQ464167_LHBs_P-RF-DE      --------------MGQNLSPSNPLGFFPDHQLDPAFRANTANPDWDFNP
KM386676_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPEHQLDPAFRANTANPDWDFNP
DQ464164_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KX357624_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
HE981179_LHBs_P-RF-FG      ---MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNK
KJ803822_LHBs_P-RF-CB      ---MGGRYSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ586810_LHBs_P-RF-AF      ---MGAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNK
KF053166_LHBs_P-RF-BC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ803827_LHBs_P-RF-BC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KX765835_LHBs_P-RF-GC      ---MGGWSSKPREGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
AY161145_LHBs_P-RF-AD      ---MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY161146_LHBs_P-RF-AD      ---MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KP274926_LHBs_P-RF-GA      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF440019_LHBs_P-RF-AG      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF440022_LHBs_P-RF-AG      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF925386_LHBs_P-RF-AC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB453985_LHBs_P-RF-AC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB222708_LHBs_P-RF-AD      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB933282_LHBs_P-RF-AG      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB933283_LHBs_P-RF-AG      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY161140_LHBs_P-RF-AD      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSNNPDWDLNP
AY161141_LHBs_P-RF-AD      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSNNPDWDLNP
GQ331048_LHBs_P-RF-AE      ---MGGWSSTPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF214656_LHBs_P-RF-AC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB194949_LHBs_P-RF-AE      ---MGGSSPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDYNP
AY233277_LHBs_P-RF-AC      ---MGGWSTKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HF571060_LHBs_P-RF-AE      ---MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ161837_LHBs_P-RF-AE      ---MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ161838_LHBs_P-RF-AE      ---MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM146131_LHBs_P-RF-AD      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF488705_LHBs_P-RF-AD      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF925404_LHBs_P-RF-AC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KP148441_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSVPSPLGFLPDHQLDPAFGANSNNPDWDFNP
KP148450_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSGPNPLGFLPDHQLDPAFRANSNNPDWDFNP
KP148442_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFRANSNNPDWDFNP
EU833891_LHBs_P-RF-GC      ---MGGPSSKPRKGMGTNLSVPNPLGFFGDHQLDPAFRANSNNPDWDLNP
FJ882610_LHBs_P-RF-GC      ---MGGPSSKPRKGMGTNLSVPNPLGFFGDHQLDPAFRANSNNPDWDLNP
FJ882614_LHBs_P-RF-GC      ---MGGPSSKPRKGMGTNLSVPNPLGFFGDHQLDPAFRANSNNPDWDLNP
KY471004_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KY470999_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDLNP
KY471000_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDLNP
KY471002_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDLNP
KY470997_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KY470998_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KY471001_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KY471003_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KY471006_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KY471007_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KY471005_LHBs_P-RF-GC      ---MRGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
FR714490_LHBs_P-RF-GB      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KP148586_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
KC172106_LHBs_P-RF-GB      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
EU835240_LHBs_P-RF-GC      ---MGGWSSTPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
FJ882613_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFRANSNNPDWDFNP
FJ023666_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
FJ882612_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFRANSNNPDWDFNP
FJ882618_LHBs_P-RF-GC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFRANSNNPDWDFNP
FJ882617_LHBs_P-RF-GC      ---MGGWSSTPRKGMGTNLSVPNPLGFLPDHQLDPAFRANSNNPDWDFNP
FJ023670_LHBs_P-RF-GC      ---MGGWSSTPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
FJ023664_LHBs_P-RF-GC      ---MGGWSSXPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
FJ023665_LHBs_P-RF-GC      ---MGGWSSTPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
FJ023667_LHBs_P-RF-GC      ---MGGWSSTPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
FJ023668_LHBs_P-RF-GC      ---MGGWSSTPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
FJ023673_LHBs_P-RF-GC      ---MGGWSSTPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
FJ386674_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDRNP
KF053186_LHBs_P-RF-BC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ803778_LHBs_P-RF-BC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MG826145_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSHNPDWDFNP
MH746811_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSHNPDWDFNP
MH746812_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSHNPDWDFNP
MH746813_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSHNPDWDFNP
MG826150_LHBs_P-RF-BC      ---MGGPSSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
MG826151_LHBs_P-RF-BC      ---MGGPSSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
EU939631_LHBs_P-RF-BC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC793112_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ684849_LHBs_P-RF-BC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
JQ412091_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939629_LHBs_P-RF-BC      ---MGGRYSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU882006_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377635_LHBs_P-RF-BC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774178_LHBs_P-RF-BC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774364_LHBs_P-RF-BC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377630_LHBs_P-RF-BC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KP148337_LHBs_P-RF-BC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF053188_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
KJ803782_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
KC315400_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
KF053179_LHBs_P-RF-BC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNP
KJ803772_LHBs_P-RF-BC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNP
KJ717800_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
KJ803791_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
FJ562229_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
JQ801477_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
KJ717815_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
KJ803803_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
KJ717816_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFKANSENPDWDLNP
KJ410497_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNP
EU660227_LHBs_P-RF-BC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
MK052976_LHBs_P-RF-BD      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANPENPDWDLNP
GQ377595_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
EU939627_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNL
MK052970_LHBs_P-RF-BD      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
MK052967_LHBs_P-RF-BD      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLSP
KC774414_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
MK052968_LHBs_P-RF-BD      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQSDPAFKANSENPDWDLNP
KJ717832_LHBs_P-RF-CB      ---MGGPSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
EU919166_LHBs_P-RF-CB      ---MGGRTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
KJ717814_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
KJ803802_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
KF053160_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
KJ803753_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
EU939623_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
EU939620_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
MH094410_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
GQ377604_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
GQ377592_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
EU939621_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
FJ562328_LHBs_P-RF-CB      ---MGGWSSKPREGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
FJ562247_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
EU939630_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
HQ684848_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
GQ377564_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
GQ377590_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
GQ377614_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
GQ377596_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
GQ377573_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
GQ377549_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
GQ377613_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
GQ377626_LHBs_P-RF-CB      ---MGGWSYKPRKGMGSNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
GQ377634_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
JQ040174_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
EU881995_LHBs_P-RF-CB      ---MGGPSSKPRKGMGTNLAVPNPLGFFPDHQLDPAFKANSENPDWDLNP
KJ803804_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFKANSENPDWDLNP
EU522070_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
GQ377602_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
MG826148_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
GQ377556_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDFNP
GQ377594_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNP
JF436919_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGLFPDHQLDPAFGANSNNLDWDFNP
EF494378_LHBs_P-RF-CA      ---MGGYSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF436923_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
HQ700519_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
AP011108_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB241109_LHBs_P-RF-CB      ---MGGYSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
HQ700520_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
HQ700531_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700527_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
HQ700528_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
HQ700523_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
HQ700530_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
KU695745_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700498_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700499_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
X75656_LHBs_P-RF-CB        ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700557_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700554_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700462_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700485_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700560_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700542_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU695746_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU695744_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU695743_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU695741_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700515_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700509_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700507_LHBs_P-RF-CB      ---MGGRSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700508_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB105172_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700518_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
AP011102_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKQDWDFNP
AB493842_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKQDWDFNP
AP011103_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
AB493840_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
AB493838_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB493837_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
AB493847_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ358155_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
GQ358156_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNKPDWDFNP
AB195940_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195941_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FR714496_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
FJ562317_LHBs_P-RF-CB      ---MGGPASKPRRGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF925382_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
JQ027310_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ803785_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
MF925370_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFRANSNNPDWDFNP
KJ803798_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFRANSNNPDWDFNP
GQ924618_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AB031265_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
KJ410506_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
AP011104_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNP
AP011105_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNP
LC416040_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNP
KP148352_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNP
KT003704_LHBs_P-RF-CB      ---MGGWSSKPRHGMGTNLSVPNPLGFFPEHQLDPAFGANSNNPDWDFNP
KX096713_LHBs_P-RF-CA      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX504540_LHBs_P-RF-CB      ---MGGRTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGVNSNNPDWDFNP
JQ040146_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFRANSNXPDWDRNP
HQ700521_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFLPDHQLDPVFGANSNNPDWDFNP
HQ700505_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939547_LHBs_P-RF-CB      ---------KPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG826141_LHBs_P-RF-CB      ---MGGPSSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
MG826147_LHBs_P-RF-CB      ---MGGPSSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
KC774324_LHBs_P-RF-CB      ---MGGPSSKPRRGMGTNLAVPNPLGFFPDHQLDLAFRANSNNPDWDFNP
AY206374_LHBs_P-RF-CB      ---MGGWSAKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GU357843_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195939_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195955_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195956_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195957_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ598675_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG826146_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GU385774_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195950_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB195951_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367800_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562227_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367419_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX661485_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173320_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173322_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367400_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB367393_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386649_LHBs_P-RF-CB      ---MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB049609_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013843_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB300369_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787446_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ787480_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF411409_LHBs_P-RF-CB      ---MGGWSSKPRHGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828936_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828933_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828934_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828938_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF828935_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG826142_LHBs_P-RF-CB      ---MGGPSSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
JX036329_LHBs_P-RF-CD      ---MGGWSSKPRQGTGTNLSVPNPLGFFPDHQLDPAFGANSNSPDWDFNP
MG826144_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871990_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871988_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871999_LHBs_P-RF-CB      ---IGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871981_LHBs_P-RF-CB      ---IGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871983_LHBs_P-RF-CB      ---IGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871986_LHBs_P-RF-CB      ---IGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871991_LHBs_P-RF-CB      ---IGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871984_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871985_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871987_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871989_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871992_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871993_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871994_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871995_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871996_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
M38454_LHBs_P-RF-CB        ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774188_LHBs_P-RF-CB      ---MGGWSSKPRRGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700526_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377522_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNHLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562294_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ089798_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774193_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774291_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774307_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774323_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU695742_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX036358_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040175_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562267_LHBs_P-RF-CB      ---MGGWASKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939551_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY123041_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU589337_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ032343_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377534_LHBs_P-RF-CB      ---------KPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX036328_LHBs_P-RF-CD      ---MGGWSSKPRQGTGTNLSVPNPLGFFPDHQLDPAFGANSNSPDWDFNP
KC774212_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964005_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964006_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964007_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964008_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964009_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964010_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964303_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964304_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964305_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964306_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPIPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964307_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964308_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964309_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964310_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964311_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964312_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964313_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964314_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964315_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964316_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964317_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU916232_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG893555_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG893554_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173350_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173325_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774234_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040142_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386586_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF233236_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562305_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939577_LHBs_P-RF-CB      ---------KPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG826149_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774183_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377560_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDLAFGANSNNPDWDFNP
FJ715345_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562314_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562226_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939668_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939589_LHBs_P-RF-CB      ---MGGRYSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EF494376_LHBs_P-RF-CA      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY247030_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY123424_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB198084_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB033557_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF461361_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774317_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774322_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939565_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377520_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB642096_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173358_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173326_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774344_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715411_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU916239_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU916240_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU916241_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU717211_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF330110_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB205152_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU871997_LHBs_P-RF-CB      ---MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386581_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386635_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377611_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
Y18857_LHBs_P-RF-CB        ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470893_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY363263_LHBs_P-RF-CB      ---MGGSSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964351_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963869_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173349_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173329_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774328_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774222_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX661498_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX661486_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700547_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377516_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715384_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715346_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715347_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY040627_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPALGANSNNPDWDFNP
AY167095_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ386585_LHBs_P-RF-CB      ---MGGRSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562287_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173279_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU787444_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377581_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377607_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715414_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715413_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715412_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715385_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ715387_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MK321265_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013806_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ040148_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
Y18856_LHBs_P-RF-CB        ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG893561_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MG893559_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC458432_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279267_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279266_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279265_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279264_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
LC279263_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY881840_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964003_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU964001_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963999_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963998_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963995_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963994_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963993_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963991_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963990_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963883_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANTNNPDWDFNP
KU963870_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963868_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963867_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963866_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963865_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963864_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963863_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963862_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963861_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963860_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963859_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963858_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963857_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU963856_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KR013816_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173300_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ173299_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774305_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774294_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774258_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774246_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774230_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774201_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774198_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774186_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX661494_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX661487_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX429896_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX026887_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JQ732168_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JN400086_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF436922_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750133_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377544_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774263_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774332_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774341_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774349_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KM213033_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
GQ377633_LHBs_P-RF-CB      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ478890_LHBs_P-RF-DC      ---MGGWSSKPRQGMVTNLSVLNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX660685_LHBs_P-RF-DC      ---MGGWTSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
MF925389_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPGHQLDPAFGANSNNPDWDFNP
GU177079_LHBs_P-RF-DE      ---MGGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFRANTTNPDWDFNP
KC774450_LHBs_P-RF-DE      ---MGGWSSKPRQGMGTNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
MH464846_LHBs_P-RF-DE      ---MGXXXXXXXXXXXXNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
MH464850_LHBs_P-RF-DA      ---MGXXXXXXXXXXXXNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
MH464851_LHBs_P-RF-DE      ---MGXXXXXXXXXXXXNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
MH464852_LHBs_P-RF-DE      ---MGXXXXXXXXXXXXNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
MH464835_LHBs_P-RF-DE      ---MGXXXXXXXXXXXXNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KY470853_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679950_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873530_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873527_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873511_LHBs_P-RF-CB      ---MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873513_LHBs_P-RF-CB      ---MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873515_LHBs_P-RF-CB      ---MGGWTSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873519_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873517_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873518_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873521_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679948_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679955_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679953_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679944_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679946_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679954_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873534_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873533_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873531_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSXNPDWDFNP
