HBVdb

Dataset for protein Pol of genotype RF

[Download (right click)] [Edit] [Sequences] [Repertoires]

873 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


JN664934_Pol_P-RF-DE      MPLSYQHFRRLVLLD--E--E--AGPLE-ELPRLADEGLNRRVAEDLNLG
HE981179_Pol_P-RF-FG      MPLSYPHFRKLLLLD--D----EAGPLEEELPRLADEGLNRRVAEDLNLQ
KJ586810_Pol_P-RF-AF      MPLSYQHFRKLLLLD--D--ETEAGPLEEELPRLADEDLNRRVAEDLNLQ
EF494378_Pol_P-RF-CA      MPLSYQYFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLSLG
KP274926_Pol_P-RF-GA      MPLSYQHFRRLLLLDE----E--AGPLEEELPRLADEDLNRRVAEDLHLQ
GQ331048_Pol_P-RF-AE      MPLSYQHFRKLLLLDEGT--E--VGPLEEELPRLADEDLNRRVAEDLNLG
JQ707426_Pol_P-RF-GA      MPLSYQHFRRLLLLDE----E--AGPLEEELPRLADEDLNRRVAEDLHLQ
AB194949_Pol_P-RF-AE      MPLSYQHFRKLLLLDDGT--E--AGPLEEELPRLADADLNRRVAEDLNLG
HF571060_Pol_P-RF-AE      MPLSYQHFRRILLLDE----E--AGPLEEELPRLADEDLNRRVAEDLNLG
AB222708_Pol_P-RF-AD      MPLSYQHFRKLLLLDDGT--E--AGPLEEELPRLADADLNRRVAEDLNLG
AB453985_Pol_P-RF-AC      MPLSYQHFRKLLLLDDGT--E--AGPLEEELPRLADADLNRRVAEDLNLG
JF440022_Pol_P-RF-AG      MPLSYQHFRKLLLLDDGT--E--AGPLEEELPRLADADLNRRVAEDLNLG
JF440019_Pol_P-RF-AG      MPLSYQHFRRLLLLDE----E--AGPLEEELPRLADADLNRRVAEDLNLG
AB933282_Pol_P-RF-AG      MPLSYQHFRKLLLLDDGT--E--AGPLEEELPRLADADLNRRVAEDLNLG
AB933283_Pol_P-RF-AG      MPLSYQHFRKLLLLDDXT--X--AGPLEEELPRLADADLNRRVAZDLNLG
MF925386_Pol_P-RF-AC      MPLSYQHFRKLLLLDDGT--E--SGPLEEELPRLADADLNRRVAEDLNLG
AY161140_Pol_P-RF-AD      MPLSYQHFRRLLLLDVET--E--AGSLEEELPRLADEDLNRRFAEDLNLG
AY161141_Pol_P-RF-AD      MPLSYQHFRRLLLLDVET--E--AGSLEEELPRLADEDLNRRFAEDLNLG
KF214656_Pol_P-RF-AC      MPLSYQHFRKLLLLDD----E--AGPLEEELPRLADEDLNRRVAEDLNLG
AY161145_Pol_P-RF-AD      MPLSYQHFRRLLLLDD----E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY161146_Pol_P-RF-AD      MPLSYQHFRRLLLLDD----E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF488705_Pol_P-RF-AD      MPLSYQHFRKLLLLDDET--E--VGPLEEELPRLADEDLNRRVAEDLNLG
AY233277_Pol_P-RF-AC      MPLSYQHFRKLLLLDDET--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MF925404_Pol_P-RF-AC      MPLSYQHFRKLLLLDDET--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KF053179_Pol_P-RF-BC      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803772_Pol_P-RF-BC      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ717794_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRFAEDVNLG
KJ803788_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRFAEDVNLG
KX765835_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB241109_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386674_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774461_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679958_Pol_P-RF-CB      MPLSYQHFRKLLLLD--N--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KF873522_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KU679941_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KF873523_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KF873524_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KF873521_Pol_P-RF-BC      MPLSYPHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679955_Pol_P-RF-CB      MPLSYPHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873511_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679944_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679953_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873519_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679950_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873517_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873518_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679946_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLXEELPRLABEGLNRRVAEDLNLG
KU679948_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873513_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873515_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679954_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEXELPRLADEGLNRRVAXDLNLG
KU679942_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679943_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLABEGLNRRVAEDLNLG
KF873527_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679956_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873530_Pol_P-RF-CB      MPLSYQHFRKLLLLD--N--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KF873531_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEXLNRRVAEDLNLG
KF873532_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873533_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873534_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679940_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873535_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679939_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679945_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873540_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873537_Pol_P-RF-CB      MPLSYQHFRKLLLLD--X--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873538_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873542_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873543_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774475_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY057948_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
DQ478890_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KX660684_Pol_P-RF-DC      MPLSYQHFRKLLLVD--D--E--AGPLEDELPRLADEGLNRRVAKDLNLG
KT991424_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--N--AGPLEDELPRLADEGLNRRVAEDLNLG
FJ562263_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--N--AGPLEDELPRLADEGLNRRVAEDLNLG
KT991427_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--N--AGPLEDELPRLADEGLNRRVAEDLNLG
KX660689_Pol_P-RF-DC      MPLSYQDFRKLLLLD--D--E--AGPLEDELPRLADEDLNRRVAEDLNLG
KP276253_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
AY817511_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KP276256_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KC774485_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750146_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KX660686_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KX354997_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750144_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGPNRRVAEDLNLG
HM750150_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750145_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750149_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KC774482_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEDLNRRVAEDLNLG
KC774456_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750148_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750143_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750147_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
FJ349241_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750142_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KY470854_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470843_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470846_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470847_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470849_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470850_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470855_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470853_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGHLEEELPRLADEGLNRRVAEDLNLG
KC774433_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774486_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY629632_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
AY817512_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774478_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774480_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774425_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB270535_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774431_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774428_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY817510_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY817513_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP276254_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP276255_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774476_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774481_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF491455_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ478886_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774452_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774449_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774439_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774435_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774455_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774442_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774443_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774470_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF491449_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774484_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774420_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774426_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX660677_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774498_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774490_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774483_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774422_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY862865_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774458_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774454_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774448_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY800249_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX660674_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX660680_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEEXPRXADEGLNRRVAEDLNLG
KC774474_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774453_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU787434_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774492_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ478898_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU787435_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774495_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774447_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY817515_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774457_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774466_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774499_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU519422_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF491451_Pol_P-RF-DC      MPLSYPHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT991420_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774463_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT991421_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT991419_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562278_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT991417_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT991423_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ478897_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774423_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774471_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774488_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774493_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX660675_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU519423_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774487_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF491448_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY817509_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLDEELSRLADEGLNRRVAEDLNLG