KF873532_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873535_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679940_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873540_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679945_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679939_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873543_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873542_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873537_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873538_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679956_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679943_LHBs_P-RF-BC      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679942_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU679958_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNS
KF873522_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNX
KU679941_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNX
KF873523_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF873524_LHBs_P-RF-CB      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY057948_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHHLDPAFGANSNNPDWDFNP
JX036330_LHBs_P-RF-DC      ---MGGWSSKPRQGTGTNLSVPNPLGFFPDHQLDPAFGANSNSPDWDFNP
AB674504_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPSHQLDPAFGANSNNPDWDFNP
KF779353_LHBs_P-RF-DA      ---MGGWSSKASTSMGTNLSAPNPLGFFPDHQLDPAFRANSNNPDWDFNP
JF491448_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470854_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470843_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470846_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470847_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470849_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470850_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470855_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470856_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY470844_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KT991419_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774479_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY817513_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY670781_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX036359_LHBs_P-RF-DC      ---MGGWSSKPRQGTGTNLSVPNPLGFFPDHQLDPAFGANSNSPDWDFNP
HM750145_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KT991427_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774485_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY817511_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750143_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX660686_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX354997_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774456_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750144_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774453_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750149_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ349241_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750142_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750146_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750147_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750148_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HM750150_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774482_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KP276253_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KP276256_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX660689_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX660684_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562263_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774449_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KT991424_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KY629632_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX036332_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY817510_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY817509_LHBs_P-RF-DC      ---TGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AB270535_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774487_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774498_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY817512_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KT991423_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ562278_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KT991420_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWGFNP
KT991417_LHBs_P-RF-DC      ---MGGWSSRPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774428_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774430_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774468_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774492_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774494_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774458_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ478886_LHBs_P-RF-DC      ---MGGRYSQPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY862865_LHBs_P-RF-DC      ---IGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774470_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774463_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774452_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774425_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774461_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF491456_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF491455_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF491451_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNHPDWDFNP
KX660677_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KF917451_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774490_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774489_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774484_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774442_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ478898_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU787435_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774495_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774474_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774431_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774454_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774476_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774481_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX660674_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX660680_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774423_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774471_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774420_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY862866_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ478887_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ478889_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ478892_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
DQ478897_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF491449_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JX429898_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774424_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774432_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774433_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774434_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774435_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774439_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774443_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774455_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774466_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774472_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KX660675_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU519423_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KU519422_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KP276255_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KP276254_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774497_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774493_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774488_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774478_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774480_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774483_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY817515_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AY800249_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU787434_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774422_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774426_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774447_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774457_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774475_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774486_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774499_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KC774448_LHBs_P-RF-DC      ---MGGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
JF440021_LHBs_P-RF-AG      ---MGGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
KJ586803_LHBs_P-RF-AF      --------------MGAPLSTTNHGEFFPDHQLDPLFRANSSSPDWDFNK
GQ161753_LHBs_P-RF-AE      --------------MGANLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
FJ023659_LHBs_P-RF-BC      ----MGRCSTTRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
FJ023662_LHBs_P-RF-GC      ----MGCWSKPRKGMGTNLSVPNPLGFLPDHQLDPAFGANSNNPDWDFNP
MF925402_LHBs_P-RF-BD      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
GQ161806_LHBs_P-RF-EA      ----MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNP
EF103283_LHBs_P-RF-AD      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
EF103284_LHBs_P-RF-AD      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
FJ562223_LHBs_P-RF-CD      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
GQ377627_LHBs_P-RF-CD      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
EU185780_LHBs_P-RF-AD      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KC012653_LHBs_P-RF-AD      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
FN594767_LHBs_P-RF-DE      ----MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNP
AY862864_LHBs_P-RF-DC      --------------MGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
AF297620_LHBs_P-RF-DA      ----------IRKGMGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KX357641_LHBs_P-RF-DE      ----MGLSWTVPLEWGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDLNP
FN594770_LHBs_P-RF-DE      ----MGLSWTVPLEWGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDHNP
MH685719_LHBs_P-RF-DE      ----MGLSWTVPLEWGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDLNP
FN594771_LHBs_P-RF-DE      ----MGLSWTVPLEWGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDHNP
KU736916_LHBs_P-RF-DE      ----MGLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDLNP
KU736914_LHBs_P-RF-DE      ----MGLSWTVPLEWGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDLNP
KP168421_LHBs_P-RF-DE      ----MGLSWTVPLEWGKNHATSNPLGFFPDHQLDPAFRANTRNPDWDLNP
KU736917_LHBs_P-RF-DE      ----MGLSWTVPLEWGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDLNP
FN594769_LHBs_P-RF-DE      ----MGLSWTVPLEWGKNHSTSNPLGFFPDHQLDPAFRANTXXPDWDHNP
GQ161754_LHBs_P-RF-DE      ----MGLSWTVPLEWGKNHSTSNPLGFFPDHQLDPAFRANTRNPDWDHNP
AF297619_LHBs_P-RF-DA      --------------MGTNLSPGNPLGFFPDHQLDPAFRANTANPDWDFNP
JF440013_LHBs_P-RF-DE      --------------MGQNLPTSNPLGFFLDHQLDPAFRANTANPDWDFNP
JF440012_LHBs_P-RF-DE      --------------MGRNLSTSNPLGFFPDHQLDPAFRANTADPDWDFNP
JF440011_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF440000_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF440017_LHBs_P-RF-DA      --------------MGTNLSVPNPLGFFPDHQLDPAFRANTANPDWDFNP
JF440010_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF440006_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF440001_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF439998_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF440004_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF440005_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF439995_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF439996_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF439999_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF440002_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF440003_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF440007_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF440009_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF440014_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF440015_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF439994_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN040803_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPEHQLDPAFRANTANPDWDFNP
JF754616_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
AM494716_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
X68292_LHBs_P-RF-DA        --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KU668440_LHBs_P-RF-DE      --------------MGQNLSTSNPPGFFPDHQLGPAFRANTRNPDWDFNP
FJ904442_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTXNPDWDFNP
KX357631_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KJ647356_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN257154_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
FJ904403_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
FJ349221_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFKANTANPDWDFNP
MF925371_LHBs_P-RF-DC      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN664929_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
AB330368_LHBs_P-RF-DA      --------------MGQNLSTSNPLGVFPDHQLDPAFRANTANPDWDFNP
AY341335_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFLPDHQLDPAFRANTSNPDWDFNP
AB674432_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
FJ349207_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
HQ700492_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700535_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
MH481860_LHBs_P-RF-DE      --------------MGQNLSTSNPLGLFPDHQLDPAFRANTNNPDWDFNP
J02202_LHBs_P-RF-DE        --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700536_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700494_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNP
HQ700493_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
FJ904430_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
AB048702_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
MH481859_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700533_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
AB033559_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700524_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700525_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
MH481858_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
MH481861_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
MH481862_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700500_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700579_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700585_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700539_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
AB048703_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700497_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700501_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700503_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700534_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700584_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700583_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700582_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700581_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700541_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700540_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700537_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
HQ700538_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
JN040798_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
MF618346_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
KF192833_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
KF192835_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
KF192836_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
KF192837_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
KF192838_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
KF192839_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
KF192840_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
KF192841_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
MF618347_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
MF488699_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
KJ803771_LHBs_P-RF-DB      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
FJ904436_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
FJ904425_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
FJ904405_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
AY236161_LHBs_P-RF-DA      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN664934_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
AB033558_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
JN664915_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
JN664933_LHBs_P-RF-DA      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
DQ315779_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
JN664940_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
KT366505_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
GQ205379_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
KC875339_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
GQ205387_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
GQ205377_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
GQ205378_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
GQ205386_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
KC875338_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
JN664925_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNP
MF925396_LHBs_P-RF-DC      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KX827299_LHBs_P-RF-DE      --------------MEQNLSTSNPLGFFPDHQLDPAFRANTTNPDWGFNP
FJ904444_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
FJ904437_LHBs_P-RF-DE      --------------MGQNLCTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
FJ904396_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
AY373430_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFHDHQLDPAFRANTANPDWDFNP
KM359442_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JF754613_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
FJ904441_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
DQ991753_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
AJ627221_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
X65259_LHBs_P-RF-DA        --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
GU563560_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPEHQLDPAFRANTANPDWDFNP
AB674433_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
AB188243_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KP288875_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
KM606741_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KM524357_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KJ647349_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JX898695_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JX898696_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JX898693_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN642160_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
FJ904440_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
FJ904406_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
FJ904404_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
FJ904447_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
FJ904394_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
FJ904400_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
JX898686_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
FJ349212_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KJ586811_LHBs_P-RF-DF      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JX898687_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JX898688_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JX898690_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JX898698_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JX898699_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
MF967563_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
U95551_LHBs_P-RF-DE        --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
MF925401_LHBs_P-RF-DB      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KM577666_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
AB188245_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN688717_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KR905422_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KT366503_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
MF925388_LHBs_P-RF-DC      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
MF925392_LHBs_P-RF-DB      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
MF925360_LHBs_P-RF-DB      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNP
KX827302_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KX357627_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KP995112_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KJ470898_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
AB674436_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
AB270538_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
X80925_LHBs_P-RF-DE        --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN257204_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN664946_LHBs_P-RF-DA      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
EU594406_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JQ687532_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
MK052969_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KX357634_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KX357629_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPEHQLDPAFRANTTNPDWDFNP
KX357628_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KX357625_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPEHQLDPAFRANTTNPDWDFNP
KM577664_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KJ470897_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
JN642139_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN257164_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
FJ904414_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
FJ904409_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
FJ904408_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
FJ904407_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
FJ904398_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
EU594436_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
EU594435_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
EF103285_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
AY233295_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
AB210819_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KX357626_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KX357630_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KX357623_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KX357633_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KX357635_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KJ470884_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
KJ470886_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
KJ470887_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
KJ470888_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
KJ470890_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
KJ470891_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNP
FJ904416_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
FJ904417_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
KM577663_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KJ647351_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KF471643_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN688689_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN642137_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
AB583679_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
AJ627217_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
DQ111987_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
FJ692536_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
GQ183486_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KX357636_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KT366492_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KM524359_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN664943_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN642152_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
MF925397_LHBs_P-RF-DC      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KF170740_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNP
JN642141_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN642127_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
AJ344117_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
AY233293_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPEHQLDPAFRANTANPDWDFNP
KU736923_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KU736922_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KU736921_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KU711666_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KP168418_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KP168417_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KM606751_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KM606750_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KM577665_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN688715_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KT366504_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
KP168416_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNP
KM577667_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN257191_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN257216_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN257189_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
MF925384_LHBs_P-RF-DB      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNP
JN257206_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN257174_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
JN257210_LHBs_P-RF-DE      --------------MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNP
EU833890_LHBs_P-RF-GA      ----MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNSPDWDFNP
AB933279_LHBs_P-RF-AG      ----MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNP
AB933280_LHBs_P-RF-AG      ----MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNP
AB933281_LHBs_P-RF-AG      ----MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNP
EF464099_LHBs_P-RF-AG      ----MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNP
KF219922_LHBs_P-RF-GH      ----MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNP
JQ272886_LHBs_P-RF-GF      ----MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNP
JQ272887_LHBs_P-RF-GF      ----MGLSWTVPLEWGKNLSTSNPLGFFPDHQLDPAFRANSSNPDWDFNP
JQ801476_LHBs_P-RF-CG      ----MGLSWTVPLEWGKNLSTSNPLGFLPDHQLDPAFRANTNNPDWDFNP
KM875422_LHBs_P-RF-CB      IKPRQGM--------GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU919167_LHBs_P-RF-CB      TKPRQGM--------GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
EU939606_LHBs_P-RF-CB      TKPRQGM--------GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700532_LHBs_P-RF-CB      IKPRKGM--------GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
HQ700580_LHBs_P-RF-CB      --TRKGM--------GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNP
                                                     .:  *: .  : .*.   **. . 

JN664935_LHBs_P-RF-DC      NKDTWPDANKVGAGAFGPGFTPPHGSLLGWSPQAQGILTTVPA-APPAST
DQ464167_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
KM386676_LHBs_P-RF-DE      NKDNWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
DQ464164_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
KX357624_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HE981179_LHBs_P-RF-FG      NKDTWPMANKVGVGGYGPGFTPPHGGLLGRSPQAQGVLTTLPADPPPAST
KJ803822_LHBs_P-RF-CB      NKDQWPEANQVGVGAFGPGFTPPHGGLLGWSPQTQGILTTVPAAPPPATT
KJ586810_LHBs_P-RF-AF      NKDNWPMANKVGVGGYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPAST
KF053166_LHBs_P-RF-BC      NKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQAQGTLTTVPAVPPPAST
KJ803827_LHBs_P-RF-BC      NKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQAQGTLTTVPAVPPPAST
KX765835_LHBs_P-RF-GC      NKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQSQGILTTLPADPPPAST
AY161145_LHBs_P-RF-AD      IKDHWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPSAST
AY161146_LHBs_P-RF-AD      IKDHWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPSAST
KP274926_LHBs_P-RF-GA      IKDHWPAANQVGVGAFGPGFTPPHGGILGWSPQAQGILTTVSTIPPPAST
JF440019_LHBs_P-RF-AG      IKDHWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGMLTPVSTIPPPASA
JF440022_LHBs_P-RF-AG      IKDHWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGMLTPVSTIPPPASA
MF925386_LHBs_P-RF-AC      IKDHWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPAST
AB453985_LHBs_P-RF-AC      IKDHWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPAST
AB222708_LHBs_P-RF-AD      IKDHWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPAST
AB933282_LHBs_P-RF-AG      IKDHWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPAST
AB933283_LHBs_P-RF-AG      IKDHWPAANQVGVGAFGPGLTPPHGGILGWSPQAQGILTTVSTIPPPAST
AY161140_LHBs_P-RF-AD      IKDHWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPAST
AY161141_LHBs_P-RF-AD      IKDHWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPAST
GQ331048_LHBs_P-RF-AE      IKDHWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPKVPPPAST
KF214656_LHBs_P-RF-AC      IKDHWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPTVPPPAST
AB194949_LHBs_P-RF-AE      IKDHWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPAST
AY233277_LHBs_P-RF-AC      IKDHWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPTVPPPAST
HF571060_LHBs_P-RF-AE      IKDHWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPAAT
GQ161837_LHBs_P-RF-AE      IKDHWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPAAT
GQ161838_LHBs_P-RF-AE      IKDHWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPAAT
HM146131_LHBs_P-RF-AD      IKDHWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILXTVPAVPPPAST
MF488705_LHBs_P-RF-AD      IKDQWPQAHQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPAST
MF925404_LHBs_P-RF-AC      IKDHWPQANQVGVGAFGPGFTPPHGGVLGWSPQAQGILATVPAVPPPAST
KP148441_LHBs_P-RF-GC      NKDHWPQAHQVGAGTFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
KP148450_LHBs_P-RF-GC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
KP148442_LHBs_P-RF-BC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
EU833891_LHBs_P-RF-GC      NKDPWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
FJ882610_LHBs_P-RF-GC      NKDPWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
FJ882614_LHBs_P-RF-GC      NKDPWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
KY471004_LHBs_P-RF-GC      NKDHWPQAHQVGAGAFGSGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
KY470999_LHBs_P-RF-GC      NKDHWPQAHQVGVGAFGSGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
KY471000_LHBs_P-RF-GC      NKDHWPQAHQVGVGAFGSGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
KY471002_LHBs_P-RF-GC      NKDHWPQAHQVGVGAFGSGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
KY470997_LHBs_P-RF-GC      NKDHWPQAHQVGVGAFGSGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
KY470998_LHBs_P-RF-GC      NKDHWPQAHQVGVGAFGSGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
KY471001_LHBs_P-RF-GC      NKDHWPQAHQVGVGAFGSGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
KY471003_LHBs_P-RF-GC      NKDHWPQAHQVGVGAFGSGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
KY471006_LHBs_P-RF-GC      NKDHWPQAHQVGVGAFGSGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
KY471007_LHBs_P-RF-GC      NKDHWPQAHQVGVGAFGSGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
KY471005_LHBs_P-RF-GC      NKDHWPQAHQVGVGAFGSGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
FR714490_LHBs_P-RF-GB      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
KP148586_LHBs_P-RF-GC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
KC172106_LHBs_P-RF-GB      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
EU835240_LHBs_P-RF-GC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAVPPPAST
FJ882613_LHBs_P-RF-GC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
FJ023666_LHBs_P-RF-GC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPLAQGILTNVPAVPPPAST
FJ882612_LHBs_P-RF-GC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
FJ882618_LHBs_P-RF-GC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
FJ882617_LHBs_P-RF-GC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
FJ023670_LHBs_P-RF-GC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAVPPPAST
FJ023664_LHBs_P-RF-GC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
FJ023665_LHBs_P-RF-GC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
FJ023667_LHBs_P-RF-GC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
FJ023668_LHBs_P-RF-GC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
FJ023673_LHBs_P-RF-GC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPAVPPPAST
FJ386674_LHBs_P-RF-BC      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQSIFTTVPAAPPPAST
KF053186_LHBs_P-RF-BC      NKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQAQGILTTVPAAPPPAST
KJ803778_LHBs_P-RF-BC      NKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQAQGILTTVPAAPPPAST
MG826145_LHBs_P-RF-BC      NKDHWPQAHQVGVGAFGSGFTPPHGGLLGWSPQAQGMLTNVPAVPPPAST
MH746811_LHBs_P-RF-BC      NKDHWPQAHQVGVGAFGSGFTPPHGGLLGWSPQAQGMLTNVPAVPPPAST
MH746812_LHBs_P-RF-BC      NKDHWPQAHQVGVGAFGSGFTPPHGGLLGWSPQAQGMLTNVPAVPPPAST
MH746813_LHBs_P-RF-BC      NKDHWPQAHQVGVGAFGSGFTPPHGGLLGWSPQAQGMLTNVPAVPPPAST
MG826150_LHBs_P-RF-BC      NKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
MG826151_LHBs_P-RF-BC      NKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
EU939631_LHBs_P-RF-BC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC793112_LHBs_P-RF-BC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
HQ684849_LHBs_P-RF-BC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGTLTTVPVAPPPAST
JQ412091_LHBs_P-RF-BC      NKDHWPAANQVGAGAFGPGFTPPHGSLLGWSPQAQGILTTVPAVPPPAST
EU939629_LHBs_P-RF-BC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU882006_LHBs_P-RF-CB      NKDQWPEANQVGVGAFGPGFTPPHGGLLGWSPQTQGILTTVPAAPPPAST
GQ377635_LHBs_P-RF-BC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774178_LHBs_P-RF-BC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KC774364_LHBs_P-RF-BC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
GQ377630_LHBs_P-RF-BC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KP148337_LHBs_P-RF-BC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGTLTTVPAAPPPAST
KF053188_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSSQAQGLLTTVPAAPPPAST
KJ803782_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSSQAQGLLTTVPAAPPPAST
KC315400_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPAST
KF053179_LHBs_P-RF-BC      HKDNWPDSNKVGVGAFGTGFTPPHGGLLGWSPQAQGILTTVPATPPPAST
KJ803772_LHBs_P-RF-BC      HKDNWPDSNKVGVGAFGTGFTPPHGGLLGWSPQAQGILTTVPATPPPAST
KJ717800_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLETTVPAAPPPAST
KJ803791_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLETTVPAAPPPAST
FJ562229_LHBs_P-RF-CB      HKDNWPDSNKVRVGAFGPRFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
JQ801477_LHBs_P-RF-BC      HKDNWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
KJ717815_LHBs_P-RF-CB      HKDKWPDANKVGVGAVGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
KJ803803_LHBs_P-RF-CB      HKDKWPDANKVGVGAVGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
KJ717816_LHBs_P-RF-CB      HKDKWPDANKVGVGAVGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
KJ410497_LHBs_P-RF-BC      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPASPPPAST
EU660227_LHBs_P-RF-BC      HKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPAST
MK052976_LHBs_P-RF-BD      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPAST
GQ377595_LHBs_P-RF-BC      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
EU939627_LHBs_P-RF-BC      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
MK052970_LHBs_P-RF-BD      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPAST
MK052967_LHBs_P-RF-BD      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPAST
KC774414_LHBs_P-RF-BC      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQALGLLTTVPTAPPPAST
MK052968_LHBs_P-RF-BD      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPAST
KJ717832_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
EU919166_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPAST
KJ717814_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
KJ803802_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
KF053160_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSSQAQGLLTTVPAAPPPAST
KJ803753_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSSQAQGLLTTVPAAPPPAST
EU939623_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
EU939620_LHBs_P-RF-CB      HKDNWQDANKVGVGAFGLGLTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
MH094410_LHBs_P-RF-BC      HKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGLLTTVPAAPPPAST
GQ377604_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
GQ377592_LHBs_P-RF-CB      HKDNWPDANQVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
EU939621_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
FJ562328_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
FJ562247_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
EU939630_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPAST
HQ684848_LHBs_P-RF-CB      YKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
GQ377564_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
GQ377590_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
GQ377614_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
GQ377596_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
GQ377573_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPHAQGLLTTVPAAPPPAST
GQ377549_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
GQ377613_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
GQ377626_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGILTTVPAAPPPAST
GQ377634_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPLAST
JQ040174_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
EU881995_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
KJ803804_LHBs_P-RF-CB      HKDKWPDANKVGVGAVGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
EU522070_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFIPPHGGLLGWSPQAQGLLTTVPAAPPPAST
GQ377602_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
MG826148_LHBs_P-RF-CB      HKDNWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
GQ377556_LHBs_P-RF-CB      HKDNWPDANXVGVGAFGPGFTPPHGGLLGXSPQAQGISTTVPAAPPPAST
GQ377594_LHBs_P-RF-CB      HKDSWPDANKVGVGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
JF436919_LHBs_P-RF-CB      NKDHWPEANQVGTGAFGPGFTPPHGGLLGWSPQAQGVLTTVPAAPPPAST
EF494378_LHBs_P-RF-CA      NKDPWPEAWQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAVPPPAST
JF436923_LHBs_P-RF-CB      NKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQAQGILTTVPAAPPPAST
HQ700519_LHBs_P-RF-CB      NKDHWPGANQVGTGAFGPGFTPPHGGLLGWSPLAQGTLTTVPAAPPPAST
AP011108_LHBs_P-RF-CB      NKDRWPEANQVGAGAFGPGFTPPHGGLLGWSPLAQGILTTVPAAPPPAST
AB241109_LHBs_P-RF-CB      NKDPWPEAWQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
HQ700520_LHBs_P-RF-CB      NKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQAQGMLTSVPAAPPPAST
HQ700531_LHBs_P-RF-CB      NKDYWPKANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTPVPAAPPPAST
HQ700527_LHBs_P-RF-CB      NKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTPVPAAPPPAST
HQ700528_LHBs_P-RF-CB      NKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTPVPAAPPPAST
HQ700523_LHBs_P-RF-CB      NKDHWPKANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTPVPAAPPPAST
HQ700530_LHBs_P-RF-CB      NKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTPVPAAPPPAST
KU695745_LHBs_P-RF-CB      NKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
HQ700498_LHBs_P-RF-CB      NKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
HQ700499_LHBs_P-RF-CB      NKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
X75656_LHBs_P-RF-CB        NKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTLPAAPPPAST
HQ700557_LHBs_P-RF-CB      NKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPAST
HQ700554_LHBs_P-RF-CB      NKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPAST
HQ700462_LHBs_P-RF-CB      NKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPTVPPPAST
HQ700485_LHBs_P-RF-CB      NKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPTVPPPAST
HQ700560_LHBs_P-RF-CB      NKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTSVPTAPPPAST
HQ700542_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGVLTTVPAAPPTAST
KU695746_LHBs_P-RF-CB      NKDRWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU695744_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU695743_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
KU695741_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
HQ700515_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
HQ700509_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
HQ700507_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
HQ700508_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
AB105172_LHBs_P-RF-CB      NKDHWPKANQVGTGAFGPGFTPPHGGLLGWSPQAQGIVTTVPAVPPPAST
HQ700518_LHBs_P-RF-CB      NKDHWPKANQVGVGAFGPGFTPPHGGILGWSPQAQGILTPVPAAPPPAST
AP011102_LHBs_P-RF-CB      NKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AB493842_LHBs_P-RF-CB      NKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AP011103_LHBs_P-RF-CB      NKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AB493840_LHBs_P-RF-CB      NKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AB493838_LHBs_P-RF-CB      NKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AB493837_LHBs_P-RF-CB      NKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AB493847_LHBs_P-RF-CB      NKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
GQ358155_LHBs_P-RF-CB      NKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
GQ358156_LHBs_P-RF-CB      NKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AB195940_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPAST
AB195941_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPAST
FR714496_LHBs_P-RF-CB      NKDQWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTLPAAPPPAST
FJ562317_LHBs_P-RF-CB      NKDHWPEAKQVGVGAFGPGVTPPHGGLVGWSPQAQGTLTTVPAAPPPAST
MF925382_LHBs_P-RF-CB      NKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
JQ027310_LHBs_P-RF-CB      NKDQWPAANQVGVGAFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
KJ803785_LHBs_P-RF-CB      NKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
MF925370_LHBs_P-RF-CB      NKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQAQGILTTVPAAPPPAST
KJ803798_LHBs_P-RF-CB      NKDQWPAAHQVGVGSFGPGFTPPHGNLLGWSPQAQGILTTVPAAPPPAST
GQ924618_LHBs_P-RF-CB      NKDQWPAANQVGVGAFGPGFTPPHGNLLGWSPQAQGILTTVPAAPPPAST
AB031265_LHBs_P-RF-CB      NKDPWPAAHQVGVGSFGPGFTPPHGNLLGWSPQAQGILTAVPAAPPPAST
KJ410506_LHBs_P-RF-CB      NKDQWPAANQVGVGSFGPGFTPPHGNLLGWSPQAQGILTTLPAAPPPAST
AP011104_LHBs_P-RF-CB      NKDQWPEANQVGVGAFGPGFTPPHGSLLGWSPQAQGILTPVPAAPPPAST
AP011105_LHBs_P-RF-CB      NKDQWPEANQVGVGAFGPGFTPPHGSLLGWSPQAQGILTPVPAAPPPAST
LC416040_LHBs_P-RF-CB      NKDQWPEANQVGVGAFGPGFTPPHGSLLGWSPQAQGILTPVPAAPPPAST
KP148352_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQAQGILTSVPAAPPPAST
KT003704_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQAQGTLTSVPAAPPPAST
KX096713_LHBs_P-RF-CA      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGTLTTVPAAPPPAST
JX504540_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
JQ040146_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVTPPPAST
HQ700521_LHBs_P-RF-CB      NKDHWPQANQVGTGAFGPGFTPPHGGLLGWSPLAQGTLTTVPAAPPPAST
HQ700505_LHBs_P-RF-CB      NKDHWPEANQVGAGAYGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
EU939547_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPVST
MG826141_LHBs_P-RF-CB      NKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
MG826147_LHBs_P-RF-CB      NKDQWPAATRVGVGSFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
KC774324_LHBs_P-RF-CB      NKDPWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
AY206374_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
GU357843_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
AB195939_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPAST
AB195955_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPAST
AB195956_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPAST
AB195957_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGIFTTVPAAPPPAST
KJ598675_LHBs_P-RF-CB      NKDHWPAANQVGAGAFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
MG826146_LHBs_P-RF-CB      NKDHWPAANQVGAGAFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
GU385774_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLVGWSPQAQGILTTVPVAPPPAST
AB195950_LHBs_P-RF-CB      NKDHWPEAKQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AB195951_LHBs_P-RF-CB      NKDHWPEAKQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AB367800_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
FJ562227_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPASA
AB367419_LHBs_P-RF-CB      NKDHWPEADQVGAGAFGPGFTPPHGGLLGRSPQAQGILTTVPAAPPPAST
JX661485_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAVPPPAST
KJ173320_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAVPPPAST
KJ173322_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAVPPPAST
AB367400_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AB367393_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
FJ386649_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAPGILTTVPVAPPPAST
AB049609_LHBs_P-RF-CB      NKDHWPEANHVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KR013843_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGRSPQAQGILTTVPAAPPPAST
AB300369_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
FJ787446_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
FJ787480_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
AF411409_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWNPQAQGILKTVPVAPPPAST
JF828936_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
JF828933_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
JF828934_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
JF828938_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
JF828935_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGALLGWSPQAQGILTTVPAAPPPAST
MG826142_LHBs_P-RF-CB      NKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
JX036329_LHBs_P-RF-CD      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
MG826144_LHBs_P-RF-CB      NKDRWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
EU871990_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPRGGLLGWSPQAQGILTTVPVAPPPAST
EU871988_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU871999_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU871981_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU871983_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU871986_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU871991_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU871984_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU871985_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU871987_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU871989_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU871992_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU871993_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU871994_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU871995_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU871996_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
M38454_LHBs_P-RF-CB        NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KC774188_LHBs_P-RF-CB      NKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGTLTTVPVAPPPAST
HQ700526_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPLAQGILTTVPAAPPPAST
GQ377522_LHBs_P-RF-CB      NKDHWPEANQGGAGAFGPGFTPPRGGLLGWSPQAQGILTTVAAAPPPAST
FJ562294_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
DQ089798_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774193_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPASS
KC774291_LHBs_P-RF-CB      NKDQWPEANQVGVGAFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
KC774307_LHBs_P-RF-CB      NKDQWPEANQVGVGAFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
KC774323_LHBs_P-RF-CB      NKDQWPEANQVGVGAFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
KU695742_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGILGWSPQAQGILTTVPATPPPAST
JX036358_LHBs_P-RF-DC      SKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
JQ040175_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
FJ562267_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
EU939551_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGTLTTVPAAPPPAST
AY123041_LHBs_P-RF-CB      NKDHWPEAIKVGAGDFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPVST
EU589337_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
FJ032343_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
GQ377534_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILSTVPVAPPPAST
JX036328_LHBs_P-RF-CD      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774212_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPAFT
KU964005_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964006_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964007_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964008_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964009_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964010_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964303_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964304_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964305_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964306_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAHGILTTVPAAPPPAST
KU964307_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964308_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964309_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964310_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964311_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964312_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964313_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964314_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964315_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964316_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964317_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
EU916232_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
MG893555_LHBs_P-RF-CB      NKDYWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTAPAAPPPAST
MG893554_LHBs_P-RF-CB      NKDHWPETNQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTAPAAPPPAST
KJ173350_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGVLTTVPVAPPPAST
KJ173325_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KC774234_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
JQ040142_LHBs_P-RF-CB      NKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
FJ386586_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLMGWSPQAQGILTTVPAAPPPAST
AF233236_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
FJ562305_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGLLTTVPVAPPPAST
EU939577_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
MG826149_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KC774183_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
GQ377560_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
FJ715345_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGTLTTVPVAPPPAST
FJ562314_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
FJ562226_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGVLGWSPQAQGILTTVPAAPPPAST
EU939668_LHBs_P-RF-CB      NKDHWPEAHQVGAGSFGPGFTPPHGGLLGWSPQAQGTLTTVPAAPPPAST
EU939589_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EF494376_LHBs_P-RF-CA      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
AY247030_LHBs_P-RF-CB      NKDHWPEAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AY123424_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
AB198084_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
AB033557_LHBs_P-RF-CB      NKDQWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AF461361_LHBs_P-RF-CB      NKDHWPEANQVGAGAFWPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KC774317_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGITPPHGGLLGWSPQAQGILTTVPVAPPPAST
KC774322_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGITPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU939565_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
GQ377520_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
AB642096_LHBs_P-RF-CB      KKDHWPXANQVGAGAFGPGFTPPHGGLXGWSPQAQGILTTVPAAPPPAST
KJ173358_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KJ173326_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KC774344_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGTLTAVPAAPPPAST
FJ715411_LHBs_P-RF-CB      NKDHWPEVNQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
EU916239_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASS
EU916240_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASS
EU916241_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASS
EU717211_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
AF330110_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AB205152_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPSHGGLLGWSPQAQGILTTVPAAPPPAST
EU871997_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
FJ386581_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGXLTTVPVAPPPAST
FJ386635_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
GQ377611_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
Y18857_LHBs_P-RF-CB        NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KY470893_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KY363263_LHBs_P-RF-CB      NKDHWPEANQVGAGAYGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU964351_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPIAPPPAST
KU963869_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KJ173349_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KJ173329_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KC774328_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGSLLGWSPQAQGILTTVPVAPPPAST
KC774222_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
JX661498_LHBs_P-RF-CB      NKDRWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGTLTTVPVAPPPAST
JX661486_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
HQ700547_LHBs_P-RF-CB      NKDQWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
GQ377516_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
FJ715384_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
FJ715346_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGTLTTVPVAPPPAST
FJ715347_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGTLTTVPVAPPPAST
AY040627_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AY167095_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
FJ386585_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAPGILTTVPVAPPPAST
FJ562287_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KJ173279_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGVLTTVPVAPPPAST
EU787444_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
GQ377581_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
GQ377607_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
FJ715414_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
FJ715413_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
FJ715412_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
FJ715385_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
FJ715387_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
MK321265_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KR013806_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
JQ040148_LHBs_P-RF-CB      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTAPAAPPPAST
Y18856_LHBs_P-RF-CB        NKDHWPEANQVGAGSFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
MG893561_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
MG893559_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPAST
LC458432_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
LC279267_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPSAST
LC279266_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPSAST
LC279265_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPSAST
LC279264_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPSAST
LC279263_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPSAST
KY881840_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KU964003_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KU964001_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KU963999_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KU963998_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KU963995_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KU963994_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KU963993_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KU963991_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KU963990_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KU963883_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KU963870_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU963868_LHBs_P-RF-CB      NKEHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU963867_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU963866_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU963865_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU963864_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU963863_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU963862_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU963861_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU963860_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU963859_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU963858_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU963857_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU963856_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KR013816_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGTLTTVPVAPPPAST
KJ173300_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KJ173299_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KC774305_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774294_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KC774258_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774246_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGVLGWSPQAQGILTTVPAAPPPAST
KC774230_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KC774201_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774198_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774186_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
JX661494_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
JX661487_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
JX429896_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
JX026887_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
JQ732168_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
JN400086_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGLLTTVPAAPPPAST
JF436922_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGVLTTVPVAPPPAST
HM750133_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
GQ377544_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KC774263_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774332_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774341_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774349_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KM213033_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
GQ377633_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
DQ478890_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KX660685_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASA
MF925389_LHBs_P-RF-DC      NLDCWPGVRQVGVGSFGPGFTPPHGNLLGWSPLHQGILTTVPAAPPPAST
GU177079_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KC774450_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPAST
MH464846_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
MH464850_LHBs_P-RF-DA      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
MH464851_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
MH464852_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
MH464835_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGMGFTPPHGGLLGWSPQAQGILQTLPANPPPPAS
KY470853_LHBs_P-RF-DC      NKDHWPEAKQVGVGAFGPGFTPPHGGLLGSSPQAQGILTTVPAAPPPAST
KU679950_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGITPPHGGLLGWSPQAQGILTTVPVAPPPAST
KF873530_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KF873527_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASA
KF873511_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KF873513_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KF873515_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KF873519_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KF873517_LHBs_P-RF-BC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KF873518_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPXAPPPAST
KF873521_LHBs_P-RF-BC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KU679948_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KU679955_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGXLXGWSPQAQGXLTTVPVAPPPAST
KU679953_LHBs_P-RF-BC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KU679944_LHBs_P-RF-BC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KU679946_LHBs_P-RF-BC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
KU679954_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASA
KF873534_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KF873533_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KF873531_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KF873532_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KF873535_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU679940_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KF873540_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU679945_LHBs_P-RF-CB      NKEHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU679939_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KF873543_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KF873542_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KF873537_LHBs_P-RF-CB      NKBXWPXANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAXPPPAST
KF873538_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU679956_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPVSA
KU679943_LHBs_P-RF-BC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASA
KU679942_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTGPAAPPPASA
KU679958_LHBs_P-RF-CB      NKXHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPAST
KF873522_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGXLTTVPTAPPPAST
KU679941_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWNPQAQGILTTVPTAPPPAST
KF873523_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPAST
KF873524_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPAST
AY057948_LHBs_P-RF-DC      NKDHWPKANQVRAGAFGPGFTPPHCSLLGWSPQAQGILTTVPAAPPPASS
JX036330_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
AB674504_LHBs_P-RF-DC      NKDQWPAANQVGVGSFGPGFTPPHGSLLGWSPQAQGILTTVPAAPPPAST
KF779353_LHBs_P-RF-DA      NKDHWPDANQVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF491448_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KY470854_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGSSPQAQGILTTVPAAPPPAST
KY470843_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGSSPQAQGILTTVPAAPPPAST
KY470846_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGSSPQAQGILTTVPAAPPPAST
KY470847_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGSSPQAQGILTTVPAAPPPAST
KY470849_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGSSPQAQGILTTVPAAPPPAST
KY470850_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGSSPQAQGILTTVPAAPPPAST
KY470855_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGSSPQAQGILTTVPAAPPPAST
KY470856_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGSSPQAQGILTTVPAAPPPAST
KY470844_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGSSPQAQGILTTVPAAPPPAST
KT991419_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPEFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774479_LHBs_P-RF-DC      NKDPWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AY817513_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPAST
KY670781_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPAST
JX036359_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
HM750145_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGCSPQAQGILTTVPAAPPPAST
KT991427_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTVPAAHPPAST
KC774485_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGIVTTVPAAPPPAST
AY817511_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGIVTTVPAAPPPAST
HM750143_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KX660686_LHBs_P-RF-DC      NKDHWPEANQVGAGASGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KX354997_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAVPPPAST
KC774456_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
HM750144_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774453_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
HM750149_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPATPPPAST
FJ349241_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
HM750142_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
HM750146_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
HM750147_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWTPQAQGILTTVPAAPPPAST
HM750148_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
HM750150_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWRPQAQGILTTVPAAPPPAST
KC774482_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KP276253_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KP276256_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KX660689_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KX660684_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
FJ562263_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTVPAAHPPAST
KC774449_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGTLTTVPAAPPPAST
KT991424_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTVPAAHPPAST
KY629632_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
JX036332_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPLHAPT
AY817510_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AY817509_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AB270535_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGNLLGWSPQAQGILTTVPAAPPPAST
KC774487_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774498_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AY817512_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KT991423_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
FJ562278_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KT991420_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KT991417_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774428_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774430_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774468_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774492_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774494_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774458_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPAST
DQ478886_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWNPQAQGILTTVPVAPPPAST
AY862865_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774470_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSLQAQGILTTVPAAPPPAST
KC774463_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774452_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774425_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774461_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTLPAAPPPAAT
JF491456_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGTLTSVPAAPPPAST
JF491455_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
JF491451_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVQAAPPPAST
KX660677_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KF917451_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774490_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWNPQAQGILTTVPAAPPPAST
KC774489_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774484_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774442_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
DQ478898_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTAVPAAPPPAST
EU787435_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTAVPAAPPPAST
KC774495_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTAVPAAPPPAST
KC774474_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTAVPAAPPPAST
KC774431_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774454_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774476_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774481_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KX660674_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KX660680_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774423_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774471_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774420_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTAVPAAPPPAST
AY862866_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
DQ478887_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPAST
DQ478889_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
DQ478892_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPAST
DQ478897_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
JF491449_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
JX429898_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774424_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPTAPPPAST
KC774432_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774433_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774434_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774435_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774439_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774443_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774455_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774466_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774472_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KX660675_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU519423_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KU519422_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KP276255_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KP276254_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774497_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774493_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774488_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774478_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774480_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
KC774483_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AY817515_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTAVPAAPPPAST
AY800249_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTAVPAAPPPAST
EU787434_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTAVPAAPPPAST
KC774422_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTAVPAAPPPAST
KC774426_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTAVPAAPPPAST
KC774447_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTAVPAAPPPAST
KC774457_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGILTAVPAAPPPAST
KC774475_LHBs_P-RF-DC      NKDHWPEAHQVGVGAFGPGFTPPHGGLLGWSPQAQGILTAVPAAPPPAST
KC774486_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGTLTAVPAAPPPAST
KC774499_LHBs_P-RF-DC      NKDHWPEANQVGVGAFGPGFTPPHGGLLGWSPQAQGTLTAVPAAPPPAST
KC774448_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPLAQGILTPVPAAPPPAST
JF440021_LHBs_P-RF-AG      IKDHWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGMLTPVSTIPPPASA
KJ586803_LHBs_P-RF-AF      NKDTWPMANKVGVGGYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPAST
GQ161753_LHBs_P-RF-AE      IKDHWPAANQVGVGAFGPGFTPPHGGVLGWSPQAQGILTTVPAVPPPAST
FJ023659_LHBs_P-RF-BC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPVVPPPAST
FJ023662_LHBs_P-RF-GC      NKDHWPQAHQVGAGAFGPGFTPPHGGLLGWSPQAQGILTNVPVVPPPAST
MF925402_LHBs_P-RF-BD      NKNIWPVANKVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
GQ161806_LHBs_P-RF-EA      NKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMLTTLPADPPPAST
EF103283_LHBs_P-RF-AD      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
EF103284_LHBs_P-RF-AD      NKDTWPDANKVGAGAFGLGFTPAHGGLLGWSPQAQGILQTLPANPPPAST
FJ562223_LHBs_P-RF-CD      NKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGTLQTLPANPPPAST
GQ377627_LHBs_P-RF-CD      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
EU185780_LHBs_P-RF-AD      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
KC012653_LHBs_P-RF-AD      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
FN594767_LHBs_P-RF-DE      NKDRWTEANKVGVGAFGPGFTPPHGGLLGWSPQAQGMQKTLPADPPPAST
AY862864_LHBs_P-RF-DC      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
AF297620_LHBs_P-RF-DA      NKDHWPEANKVGVGAFRAGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
KX357641_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FN594770_LHBs_P-RF-DE      NKDHWTDXNKVGVGAFGPGXTPPHGGLLGWSPQAQGIIQTLPANPPPAST
MH685719_LHBs_P-RF-DE      NKDTWPDANKEGTGAFGPGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FN594771_LHBs_P-RF-DE      NKDHWTDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KU736916_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KU736914_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGPGFTPLHGGLLGWSPQAQGTIQTLPANPPPAST
KP168421_LHBs_P-RF-DE      NKDTWPDANKVGTGAFGPGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KU736917_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FN594769_LHBs_P-RF-DE      NKDHWTDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
GQ161754_LHBs_P-RF-DE      NKDHWTDANKVGVGAFGPGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
AF297619_LHBs_P-RF-DA      NKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF440013_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF440012_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF440011_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF440000_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF440017_LHBs_P-RF-DA      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF440010_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPHAQGILQTLPANPPPAST
JF440006_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF440001_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF439998_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF440004_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF440005_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF439995_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF439996_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF439999_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF440002_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF440003_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF440007_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF440009_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF440014_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF440015_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF439994_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JN040803_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTMPTNPPPAST
JF754616_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
AM494716_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
X68292_LHBs_P-RF-DA        NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
KU668440_LHBs_P-RF-DE      NKDPWPDAIKVGVGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPVAAT
FJ904442_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KX357631_LHBs_P-RF-DE      NKDTWPEANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KJ647356_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JN257154_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
FJ904403_LHBs_P-RF-DE      NKDTWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
FJ349221_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
MF925371_LHBs_P-RF-DC      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGITQTLPTNPPPAST
JN664929_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAHGILQTLPANPPPAAT
AB330368_LHBs_P-RF-DA      NKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGMLLTLPANPPPAST
AY341335_LHBs_P-RF-DE      NKDTWPDANKVGTGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASS
AB674432_LHBs_P-RF-DE      NKDPWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPTNPPPAST
FJ349207_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
HQ700492_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQSMPENPPPAST
HQ700535_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
MH481860_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAFT
J02202_LHBs_P-RF-DE        NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
HQ700536_LHBs_P-RF-DE      NKDAWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700494_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700493_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FJ904430_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
AB048702_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
MH481859_LHBs_P-RF-DE      NKDTWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700533_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
AB033559_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700524_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700525_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
MH481858_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
MH481861_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
MH481862_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700500_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700579_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700585_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700539_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
AB048703_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
HQ700497_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700501_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700503_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700534_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700584_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700583_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700582_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700581_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700541_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700540_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700537_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
HQ700538_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
JN040798_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
MF618346_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
KF192833_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
KF192835_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
KF192836_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
KF192837_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
KF192838_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
KF192839_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
KF192840_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
KF192841_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
MF618347_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
MF488699_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAAT
KJ803771_LHBs_P-RF-DB      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FJ904436_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
FJ904425_LHBs_P-RF-DE      NKDTWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGIIHTLPANPPPAST
FJ904405_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGITQTLPANPPPAST
AY236161_LHBs_P-RF-DA      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JN664934_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAAT
AB033558_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAAT
JN664915_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAAT
JN664933_LHBs_P-RF-DA      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAAT
DQ315779_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAAT
JN664940_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAAT
KT366505_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAAT
GQ205379_LHBs_P-RF-DE      NKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAAT
KC875339_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAAT
GQ205387_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAAT
GQ205377_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAAT
GQ205378_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAAT
GQ205386_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAAT
KC875338_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAAT
JN664925_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAAT
MF925396_LHBs_P-RF-DC      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KX827299_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FJ904444_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FJ904437_LHBs_P-RF-DE      NKDNWPDANKVGAGAFGVGFTPLHGGLLGWSPQAQGILTTLPANPPPAST
FJ904396_LHBs_P-RF-DE      NKDNWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAKPPPASA
AY373430_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
KM359442_LHBs_P-RF-DE      NKDNWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JF754613_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPAST
FJ904441_LHBs_P-RF-DE      NKDTWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
DQ991753_LHBs_P-RF-DE      NKDPWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
AJ627221_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
X65259_LHBs_P-RF-DA        NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILHTVPANPPPAST
GU563560_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
AB674433_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPAST
AB188243_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGPGLTPPHGGLLGWSPQAQGILQTLQTNPPPAST
KP288875_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KM606741_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KM524357_LHBs_P-RF-DE      NKDTWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KJ647349_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JX898695_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JX898696_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JX898693_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JN642160_LHBs_P-RF-DE      NKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FJ904440_LHBs_P-RF-DE      NKDNWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
FJ904406_LHBs_P-RF-DE      NKDTWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FJ904404_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FJ904447_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FJ904394_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FJ904400_LHBs_P-RF-DE      NKDTWPDANKVGVGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
JX898686_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTVPANPPPAST
FJ349212_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPAST
KJ586811_LHBs_P-RF-DF      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JX898687_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JX898688_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JX898690_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JX898698_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JX898699_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
MF967563_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
U95551_LHBs_P-RF-DE        NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
MF925401_LHBs_P-RF-DB      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KM577666_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
AB188245_LHBs_P-RF-DE      NKDTWPNANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JN688717_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KR905422_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
KT366503_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPAST
MF925388_LHBs_P-RF-DC      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
MF925392_LHBs_P-RF-DB      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
MF925360_LHBs_P-RF-DB      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KX827302_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
KX357627_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPANPPPAST
KP995112_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KJ470898_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGXTPPHGGLLGWSPQAQGIIQTLPANPPPAST
AB674436_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
AB270538_LHBs_P-RF-DE      NKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPAST
X80925_LHBs_P-RF-DE        NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
JN257204_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPPST
JN664946_LHBs_P-RF-DA      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
EU594406_LHBs_P-RF-DE      NKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
JQ687532_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
MK052969_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPAST
KX357634_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KX357629_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KX357628_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KX357625_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KM577664_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
KJ470897_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
JN642139_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTMPANPPPAST
JN257164_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
FJ904414_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPTST
FJ904409_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FJ904408_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FJ904407_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FJ904398_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
EU594436_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
EU594435_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILHTLPANPPPAST
EF103285_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
AY233295_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASI
AB210819_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
KX357626_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KX357630_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KX357623_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KX357633_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KX357635_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KJ470884_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KJ470886_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KJ470887_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KJ470888_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KJ470890_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KJ470891_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FJ904416_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FJ904417_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KM577663_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
KJ647351_LHBs_P-RF-DE      NKDNWPDANKVGAGAFGLGXTPPHGGLLGWSPQAQGILQTLPANPPPAST
KF471643_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPAST
JN688689_LHBs_P-RF-DE      NKDTWPXANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JN642137_LHBs_P-RF-DE      NKDSWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
AB583679_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
AJ627217_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
DQ111987_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
FJ692536_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
GQ183486_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
KX357636_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KT366492_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
KM524359_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPAST
JN664943_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASA
JN642152_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
MF925397_LHBs_P-RF-DC      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
KF170740_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
JN642141_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JN642127_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
AJ344117_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
AY233293_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
KU736923_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KU736922_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KU736921_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KU711666_LHBs_P-RF-DE      NKDPWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KP168418_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KP168417_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KM606751_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KM606750_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAST
KM577665_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JN688715_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
KT366504_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
KP168416_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPVST
KM577667_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JN257191_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPVST
JN257216_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGXGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JN257189_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
MF925384_LHBs_P-RF-DB      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JN257206_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
JN257174_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTXPANPPPAST
JN257210_LHBs_P-RF-DE      NKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAST
EU833890_LHBs_P-RF-GA      KKDPWPEANKVGVGAFGPGLTPPHGGLLGWSPQAQGILTTVSTIPPPAST
AB933279_LHBs_P-RF-AG      KKDPWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPAST
AB933280_LHBs_P-RF-AG      KKDPWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPAST
AB933281_LHBs_P-RF-AG      KKDPWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPAST
EF464099_LHBs_P-RF-AG      KKDPWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPAST
KF219922_LHBs_P-RF-GH      KKDPWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPAST
JQ272886_LHBs_P-RF-GF      KKDPWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPAST
JQ272887_LHBs_P-RF-GF      KKDNWPEANKVGVGAYGPGFTPPHGGLLGWSPQAQGTLTTLPADPPPAST
JQ801476_LHBs_P-RF-CG      KKDPWPEANKVGVGAYGPGFTPPHGGLLGWSPQSQGTLTTLPADPPPAST
KM875422_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPVAPPPAST
EU919167_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
EU939606_LHBs_P-RF-CB      NKDHWPEANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPAST
HQ700532_LHBs_P-RF-CB      NKDHWPKANQVGAGAFGPGFTPPHGGLLGWSPQAQGILTPVPAAPPPAST
HQ700580_LHBs_P-RF-CB      NKDQWPEANQVGAGAFGXGFTPPHGGLLGWSPQAQGILTTVPTAPPPAST
                               *       .*       * .  : *      .              