KC774424_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774489_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774479_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774468_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774432_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF491456_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF917451_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774472_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774434_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ478887_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ478892_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774494_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774430_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ478889_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRHVAEDLNLG
KC774497_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX429898_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803822_Pol_P-RF-CB      MPLSYQCFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU660227_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
KJ717832_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KJ803804_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ717816_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ717815_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803803_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ717800_Pol_P-RF-CB      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRLAEDLNLG
KJ803791_Pol_P-RF-CB      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRLAEDLNLG
KF053188_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--D--AGPLEEELPRLADEGLNRRVADDLNLG
KJ803782_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--D--AGPLEEELPRLADEGLNRRVADDLNLG
KJ717814_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRFAEDLNLG
KJ803802_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRFAEDLNLG
GQ377556_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--G--AGPLEEELPRLADEGLNRRVAEDLNLG
KF053160_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803753_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC315400_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377595_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ801477_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK052968_Pol_P-RF-BD      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRPADEGLNRRVAEDLNLG
MK052976_Pol_P-RF-BD      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK052967_Pol_P-RF-BD      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK052970_Pol_P-RF-BD      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADKGLNRRVTKDLNLG
EU939627_Pol_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ410497_Pol_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774414_Pol_P-RF-BC      MPLSYQHFRKLLLLD--E--K--AGPLEEELPRLADEGLNRRVAEDLNLG
MH094410_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939623_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377592_Pol_P-RF-CB      MPLSYQHFRKLLLLE--E--G--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939620_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562328_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ684848_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939630_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377539_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939621_Pol_P-RF-CB      MPLSYQRFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377604_Pol_P-RF-CB      MPLSYQHFRKLLLLD--K--D--AGTLEEELPRLADEGLNRRVAEDLNLG
GQ377602_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADDGLNRRVAEDLNLG
GQ377634_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377594_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562247_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377573_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377613_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377626_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ377549_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ040174_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377565_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377590_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377596_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377564_Pol_P-RF-CB      MPLSYQHFRKLQLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377614_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT003704_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP148352_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
AP011104_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AP011105_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC416040_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826148_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
EU522070_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU919166_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB105172_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
AP011102_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
AB493842_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
AP011103_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
AB493838_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDDLNRRVAEDLNLG
AB493847_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDDLNRRVAEDLNLG
AB493837_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
AB493840_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
GQ358155_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
GQ358156_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
HQ700542_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
HQ700509_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700515_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700508_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KU695744_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KU695746_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KU695741_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KU695743_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700505_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KU695742_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELHRLADEGLNRRVAEDLNLG
X75656_Pol_P-RF-CB        MPLSYQHFRKLLLLD--V--E--AGPLEEELPRLADEGLNHRVAEDLNLG
HQ700462_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
HQ700560_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
HQ700498_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
HQ700499_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
HQ700485_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
KU695745_Pol_P-RF-CB      MPLSYQHFRKLLLLD--N--E--AGTLEEELPRLADEGLNHRVAEDLNLG
HQ700554_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNHRVAEDLNLG
HQ700557_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNHRVAEDLNLG
HQ700530_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700523_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700531_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700518_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700527_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700528_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700519_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700521_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774246_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700520_Pol_P-RF-CB      MPLSYQHFRRLLLLD--N--E--AGPLEEELPRLADEGLNRRVAADLNLG
GQ377635_Pol_P-RF-BC      MPLSYQRFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939631_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939629_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774178_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774364_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377630_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP148337_Pol_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173350_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173349_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173358_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU882006_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ598675_Pol_P-RF-CB      MPLSYQHFRKLLLLD--N--D--AGPLEEELPRLADEGLNRRVAEDLNLG
EU881995_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
JX504540_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EF494376_Pol_P-RF-CA      MPLSYQHFWKLLLLDDGT--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AP011108_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
MG826146_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNHRVAEDLNLG
FJ562302_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX096713_Pol_P-RF-CA      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562317_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF436919_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
HQ684849_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB300369_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--VGPLEEELPRLADEGLNRRVAEELNLG
KC774198_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774201_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AY206374_Pol_P-RF-CB      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774323_Pol_P-RF-CB      MPLSYHHFGKLLWTH--D--E--AGPIGALLPRLADEKTNCRVPEDLNLG
KC774307_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774193_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ377560_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774291_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KR013843_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ032337_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826144_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ386646_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB033557_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700547_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173320_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KJ173322_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KJ173279_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ040146_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB367419_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939547_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195955_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195956_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195957_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195939_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195940_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195941_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774188_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562267_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562294_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386586_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774212_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ732168_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNLRVAEDLNLG
HQ700526_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GU385774_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GU357843_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386635_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
JX661485_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX661486_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ040142_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