JN664935_LHBs_P-RF-DC      NQQSGRQPTPMSPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSS
DQ464167_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPHI-QWNSTAFKQTLQDPRVRGLYLPAGGSS
KM386676_LHBs_P-RF-DE      NRQSGRQPTPLTPPLRDTHPQA-QWTSSTFHQTLQDPRVRGLYLPAGGSS
DQ464164_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPHI-QWNSTTFYQTLQDPRVRGLYFPAGGSS
KX357624_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPEA-QWNSTTFHQTLQDPRVRGL--PAGGSS
HE981179_LHBs_P-RF-FG      NRRSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYVPAGGSS
KJ803822_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KJ586810_LHBs_P-RF-AF      NRRSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALLDPRVRALYFPAGGSS
KF053166_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNSSTFHPTLQDPRVRALYFPAGGSS
KJ803827_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNSSTFHPTLQDPRVRALYFPAGGSS
KX765835_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYLPAGGSS
AY161145_LHBs_P-RF-AD      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
AY161146_LHBs_P-RF-AD      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
KP274926_LHBs_P-RF-GA      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
JF440019_LHBs_P-RF-AG      NRQSGRQPTPISPPLRDSHPQAMQWNSTALHQALQDPRVRGLYFPAGGSS
JF440022_LHBs_P-RF-AG      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPRVRGLYFPAGGSS
MF925386_LHBs_P-RF-AC      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQDPRVRGLYLPAGGSS
AB453985_LHBs_P-RF-AC      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
AB222708_LHBs_P-RF-AD      NRQTGRQPTPISPPLRDSHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
AB933282_LHBs_P-RF-AG      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
AB933283_LHBs_P-RF-AG      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
AY161140_LHBs_P-RF-AD      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQDPRVRGLYSPAGGSS
AY161141_LHBs_P-RF-AD      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQDPRVRGLYLLAGGSS
GQ331048_LHBs_P-RF-AE      NRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALQDPRVRGLYFPAGGSS
KF214656_LHBs_P-RF-AC      NRQSGRQPTPISTPLRDSHPQAIQWNSTAFHQTLQDPRVRGLYFPAGGSS
AB194949_LHBs_P-RF-AE      NRQSGRQPTPISPPLRDSHPQAVQWNSTAFHQALQDPRVRGLYLPAGGSS
AY233277_LHBs_P-RF-AC      NRLSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
HF571060_LHBs_P-RF-AE      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
GQ161837_LHBs_P-RF-AE      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
GQ161838_LHBs_P-RF-AE      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
HM146131_LHBs_P-RF-AD      NRQSGRQPTPISPPLRDSHPQAIQWNSTAFHQTLQDPRVRGLYFPAGGSS
MF488705_LHBs_P-RF-AD      NRQSGRQPTPISPPLRDSHPQAVQWNSTAFHQALQDPRVRGLYFPAGGSS
MF925404_LHBs_P-RF-AC      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KP148441_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPKIRGLYFPAGGSS
KP148450_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYLPAGGSS
KP148442_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNSTNFHQALQDPRIRGLYLPAGGSS
EU833891_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
FJ882610_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPKVRGLYFPAGGSS
FJ882614_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPKVRGLYFPAGGSS
KY471004_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSS
KY470999_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSS
KY471000_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSS
KY471002_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSS
KY470997_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSS
KY470998_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSS
KY471001_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSS
KY471003_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSS
KY471006_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSS
KY471007_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSS
KY471005_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSS
FR714490_LHBs_P-RF-GB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSS
KP148586_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSS
KC172106_LHBs_P-RF-GB      NRQSGRQPTPISPPLRDSHPQARQWNSTTFHQALQDPRIRGLYLPAGGSS
EU835240_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ882613_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
FJ023666_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFXQALQDPRVRGLYFPAGGSS
FJ882612_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
FJ882618_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
FJ882617_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
FJ023670_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
FJ023664_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
FJ023665_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
FJ023667_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
FJ023668_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
FJ023673_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
FJ386674_LHBs_P-RF-BC      NRQLGRQPTPVTPPLRDTHPQATQWNSTTFHQTLQDPRVRALYFPAGGSS
KF053186_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KJ803778_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
MG826145_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSS
MH746811_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNITTFHQTLQDPRVRALYFPAGGSS
MH746812_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNITTFHQTLQDPRVRALYFPAGGSG
MH746813_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSG
MG826150_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAAQWNSTTFHQTLQDPKVRALYFPAGGSS
MG826151_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAAQWNSTTFHQTLQDPRVRALYFPAGGSS
EU939631_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSS
KC793112_LHBs_P-RF-BC      NRQTGRQPTPISPPLRDTHPQAMRWNSTTFHQTLQDPRVRALYLPAGGSS
HQ684849_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
JQ412091_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU939629_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRALYFPAGGSS
EU882006_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPAGGSS
GQ377635_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774178_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSS
KC774364_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSS
GQ377630_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KP148337_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KF053188_LHBs_P-RF-CB      NRQSGRQTTPFSPPLRDTHPQAMQWNSTTVHQTLQDPRVRGLYFPAGGSS
KJ803782_LHBs_P-RF-CB      NRQSGRQTTPFSPPLRDTHPQAMQWNSTTVHQTLQDPRVRGLYFPAGGSS
KC315400_LHBs_P-RF-CB      NRQSGRQPTPFSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
KF053179_LHBs_P-RF-BC      NRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
KJ803772_LHBs_P-RF-BC      NRQVGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
KJ717800_LHBs_P-RF-CB      NRQSGRQPTPVSPPLRDTHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSS
KJ803791_LHBs_P-RF-CB      NRQSGRQPTPVSPPLRDTHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSS
FJ562229_LHBs_P-RF-CB      NRQFGGGATPLSPPLTDNNPHAIQWNSSTFHQTLQDPRVRALHSPAGGSS
JQ801477_LHBs_P-RF-BC      NRQSGRQPTPLSPPLRDTHPLAMHWNSTTFRQTLQDPRVRALYFPAGGSS
KJ717815_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KJ803803_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KJ717816_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KJ410497_LHBs_P-RF-BC      NRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
EU660227_LHBs_P-RF-BC      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
MK052976_LHBs_P-RF-BD      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALQDPRVRALYFPAGGSS
GQ377595_LHBs_P-RF-BC      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
EU939627_LHBs_P-RF-BC      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
MK052970_LHBs_P-RF-BD      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALQDPRVRALYFPAGGSS
MK052967_LHBs_P-RF-BD      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALQDPRVRALYFPAGGSS
KC774414_LHBs_P-RF-BC      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
MK052968_LHBs_P-RF-BD      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALQDPRVRALYFPAGGSS
KJ717832_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQALLAPRVRGLYLPAGGSS
EU919166_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KJ717814_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSS
KJ803802_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSS
KF053160_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSS
KJ803753_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSS
EU939623_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTKFHQTLQDPRVRALYFPAGGSS
EU939620_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAIRWNSTTFHQTLQDPRVRALYSPAGGSS
MH094410_LHBs_P-RF-BC      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
GQ377604_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
GQ377592_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
EU939621_LHBs_P-RF-CB      NRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
FJ562328_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMKWNSPTFHQTLQDPRVRALYFPAGGSS
FJ562247_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSS
EU939630_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
HQ684848_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALFFPAGGSS
GQ377564_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSXTFHQTLQDPRVRALYFPAGGSS
GQ377590_LHBs_P-RF-CB      NRQSGRQPTPLTPPLRDTHPQAMKWNSPTFHQTLQDPRVRXLYFPAGGSS
GQ377614_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
GQ377596_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
GQ377573_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
GQ377549_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
GQ377613_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
GQ377626_LHBs_P-RF-CB      NRQSGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
GQ377634_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
JQ040174_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
EU881995_LHBs_P-RF-CB      NRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSS
KJ803804_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSS
EU522070_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFQQALLDPRVRGLYFPAGGSN
GQ377602_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MG826148_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
GQ377556_LHBs_P-RF-CB      NRQSGRQPTPLTPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
GQ377594_LHBs_P-RF-CB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
JF436919_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYFPAGGSS
EF494378_LHBs_P-RF-CA      NRQSGRQPTPISPPLRDSHPQAIQWNSTTFHHTLLDPRVRGLYFPAGGSS
JF436923_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSS
HQ700519_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSS
AP011108_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AB241109_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700520_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNAKTFHQALLDPRVRGLYFPAGGSS
HQ700531_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700527_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700528_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700523_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700530_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU695745_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700498_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700499_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
X75656_LHBs_P-RF-CB        NRQSGRQPTPISPPLRDSHPQAMQWNSTTFQQALLDPRVRGLYFPAGGSS
HQ700557_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700554_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700462_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPAGGSS
HQ700485_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700560_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNXTTFHQALLDPRVRGLYFPAGGSS
HQ700542_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU695746_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU695744_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU695743_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU695741_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700515_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSS
HQ700509_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSS
HQ700507_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700508_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AB105172_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTNFHQALLDPRVRGLYFPAGGSS
HQ700518_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSG
AP011102_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AB493842_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AP011103_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AB493840_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALLDPRVRGLYFPAGGSS
AB493838_LHBs_P-RF-CB      NRQSGRQPTPISPPLTDSHPQAMQWNSTAFHQALLDPRVRGLYFPAGGSS
AB493837_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALLDPRVRGLYFPAGGSS
AB493847_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALLDPRVRGLYFPAGGSS
GQ358155_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALLDPRVRGLYFPAGGSS
GQ358156_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALLDPRVRGLYFPAGGSS
AB195940_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AB195941_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FR714496_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAIQWNSSKFHQALLDPRVRGLYSPAGGSS
FJ562317_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSS
MF925382_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSS
JQ027310_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSS
KJ803785_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSS
MF925370_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSNTFHQALLDPRVRGLYFPAGGSS
KJ803798_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSS
GQ924618_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPKVRGLYFPAGGSS
AB031265_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSS
KJ410506_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSS
AP011104_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AP011105_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
LC416040_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSS
KP148352_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KT003704_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KX096713_LHBs_P-RF-CA      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
JX504540_LHBs_P-RF-CB      NRQLGRQPTPISPPLRDSHPQAVQGNSTTFQQALLDPRVRGLYFPAGGSS
JQ040146_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFXQALLDPRVRGLYFPAGGSS
HQ700521_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700505_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU939547_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSS
MG826141_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLGPKVRGLDLPAGGSS
MG826147_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAAQWNSTTFHQALLGPKVRALNLPAGGSS
KC774324_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AY206374_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQATQWNSTTFLQTLLDPKVRGLYFPVGGSS
GU357843_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AB195939_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AB195955_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AB195956_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AB195957_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KJ598675_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSS
MG826146_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYYPAGGSS
GU385774_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSS
AB195950_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVKGLYFPAGGSS
AB195951_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVKGLYFPAGGSS
AB367800_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPAGGSS
FJ562227_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYIPAGGSS
AB367419_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSS
JX661485_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRALYLPGGGSS
KJ173320_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KJ173322_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AB367400_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AB367393_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSS
FJ386649_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AB049609_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYLPAGGSS
KR013843_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSS
AB300369_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAVQWNSTTFQQALLDPRVRGLYLPAGGSS
FJ787446_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSS
FJ787480_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSS
AF411409_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSS
JF828936_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSS
JF828933_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSS
JF828934_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSS
JF828938_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSS
JF828935_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSS
MG826142_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLDLPAGGSS
JX036329_LHBs_P-RF-CD      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
MG826144_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNTTTFHQALLDPRVRGLYFPAGGSS
EU871990_LHBs_P-RF-CB      NRQSERQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU871988_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU871999_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU871981_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU871983_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU871986_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU871991_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU871984_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU871985_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU871987_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU871989_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU871992_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU871993_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU871994_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU871995_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU871996_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
M38454_LHBs_P-RF-CB        NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774188_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700526_LHBs_P-RF-CB      NRQLGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
GQ377522_LHBs_P-RF-CB      NRKSGRQPTPISPPLRDSRPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FJ562294_LHBs_P-RF-CB      NRQSGRQPTPFSPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSS
DQ089798_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774193_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774291_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774307_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774323_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU695742_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
JX036358_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNPTTFHQTLQDPRVRGLYFPAGGSS
JQ040175_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FJ562267_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU939551_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSS
AY123041_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU589337_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGL--PAGGSS
FJ032343_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGL--PAGGSS
GQ377534_LHBs_P-RF-CB      NRQTGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
JX036328_LHBs_P-RF-CD      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774212_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964005_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964006_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964007_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964008_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964009_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964010_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964303_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964304_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964305_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964306_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964307_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964308_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964309_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964310_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964311_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964312_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964313_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964314_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964315_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964316_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQDLLDPRVRGLYFPAGGSS
KU964317_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU916232_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
MG893555_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSS
MG893554_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSS
KJ173350_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KJ173325_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774234_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSS
JQ040142_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSS
FJ386586_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQATQWNSTTFHQALLDPRVRGLYLPAGGSS
AF233236_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FJ562305_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYLPAGGSS
EU939577_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYLPAGGSS
MG826149_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774183_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
GQ377560_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FJ715345_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FJ562314_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FJ562226_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLGPRVRGLYFPAGGSS
EU939668_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU939589_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EF494376_LHBs_P-RF-CA      NRQSGRQPTPISPPLRDSHPQAIKWNSTTFHQALLDPRVRDLYFPAGGSS
AY247030_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AY123424_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AB198084_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AB033557_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AF461361_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGL--PAGGSS
KC774317_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774322_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU939565_LHBs_P-RF-CB      NRQTGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
GQ377520_LHBs_P-RF-CB      NRQTGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AB642096_LHBs_P-RF-CB      NRQTGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KJ173358_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KJ173326_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNLTTFHQALLDPRVRGLYFPAGGSS
KC774344_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ715411_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU916239_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU916240_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU916241_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU717211_LHBs_P-RF-CB      TRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPAGGSS
AF330110_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AB205152_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU871997_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FJ386581_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FJ386635_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSS
GQ377611_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
Y18857_LHBs_P-RF-CB        NRQSGRKPTPLSPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KY470893_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KY363263_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964351_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963869_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KJ173349_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KJ173329_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774328_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774222_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
JX661498_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLLDPRVRGLYFPAGGSS
JX661486_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700547_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTNFHQALLDPRVRGLYFPAGGSS
GQ377516_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPKVRGLYFPAGGSS
FJ715384_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLGPRVRGLYFPAGGSS
FJ715346_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FJ715347_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AY040627_LHBs_P-RF-CB      YRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
AY167095_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FJ386585_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FJ562287_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQALLDPRVRGLYFPAGGSS
KJ173279_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU787444_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
GQ377581_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVXGLYFPAGGSS
GQ377607_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FJ715414_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FJ715413_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FJ715412_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FJ715385_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
FJ715387_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
MK321265_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLXPRVRGLYFPAGGSS
KR013806_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAVQWNSTTFHQALLDPRVRGLYFPAGGSG
JQ040148_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
Y18856_LHBs_P-RF-CB        NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
MG893561_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
MG893559_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
LC458432_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
LC279267_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
LC279266_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
LC279265_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
LC279264_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
LC279263_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KY881840_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964003_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU964001_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963999_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963998_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963995_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963994_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963993_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963991_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963990_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963883_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRSLYFPAGGSS
KU963870_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963868_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963867_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963866_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963865_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963864_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963863_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963862_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963861_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963860_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963859_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963858_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963857_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KU963856_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KR013816_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KJ173300_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KJ173299_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774305_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774294_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774258_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774246_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774230_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774201_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774198_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774186_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
JX661494_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
JX661487_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
JX429896_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
JX026887_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
JQ732168_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
JN400086_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
JF436922_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HM750133_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
GQ377544_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774263_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774332_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774341_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KC774349_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
KM213033_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
GQ377633_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
DQ478890_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPHAMHWNSTTFHQTLQDPKVRGLYFPAGGSS
KX660685_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAXQWNSTTFLQTLQDPRVRGLYFPAGGSS
MF925389_LHBs_P-RF-DC      NRQSGRQPTPLSPPLRNTHPQAMQWNSRTFHQALQDPRVRGLYFPAGGSS
GU177079_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774450_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MH464846_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MH464850_LHBs_P-RF-DA      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MH464851_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MH464852_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MH464835_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KY470853_LHBs_P-RF-DC      NRQAGRQPTPISPPLRDSHPQATQWNSTTFLRALQDPRVRGLYFPAGGSS
KU679950_LHBs_P-RF-CB      NRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KF873530_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNTTTFHQALQDXRVRGLYFPAGGSS
KF873527_LHBs_P-RF-CB      NRQSGRQPTPISPPLRVTHPQAMQWNSSAFHQALQDPRVRGLYFPAGGSS
KF873511_LHBs_P-RF-CB      NRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KF873513_LHBs_P-RF-CB      NRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KF873515_LHBs_P-RF-CB      NRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KF873519_LHBs_P-RF-CB      NRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KF873517_LHBs_P-RF-BC      NRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KF873518_LHBs_P-RF-CB      NRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KF873521_LHBs_P-RF-BC      NRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KU679948_LHBs_P-RF-CB      NRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KU679955_LHBs_P-RF-CB      NRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KU679953_LHBs_P-RF-BC      NRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KU679944_LHBs_P-RF-BC      NRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KU679946_LHBs_P-RF-BC      NRQSGRQPTPITPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KU679954_LHBs_P-RF-CB      NRQSGRQPTPISQPLRVTHPQAXQWNSSAFHQALQDPXVRGLYXPAGGSS
KF873534_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQALQDPRVKGLYFPAGGSS
KF873533_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KF873531_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KF873532_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KF873535_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KU679940_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYXPAGGSS
KF873540_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KU679945_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQTLQDPRVRGLYFPAGGSS
KU679939_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KF873543_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KF873542_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KF873537_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTAXHQALQDPRVRXLYFPAGGSS
KF873538_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KU679956_LHBs_P-RF-CB      NRQSGRQPTPISPPLRVTHPQAMQWNSSAFHQALQDPRIRGLYFPAGGSS
KU679943_LHBs_P-RF-BC      NRQSGRQPTPISQPLRVTHPQAMQWNSSAFHQALQDPXVRGLYFPAGGSS
KU679942_LHBs_P-RF-CB      NRQSGRQPTPISQPLRVTHPQAMQWNSSAFHQALQDPRVRGLYFPAGGSS
KU679958_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFQQALLDPRVRGLYFPAGGSS
KF873522_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSXTFQQALLDPRVRGLYFPAGGSS
KU679941_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFQQALLDPRVRGLYFPAGGSS
KF873523_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFQQALLDPRVRGLYFPAGGSS
KF873524_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFQQALLDPRVRGLYFPAGGSS
AY057948_LHBs_P-RF-DC      NRQSGKQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JX036330_LHBs_P-RF-DC      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTQQDPRVRGLYFPAGGSS
AB674504_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDTHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSS
KF779353_LHBs_P-RF-DA      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF491448_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KY470854_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAVQWNSTTFLQTLQDPRVRGLYFPAGGSS
KY470843_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAVQWNSTTFLQTLQDPRVRGLYFPAGGSS
KY470846_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAVQWNSTTFLQTLQDPRVRGLYFPAGGSS
KY470847_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAVQWNSTTFLQTLQDPRVRGLYFPAGGSS
KY470849_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAVQWNSTTFLQTLQDPRVRGLYFPAGGSS
KY470850_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAVQWNSTTFLQTLQDPRVRGLYFPAGGSS
KY470855_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAVQWNSTTFLQTLQDPRVRGLYFPAGGSS
KY470856_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAVQWNSTTFLQTLQDPRVRGLYFPAGGSS
KY470844_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAVQWNSTTFLQTLQDPRVRGLYFPAGGSS
KT991419_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774479_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AY817513_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KY670781_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQALQWNSTTFHQTLQDPRVRGL--PAGGSS
JX036359_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HM750145_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSS
KT991427_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
KC774485_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AY817511_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HM750143_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX660686_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX354997_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774456_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HM750144_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTPQDPRVRGLYFPAGGSS
KC774453_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HM750149_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ349241_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HM750142_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HM750146_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HM750147_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HM750148_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HM750150_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774482_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KP276253_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KP276256_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX660689_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX660684_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ562263_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVKGLYLPAGGSS
KC774449_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
KT991424_LHBs_P-RF-DC      NRQSGRQPTPISPPLRNSHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
KY629632_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JX036332_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AY817510_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAIQWNSTTFHQTLQDPRVRGLYFPVGGSS
AY817509_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AB270535_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774487_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774498_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AY817512_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVGGLYFPAGGSS
KT991423_LHBs_P-RF-DC      NRQSGRLPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ562278_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KT991420_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KT991417_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
KC774428_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFLQTLQDPRVRGLYFPAGGSS
KC774430_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774468_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774492_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774494_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774458_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
DQ478886_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AY862865_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774470_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774463_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774452_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774425_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774461_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF491456_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF491455_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF491451_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX660677_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAYKWNSTTFHQTLQDPRVRGLYFPAGGFS
KF917451_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774490_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774489_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774484_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774442_LHBs_P-RF-DC      TRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
DQ478898_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
EU787435_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQATQWNSTTFLQTLQDPRVRGLYFPAGGSS
KC774495_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774474_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774431_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774454_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774476_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774481_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFLQTLQDPRVRGLYFPAGGSS
KX660674_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX660680_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774423_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774471_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774420_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AY862866_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
DQ478887_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
DQ478889_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
DQ478892_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
DQ478897_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF491449_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JX429898_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774424_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774432_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774433_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774434_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774435_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774439_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774443_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774455_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774466_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774472_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX660675_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KU519423_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KU519422_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KP276255_LHBs_P-RF-DC      NRQSRRQPTPISPPLRYSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KP276254_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774497_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774493_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774488_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774478_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774480_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774483_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AY817515_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AY800249_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
EU787434_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774422_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774426_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774447_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774457_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774475_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774486_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774499_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC774448_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF440021_LHBs_P-RF-AG      NRQSGRQPTPISPPLRDSHPQAMQW-------ALQDPKVRGLYFPAGGSS
KJ586803_LHBs_P-RF-AF      NRRSGRKPTPVSPPLRDTHPQAMQWNSTQFHQALSDPRVRALYFPAGGPS
GQ161753_LHBs_P-RF-AE      NRQSGRQPTPISPPLRDSHPQAMQWNSTNFHQALQDPRVRGLYFPAGGSS
FJ023659_LHBs_P-RF-BC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALQDPRIRGLYFPAGGSS
FJ023662_LHBs_P-RF-GC      NRQSGRQPTPISPPLRDSHPQAMQWNSTNFHQALQDPRIRGLYFPAGGSS
MF925402_LHBs_P-RF-BD      NRQSGRQPTPISPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSS
GQ161806_LHBs_P-RF-EA      NRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQPLQBPRVRGQDFPAGGSS
EF103283_LHBs_P-RF-AD      NRQSGRQPTPLSPPLRNTHPQAMQWNSTAFHQALQDPTVRGLYFPAGGSS
EF103284_LHBs_P-RF-AD      NRQSGRQPTPLSPPLRNTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
FJ562223_LHBs_P-RF-CD      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSS
GQ377627_LHBs_P-RF-CD      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
EU185780_LHBs_P-RF-AD      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KC012653_LHBs_P-RF-AD      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FN594767_LHBs_P-RF-DE      NRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
AY862864_LHBs_P-RF-DC      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AF297620_LHBs_P-RF-DA      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX357641_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRSTHPQAMQWNSTTFHQTLQDSRVRGLYFPAGGSS
FN594770_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHXTLQDPRVRGLYLPAGGSI
MH685719_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FN594771_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KU736916_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KU736914_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KP168421_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRETHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
KU736917_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FN594769_LHBs_P-RF-DE      NRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
GQ161754_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
AF297619_LHBs_P-RF-DA      NRQSGRQPTPMSPPLRNTHPQAMQWNSTALHQALQDPRDRGLYFPAGGSS
JF440013_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
JF440012_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF440011_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF440000_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQALQDPRARGLYFPAGGSS
JF440017_LHBs_P-RF-DA      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF440010_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF440006_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
JF440001_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF439998_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF440004_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF440005_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF439995_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF439996_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF439999_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF440002_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF440003_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF440007_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF440009_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF440014_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF440015_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF439994_LHBs_P-RF-DE      NRQTERQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN040803_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSS
JF754616_LHBs_P-RF-DE      NRQSRRQPTPLSPPLRDTHPQAMQWNITTFHQTLQDPRVKGLYYHAGGSS
AM494716_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSS
X68292_LHBs_P-RF-DA        NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KU668440_LHBs_P-RF-DE      NRQSGRQPTPMSPPVRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904442_LHBs_P-RF-DE      NRQSGRQPTPPTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX357631_LHBs_P-RF-DE      KRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGL--PAGGSS
KJ647356_LHBs_P-RF-DE      NRXSGRQPTPLSPPLRDSHPQVMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN257154_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904403_LHBs_P-RF-DE      NRQSGRQPTPLSLPLRVTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ349221_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLNFPAGGSS
MF925371_LHBs_P-RF-DC      NRRSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVKDLYFPAGGSS
JN664929_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQALQDPRVRGQNFPAGGSS
AB330368_LHBs_P-RF-DA      NRQSGRQPTPLSPPLRDTHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
AY341335_LHBs_P-RF-DE      NRQSGRQPTPPSPPLRNTHPQAMKWNSTTFRQILQDPRVRGLYFPAGGSS
AB674432_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLNLPAGGSS
FJ349207_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMHWNSTTFHQTLQDPKVRGLYLPAGGSS
HQ700492_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRITHPQAMQWNSTTFHQNLQDPRVRGLYFPAGGSS
HQ700535_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MH481860_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWXSTTFHQTLQDPRVRGLYFPAGGSS
J02202_LHBs_P-RF-DE        NRQSGRQPTPLSPPLRTTHPQAMHWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700536_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700494_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700493_LHBs_P-RF-DE      NRQXXRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904430_LHBs_P-RF-DE      NRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
AB048702_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
MH481859_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWXSTTFHQTLQDPRVRGLYFPAGGSS
HQ700533_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AB033559_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700524_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700525_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MH481858_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWXSTTFHQTLQDPRVRGLYFPAGGSS
MH481861_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWXSTTFHQTLQDPRVRGLYFPAGGSS
MH481862_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWXSTTFHQTLQDPRVRGLYFPAGGSS
HQ700500_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700579_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSS
HQ700585_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSS
HQ700539_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AB048703_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700497_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700501_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700503_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700534_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPXVRGLYFPAGGSS
HQ700584_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700583_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700582_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700581_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700541_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700540_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700537_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
HQ700538_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN040798_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVGGLYFPAGGSS
MF618346_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KF192833_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KF192835_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KF192836_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KF192837_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KF192838_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KF192839_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KF192840_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KF192841_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MF618347_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MF488699_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAVRWNSTTFHQALQDPRVRGLNRPAGGST
KJ803771_LHBs_P-RF-DB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904436_LHBs_P-RF-DE      NRQSGRLPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904425_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904405_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AY236161_LHBs_P-RF-DA      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN664934_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSS
AB033558_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDAHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSS
JN664915_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGST
JN664933_LHBs_P-RF-DA      NRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGST
DQ315779_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGST
JN664940_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGST
KT366505_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGST
GQ205379_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDYHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSS
KC875339_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPKVRGLYFPAGGST
GQ205387_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRVTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGST
GQ205377_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGST
GQ205378_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGST
GQ205386_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGST
KC875338_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGST
JN664925_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGST
MF925396_LHBs_P-RF-DC      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX827299_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904444_LHBs_P-RF-DE      NRQSRRQPTPPSLPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904437_LHBs_P-RF-DE      NCQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYLPAGGSS
FJ904396_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQATQWNSTTFHQNLQDPRVRDLNSPAGGSS
AY373430_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KM359442_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JF754613_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTPFHQTLQDPRVRGLYFPAGGSS
FJ904441_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
DQ991753_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
AJ627221_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPTVRGLNFPAGGSS
X65259_LHBs_P-RF-DA        NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
GU563560_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRSLYFPAGGSS
AB674433_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRSLYFPAGGSS
AB188243_LHBs_P-RF-DE      NRKLGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSS
KP288875_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KM606741_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLHFPVGGSS
KM524357_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KJ647349_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JX898695_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JX898696_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JX898693_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN642160_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904440_LHBs_P-RF-DE      KRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
FJ904406_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904404_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904447_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904394_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
FJ904400_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JX898686_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ349212_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
KJ586811_LHBs_P-RF-DF      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JX898687_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JX898688_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JX898690_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JX898698_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQXMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JX898699_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MF967563_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
U95551_LHBs_P-RF-DE        NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MF925401_LHBs_P-RF-DB      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFNQTLQDPRVRGLYFPAGGSS
KM577666_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDTRVTGLNFPAGGSS
AB188245_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN688717_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KR905422_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KT366503_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MF925388_LHBs_P-RF-DC      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MF925392_LHBs_P-RF-DB      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MF925360_LHBs_P-RF-DB      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX827302_LHBs_P-RF-DE      NRHSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPKVRGLTFPAGGSS
KX357627_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KP995112_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
KJ470898_LHBs_P-RF-DE      NRQXGRQPTPLSPPLRNTHPQAMQWNSTTFXQTLQDPRVRGLYFPAGGSS
AB674436_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSS
AB270538_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
X80925_LHBs_P-RF-DE        NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN257204_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
JN664946_LHBs_P-RF-DA      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSS
EU594406_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JQ687532_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MK052969_LHBs_P-RF-DE      TRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHHTLQDPRVRGLYFPAGGSS
KX357634_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAWKWNSTTFHQTLQDPRVRGLYSPAGGSS
KX357629_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
KX357628_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX357625_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KM577664_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KJ470897_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN642139_LHBs_P-RF-DE      NRQSRRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN257164_LHBs_P-RF-DE      NRQSRRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904414_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904409_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904408_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904407_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTIFHQTLQDPRVRGLYFPAGGSS
FJ904398_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
EU594436_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGFS
EU594435_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
EF103285_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
AY233295_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AB210819_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX357626_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX357630_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX357623_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX357633_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX357635_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KJ470884_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KJ470886_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KJ470887_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KJ470888_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KJ470890_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KJ470891_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904416_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ904417_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KM577663_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KJ647351_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
KF471643_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN688689_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN642137_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
AB583679_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AJ627217_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
DQ111987_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
FJ692536_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
GQ183486_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KX357636_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
KT366492_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KM524359_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMHWNSTTFHQTLQDPRVRGLYFPAGGSN
JN664943_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSS
JN642152_LHBs_P-RF-DE      NRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
MF925397_LHBs_P-RF-DC      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSS
KF170740_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRSTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN642141_LHBs_P-RF-DE      NRQSGRQPTPLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN642127_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AJ344117_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
AY233293_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KU736923_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KU736922_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KU736921_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KU711666_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KP168418_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KP168417_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KM606751_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGCSS
KM606750_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KM577665_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQNPRVRGLYFPAGGSS
JN688715_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KT366504_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KP168416_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
KM577667_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN257191_LHBs_P-RF-DE      NRXSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSS
JN257216_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQXMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN257189_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYXPAGGSS
MF925384_LHBs_P-RF-DB      NRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN257206_LHBs_P-RF-DE      NRQTGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQDPRVXGLYLPAGGSS
JN257174_LHBs_P-RF-DE      XRQSGRQPTPLSPPLRBTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
JN257210_LHBs_P-RF-DE      NRQSGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSS
EU833890_LHBs_P-RF-GA      NRQSGRQPTPISPPLRDSHPQAMQWNSTAVHQALQDPRVRGLNFPAGGSS
AB933279_LHBs_P-RF-AG      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQTLQDPRVRGLYLPAGGSS
AB933280_LHBs_P-RF-AG      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQTLQDPRVRGLYLPAGGSS
AB933281_LHBs_P-RF-AG      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQTLQDPRVRGLYLPAGGSS
EF464099_LHBs_P-RF-AG      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQDPRVRGLYFPAGGSS
KF219922_LHBs_P-RF-GH      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSS
JQ272886_LHBs_P-RF-GF      NRQSGRQPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSS
JQ272887_LHBs_P-RF-GF      NRRSGRKPTPISPPLRDSHPQAMQWNSTAFHQALQNPKVRGLYFPAGGSS
JQ801476_LHBs_P-RF-CG      NRQSGRQPTPISPPLRDSHPQAMQWNSSTFHQALLDPRVRGLYFPAGGSS
KM875422_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU919167_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
EU939606_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700532_LHBs_P-RF-CB      NRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
HQ700580_LHBs_P-RF-CB      NRQSGRQXTPISPPLRDSHPQAMQWNSTTFHQALLDPRVRGLYFPAGGSS
                                   ** : *:   .*   .                      *   

JN664935_LHBs_P-RF-DC      SGTVNPVLTTASPLSSIFSRTGDPALNMENITSGFLGPLLVLQAGFFLLT
DQ464167_LHBs_P-RF-DE      SRTVNPVPTTASPLSSIFSRIGDPALNMESITSGFLQPLLVLQAGFFLLT
KM386676_LHBs_P-RF-DE      SGTVNPVPTTASHLSSIFSRTGDLALNMENITSGLLGPLLVLQAGFFLLT
DQ464164_LHBs_P-RF-DE      SGTVNPVPTTASPSSSISSRIGDPALNMENITSGFLQPLLGLQAGFFLLT
KX357624_LHBs_P-RF-DE      SGTVSPVPTTASHISSIFSRIGDPALNMENITSGFLGPLLVLQAGFSLLT
HE981179_LHBs_P-RF-FG      SETQNPAPTIASLTSSIFSKTGGPAMNMDNITSGLLGPLLVLQAVCFLLT
KJ803822_LHBs_P-RF-CB      SETVNLVPNTASPISSIFWRIGGPAPNMENTTSGFLGPPIVLQAGFFLLT
KJ586810_LHBs_P-RF-AF      SETLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLT
KF053166_LHBs_P-RF-BC      SGTVNPVQNTASPISSILSTTGDPAPNMENISSGLLGPLLVLQAGFFSLT
KJ803827_LHBs_P-RF-BC      SGTVNPVQNTASPISSILSTTGDPAPNMENISSGLLGPLLVLQAGFFSLT
KX765835_LHBs_P-RF-GC      SGIVNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLT
AY161145_LHBs_P-RF-AD      SGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLT
AY161146_LHBs_P-RF-AD      SGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLT
KP274926_LHBs_P-RF-GA      SGTVNPVPTIASHISSIFSRIGDPAPNMENITSGFLGPLLVLQAGFFLLT
JF440019_LHBs_P-RF-AG      SGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLT
JF440022_LHBs_P-RF-AG      SGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLT
MF925386_LHBs_P-RF-AC      SGTVNPAPNIASHISSISTRTGDPVANMENITSGFLGPLLVLQAGFFLLT
AB453985_LHBs_P-RF-AC      SGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLT
AB222708_LHBs_P-RF-AD      SGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLT
AB933282_LHBs_P-RF-AG      SGTVNPAPNIASHISSISARTGDPVTNMENITSGFLGPLLVLQAGFFLLT
AB933283_LHBs_P-RF-AG      SGTVNPAPNIASHISSISARXGDPVTNMENITSGFLGPLLVLQAGFFLLT
AY161140_LHBs_P-RF-AD      SGTLNPVPIIAPLISSISSRIGDPAPNMENITSGFLGPLLVLQAGFFLLT
AY161141_LHBs_P-RF-AD      SGTLNPVPTIASHISSISSRIGDPAPNMENITSGFHGPLLVLQAGFFLLT
GQ331048_LHBs_P-RF-AE      SGTVNPVQNIASHISSISSRTGDPVPNMENITSGSLGPLLVLQAGFFLLT
KF214656_LHBs_P-RF-AC      SGTLNPVPNIASHISSISLRIGDPALNMENITSGFLGPLLVLQAGFFLLT
AB194949_LHBs_P-RF-AE      SGTVSPVPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLT
AY233277_LHBs_P-RF-AC      SGILNPVPNTASHISSISSRTGDPALNMENITSGFLGPLLVLQAGFFLLT
HF571060_LHBs_P-RF-AE      SGTVNPVPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLT
GQ161837_LHBs_P-RF-AE      SGTVTPVPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLT
GQ161838_LHBs_P-RF-AE      SGTVTPVPNIASHISSISSRTGDPAPTMENITSGFLGPLLVLQAGFFLLT
HM146131_LHBs_P-RF-AD      SGTLNPVPTIASHISSISSRIGDPAPNMENIASGYLGPLLVLQAGFFLLT
MF488705_LHBs_P-RF-AD      SGTLNPVPNIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLT
MF925404_LHBs_P-RF-AC      SGTLNPVPTIASHISSISSRTGDPAPNMENITSGFLGPLLVLQAGFFLLT
KP148441_LHBs_P-RF-GC      SGTVNPAPNIVSHISSIFARTGDPATNMENITSGFLGPLLVLQAGFFLLT
KP148450_LHBs_P-RF-GC      SGTVNPAPNIVSHITSIFARTGDPATNMENITSGFLGPLLVLQAGFFLLT
KP148442_LHBs_P-RF-BC      SGTVNPAPNIVSHISSIFARTGDPATNMENITSGFLGPLLVLQAGFFLLT
EU833891_LHBs_P-RF-GC      SGTVNPVPNIASHISSIFARTGDLAPNMENITSGFLGPLLVLQAGFFLLT
FJ882610_LHBs_P-RF-GC      SGTVNPVPNIASHISSIFARTGDLAPNMENITSGFLGPLLVLQAGFFLLT
FJ882614_LHBs_P-RF-GC      SGTVNPVPNIASHISSIFARTGDLAPNMENITSGFLGPLLVLQAGFFLLT
KY471004_LHBs_P-RF-GC      SGTVNPAPNIAPHISSIFTRIGDPATNMENIRSGFLGPLLVLQAGFFLLT
KY470999_LHBs_P-RF-GC      SGTVNPAPNIASHISSIFTRVGDPATNMENITSGFLGPLLVLQAGFFLLT
KY471000_LHBs_P-RF-GC      SGTVNPAPNIASHISSIFTRVGDPATNMENITSGFLGPLLVLQAGFFLLT
KY471002_LHBs_P-RF-GC      SGTVNPAPNIASHISSIFTRVGDPATNMENITSGFLGPLLVLQAGFFLLT
KY470997_LHBs_P-RF-GC      SGTVNPAPNIASHISSIFTRIGDPATNMENITSGFLGPLLVLQAGFFLLT
KY470998_LHBs_P-RF-GC      SGTVNPAPNIASHISSIFTRIGDPATNMENITSGFLGPLLVLQAGFFLLT
KY471001_LHBs_P-RF-GC      SGTVNPAPNIASHISSIFTRIGDPATNMENITSGFLGPLLVLQAGFFLLT
KY471003_LHBs_P-RF-GC      SGTVNPAPNIASHISSIFTRIGDPATNMENITSGFLGPLLVLQAGFFLLT
KY471006_LHBs_P-RF-GC      SGTVNPAPNIASHISSIFTRIGDPATNMENITSGFLGPLLVLQAGFFLLT
KY471007_LHBs_P-RF-GC      SGTVNPAPNIASHISSIFTRIGDPATNMENITSGFLGPLLVLQAGFFLLT
KY471005_LHBs_P-RF-GC      SGTVNPAPNIASHISSIFTRIGDPATNMENITSGFLGPLLVLQAGFFLLT
FR714490_LHBs_P-RF-GB      SGTVNPAPNIASHISSIFTRIGDPATNMENITSGFLGPLLVLQAGFFLLT
KP148586_LHBs_P-RF-GC      SGTVNPAPNIVSHISSIFARIGDPATNMENITSGFLGPLLVLQAGFFLLT
KC172106_LHBs_P-RF-GB      SGTVNPAPNIASHISSIFTRIGDPATNMENITSGFLGPLLVLQAGFFLLT
EU835240_LHBs_P-RF-GC      SGTVNPVPNIASHISSIFARTGDPAPNMENITSGFLGPLLVLQAGFFLLT
FJ882613_LHBs_P-RF-GC      SGTVNPVPNIASHISSIFARTGDLAPNMENITSGFLGPLLVLQAGFFLLT
FJ023666_LHBs_P-RF-GC      SGTVNPVPNIASHISSISARTGDLAPNMENITSGFLGPLLVLQAGFFLLT
FJ882612_LHBs_P-RF-GC      SGTVNPVPNIASHISSIFARTGDLAPNMENITSGFLGPLLVLQAGFFLLT
FJ882618_LHBs_P-RF-GC      SGTVNPVPNIASHISSIFARTGDLAPNMENITSGFLGPLLVLQAGFFLLT
FJ882617_LHBs_P-RF-GC      SGTVNPVPNIASHISSIFARTGDLAPNMENITSGFLGPLLVLQAGFFLLT
FJ023670_LHBs_P-RF-GC      SGTVNPVPNIASHISSIFARTGDLAPNMENITSGFLGPLLVLQAGFFLLT
FJ023664_LHBs_P-RF-GC      SGTVNPVPNIASHISSIFARTGDLAPNMENITSGFLGPLLVLQAGFFLLT
FJ023665_LHBs_P-RF-GC      SGTVNPVPNIASHISSIFARTGDLAPNMENITSGFLGPLLVLQAGFFLLT
FJ023667_LHBs_P-RF-GC      SGTVNPVPNIASHISSIFARTGDLAPNMENITSGFLGPLLVLQAGFFLLT
FJ023668_LHBs_P-RF-GC      SGTVNPVPNIASHISSIFARTGDLAPNMENITSGFLGPLLVLQAGFFLLT
FJ023673_LHBs_P-RF-GC      SGTVNPVPNIASHISSIFARTGDLAPNMENITSGFLGPLLVLQAGFFLLT
FJ386674_LHBs_P-RF-BC      SGTLSPAQNTVSTTSSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
KF053186_LHBs_P-RF-BC      SGTVSPAQNTVSTTSSHLSKTGDPVPNMENIASGLLEPLLVLQAGFFLLT
KJ803778_LHBs_P-RF-BC      SGTVSPAQNTVSTTSSHLSKTGDPVPNMENIASGLLEPLLVLQAGFFLLT
MG826145_LHBs_P-RF-BC      SGTVSPAQNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLPAGFFLLT
MH746811_LHBs_P-RF-BC      AGTVSPAQNTVSTISSILSKTGDPAPNMENIASGLLGPLLVLPAGFFLLT
MH746812_LHBs_P-RF-BC      SGTVSPAQNTVSTISSILSKTGDPAPNMENIASGLLGPLLVLPAGFFLLT
MH746813_LHBs_P-RF-BC      SGTVSPAQNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLPAGFFLLT
MG826150_LHBs_P-RF-BC      SGTVSPAQNTVSAISSISSTTGDPVPNMENIASGLLGPLLVLQAGFFLLT
MG826151_LHBs_P-RF-BC      SGTVSPAQNTVSAISSILSKTGDPVPKMENIASGLLGPLLVLQAGFFLLT
EU939631_LHBs_P-RF-BC      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFPGPLLVLQAGYFSLT
KC793112_LHBs_P-RF-BC      SGTVSPAQNTVSAISSISSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
HQ684849_LHBs_P-RF-BC      SGTVNPVPTTASPISSILSKTGDPVTNMENTASGLLGPLLVLQAGFFSLT
JQ412091_LHBs_P-RF-BC      SGTVNPVPTTASPISSIFSRTGDPAQNMENTTSGFLGPLLVLQAGFFLLT
EU939629_LHBs_P-RF-BC      SGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFSLT
EU882006_LHBs_P-RF-CB      SGTVSPVPTTASAISSILSKTGDPVPNMENTTSGFLGPLLVLQAGFFLLT
GQ377635_LHBs_P-RF-BC      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
KC774178_LHBs_P-RF-BC      SGTVNPVPTTASPISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
KC774364_LHBs_P-RF-BC      SGTVNPVPTTASPISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
GQ377630_LHBs_P-RF-BC      SGTVNPVPTTASPISSIFLRTGDPAPNMENTASGFLGPLLVLQAGFFLLT
KP148337_LHBs_P-RF-BC      SGTVNPVPTTVSPISSIFSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
KF053188_LHBs_P-RF-CB      SGTVNPVPNTASPISSILSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KJ803782_LHBs_P-RF-CB      SGTVNPVPNTASPISSILSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KC315400_LHBs_P-RF-CB      SGTVNPAPTTASPISSIFSRTGDPVPNMESTTSGFLGPLLVLQAGFFLLT
KF053179_LHBs_P-RF-BC      SGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLT
KJ803772_LHBs_P-RF-BC      SGTVNPVQNTASSISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFSLT
KJ717800_LHBs_P-RF-CB      SGTANPVPTSASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLT
KJ803791_LHBs_P-RF-CB      SGTANPVPTSASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLT
FJ562229_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
JQ801477_LHBs_P-RF-BC      SGTVSPAQNTVSAISSILSKTGDPVPNMENISSGLLGPLLVLQAGFFSLT
KJ717815_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KJ803803_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KJ717816_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KJ410497_LHBs_P-RF-BC      SGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
EU660227_LHBs_P-RF-BC      SGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
MK052976_LHBs_P-RF-BD      SGTVSPAQNTVSAISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
GQ377595_LHBs_P-RF-BC      SGTVSPAQNTVSAISSILSKTGDPAPNMENIASGLLGPLLVLQAGFFLLT
EU939627_LHBs_P-RF-BC      SGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLXGPLLVLQAGFFLLT
MK052970_LHBs_P-RF-BD      SGTVSPAQNTVSAISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
MK052967_LHBs_P-RF-BD      SGTVSPAQNTVSAISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
KC774414_LHBs_P-RF-BC      SGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
MK052968_LHBs_P-RF-BD      SGTVSPAQNTVSAISSTLSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
KJ717832_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU919166_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
KJ717814_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KJ803802_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KF053160_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KJ803753_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU939623_LHBs_P-RF-CB      SGTVSPAQNTVSAISSISSKTGDPALNMENTTSGFLGPLLVLQAGFFLLT
EU939620_LHBs_P-RF-CB      SGTVSPAQNTVSPISSILSKTGDPVPNMENIASGFLGPLLVLQAGFFLLT
MH094410_LHBs_P-RF-BC      SGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
GQ377604_LHBs_P-RF-CB      SGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLALQAGFFSLT
GQ377592_LHBs_P-RF-CB      SGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
EU939621_LHBs_P-RF-CB      SGTVSPAQNTVSAISSILSTTGDPVPNMENIASGLLGPLLVLQAGFFLLT
FJ562328_LHBs_P-RF-CB      SGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
FJ562247_LHBs_P-RF-CB      SGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFXLT
EU939630_LHBs_P-RF-CB      SGTVSPAQNTVSTISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
HQ684848_LHBs_P-RF-CB      SGTVSPAQNTVSAISSILSKTGDPVPNMENITSGFLGPLLVLQAGFFLLT
GQ377564_LHBs_P-RF-CB      SGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
GQ377590_LHBs_P-RF-CB      SGTVXPXXXTXSXISSIFSXTGDPXPNMENXXSGXLGPLLVLQAGFFLLT
GQ377614_LHBs_P-RF-CB      SGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
GQ377596_LHBs_P-RF-CB      SGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
GQ377573_LHBs_P-RF-CB      SGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
GQ377549_LHBs_P-RF-CB      SGTVSPAQNTVSAISSILSKTGDPVPNMENIASGXLGPLLVLQAGFFLLT
GQ377613_LHBs_P-RF-CB      SGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
GQ377626_LHBs_P-RF-CB      SGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
GQ377634_LHBs_P-RF-CB      SGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
JQ040174_LHBs_P-RF-CB      SGTVSPVQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAGFFLLT
EU881995_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
KJ803804_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
EU522070_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
GQ377602_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
MG826148_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
GQ377556_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
GQ377594_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
JF436919_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFSLT
EF494378_LHBs_P-RF-CA      SGTANPVPTTASPISSIFSRTGDLAPNMENTTSGFLGPLLVLQAGFFLLT
JF436923_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
HQ700519_LHBs_P-RF-CB      SGTANPVPTTASPISSIFSRTGDPALSMESTTSGFLGPLLXLQAVFFLLT
AP011108_LHBs_P-RF-CB      SGTINPVPTTASPVSSIFSKTGDPASNMENTTSGFLGPLLVLQAGFFLLT
AB241109_LHBs_P-RF-CB      SGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
HQ700520_LHBs_P-RF-CB      SGTVNPVPTTAFPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLT
HQ700531_LHBs_P-RF-CB      SGTLNPVPTTASPISSILSRTGDPALNMESTTSGFLGPLLVLQAVFFLLT
HQ700527_LHBs_P-RF-CB      SGTVNPVPTTASPISSISSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLT
HQ700528_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLT
HQ700523_LHBs_P-RF-CB      SGTLNLVPTTAYPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLT
HQ700530_LHBs_P-RF-CB      SGTLNLVPTTASPISSIXXTTGDPAPNMESTTSGFLGPLLVLQAVFFLLT
KU695745_LHBs_P-RF-CB      SGAVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLT
HQ700498_LHBs_P-RF-CB      SGAVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLT
HQ700499_LHBs_P-RF-CB      SGAVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLT
X75656_LHBs_P-RF-CB        SGTVNPVPTTASLISSIFSRTGDPVTNMENTTSGFLGPLLVLQAGFFLLT
HQ700557_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPALNMENTTSGFLGPLLVLQAVFFLLT
HQ700554_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLXLQAVFFLLT
HQ700462_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLT
HQ700485_LHBs_P-RF-CB      SGTVNPVPTSASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLT
HQ700560_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLT
HQ700542_LHBs_P-RF-CB      SGAVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
KU695746_LHBs_P-RF-CB      SGTVNPVPTTASPISSSFVRIGDPAPNMENTTSGFLGPLLVLQAVFFLLT
KU695744_LHBs_P-RF-CB      SGTVNPVPTTASPISSNFARTGDPAPNMESTTSGFLGPLLVLQAVFFLLT
KU695743_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLT
KU695741_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLT
HQ700515_LHBs_P-RF-CB      SGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
HQ700509_LHBs_P-RF-CB      SGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
HQ700507_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
HQ700508_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
AB105172_LHBs_P-RF-CB      SGTVNPVPTIASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLT
HQ700518_LHBs_P-RF-CB      SGTVNPVPTIASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLT
AP011102_LHBs_P-RF-CB      SGTVNPVPTIASPISSIFLRTGDPAPNMESTTSGFLGPLLVLQAVFFLLT
AB493842_LHBs_P-RF-CB      SGTVNPVPTIASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLT
AP011103_LHBs_P-RF-CB      SGTVNPVPTIASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLT
AB493840_LHBs_P-RF-CB      SGTVNPVPTIASPISSIFSRIGDPAQNMESTTSGFLGPLLVLQAVFFLLT
AB493838_LHBs_P-RF-CB      SGTVNPVPTIASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLT
AB493837_LHBs_P-RF-CB      SGTVHPVPTIASPISSIFLRTGDPAPNMESTTSGFLGPLLVLQAVFFLLT
AB493847_LHBs_P-RF-CB      SGTVNPVPTIASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLT
GQ358155_LHBs_P-RF-CB      SGTVNPVPTIASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLT
GQ358156_LHBs_P-RF-CB      SGTVNPVPTIASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAVFFLLT
AB195940_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSKTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
AB195941_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSKTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
FR714496_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
FJ562317_LHBs_P-RF-CB      SGTINPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLALQAGFFLLT
MF925382_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
JQ027310_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLALQAGFFLLT
KJ803785_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
MF925370_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KJ803798_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
GQ924618_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
AB031265_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KJ410506_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
AP011104_LHBs_P-RF-CB      SGTVNPVLTSASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
AP011105_LHBs_P-RF-CB      SGTVNPVLTSASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
LC416040_LHBs_P-RF-CB      SGTVNPVPTSASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KP148352_LHBs_P-RF-CB      SGTVNPVPTSASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KT003704_LHBs_P-RF-CB      SGTVNPVPTSASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KX096713_LHBs_P-RF-CA      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
JX504540_LHBs_P-RF-CB      SGTANPVPTTASPISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFSLT
JQ040146_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGLFLLT
HQ700521_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPALNMESTTSGFLGPLLVLQAVFFLLT
HQ700505_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAVFFLLT
EU939547_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
MG826141_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVYRAGFFLLT
MG826147_LHBs_P-RF-CB      SGTVNPFPTIASPISSIFSRAGDPAPNMENTTSGFLGPLLVLQAGFFLLT
KC774324_LHBs_P-RF-CB      SGTVNPVPTSASPISSIFSRTGDPASNMENTTSGFLGPLLVLQAGFFLLT
AY206374_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
GU357843_LHBs_P-RF-CB      SGTVNPVPTTASPISSILSKTGDPAPNMENITSGLLGPLLVLQAGFFLLT
AB195939_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSKTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
AB195955_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSKTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
AB195956_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSKTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
AB195957_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSKTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KJ598675_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
MG826146_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
GU385774_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPSMENTTSGFLGPLLVLQAGFFLLT
AB195950_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
AB195951_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
AB367800_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLGLQAGFFLLT
FJ562227_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
AB367419_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
JX661485_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
KJ173320_LHBs_P-RF-CB      SGTVNPVPTTASHISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLT
KJ173322_LHBs_P-RF-CB      SGTVNPVPTTASHISSIFSRIGDPAPNMENTTSGFLGPLLVLQAGFFLLT
AB367400_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
AB367393_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
FJ386649_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
AB049609_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
KR013843_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
AB300369_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
FJ787446_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
FJ787480_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
AF411409_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
JF828936_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
JF828933_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
JF828934_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
JF828938_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
JF828935_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
MG826142_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLRPLLVLQAGFFLLT
JX036329_LHBs_P-RF-CD      SGTVNPVPTTALPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
MG826144_LHBs_P-RF-CB      SGTVNPVPTTASPTSSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
EU871990_LHBs_P-RF-CB      SATVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU871988_LHBs_P-RF-CB      SATVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU871999_LHBs_P-RF-CB      SATVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU871981_LHBs_P-RF-CB      SATVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU871983_LHBs_P-RF-CB      SATVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU871986_LHBs_P-RF-CB      SATVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU871991_LHBs_P-RF-CB      SATVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU871984_LHBs_P-RF-CB      SATVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU871985_LHBs_P-RF-CB      SATVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU871987_LHBs_P-RF-CB      SATVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU871989_LHBs_P-RF-CB      SATVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU871992_LHBs_P-RF-CB      SATVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU871993_LHBs_P-RF-CB      SATVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU871994_LHBs_P-RF-CB      SATVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU871995_LHBs_P-RF-CB      SATVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
EU871996_LHBs_P-RF-CB      SATVNPVPTTASPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
M38454_LHBs_P-RF-CB        SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
KC774188_LHBs_P-RF-CB      SGTVNPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
HQ700526_LHBs_P-RF-CB      SGTVTPVPTSASTISSILSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
GQ377522_LHBs_P-RF-CB      SGTANPVPTTASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
FJ562294_LHBs_P-RF-CB      SGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
DQ089798_LHBs_P-RF-CB      SGTVNPVPTIASPISSIFSRTGDPAPNMENTTSGFLGPLLVLQAGFFLLT
KC774193_LHBs_P-RF-CB      SGTVNPVPTTASPTSSIFSRIGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KC774291_LHBs_P-RF-CB      SGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KC774307_LHBs_P-RF-CB      SGTVNPVPTTASPTSSIFSRTGDPAPNMESTTSGFLGPLLVLQAGFFLLT
KC774323_LHBs_P-RF-CB      SGTVNPVPTTASPTSSIFSRTGDPAPN