MG893555_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ040148_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG893554_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774344_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU787444_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLLHEGLLRRDEKDLNLG
AY247030_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB367800_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB049609_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX661487_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU916232_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377534_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939668_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY040627_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ089798_Pol_P-RF-CB      MPLSYQHFRKLLLLD--N--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774222_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173329_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
KC774324_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562305_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964306_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964308_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964005_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964006_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964007_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964009_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964010_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964303_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964304_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964305_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964307_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964309_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964310_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964311_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964312_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964313_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964314_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964315_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964316_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964317_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964008_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826149_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774349_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774234_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB670303_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195950_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195951_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386578_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386585_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386649_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173299_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173300_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY363263_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562227_Pol_P-RF-CB      MPLSYQHFRKLLLLD--V--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939589_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB367400_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB642096_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
M38454_Pol_P-RF-CB        MPLSYQHFRKLLLLDXXX--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KR013806_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774258_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377548_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939551_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF828933_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF828934_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF828935_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF828938_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF828936_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY123041_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB367393_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLKLG
AB205152_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AF330110_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HM750133_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK321265_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774305_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562226_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AF411409_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU916239_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU916241_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU916240_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN400086_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386581_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM213033_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774263_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774332_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774341_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG893559_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562314_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963868_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963856_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963857_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963858_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963860_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963861_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963863_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963864_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963865_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963866_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963867_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963869_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963870_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963859_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871981_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871983_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871984_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871985_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871986_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871989_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871991_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871993_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871996_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871999_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871992_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871987_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871988_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871994_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871990_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963883_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX661498_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX661494_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF436922_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377611_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEELNLG
GQ377520_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386633_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AF233236_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562287_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB198084_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY881840_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377516_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774317_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774322_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY167095_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377633_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964351_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX429896_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY123424_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871997_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ787446_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ787480_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC458432_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KR013816_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963991_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963990_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963993_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963994_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963995_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963998_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963999_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964001_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964003_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774230_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774183_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX026887_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG893561_Pol_P-RF-CB      MPLSYQHFGKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470893_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774328_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774294_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173325_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774186_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ040175_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173326_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377607_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377581_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377544_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC279265_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC279266_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC279267_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC279263_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC279264_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ361772_Pol_P-RF-GC      MPLSYPHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826150_Pol_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826151_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPPLAEEGFNRRVAEDLNLG
EU835240_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023666_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023665_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023670_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023668_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023664_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023673_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU833891_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882610_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882614_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023667_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882611_Pol_P-RF-GC      MPLSYQHFRKLLLLD--A--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882617_Pol_P-RF-GC      MPLSYQHFRKLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882612_Pol_P-RF-GC      MPLSYQHFRKLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882613_Pol_P-RF-GC      MPLSYQHFRKLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882618_Pol_P-RF-GC      MPLSYQHFRKLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MH746811_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MH746812_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MG826145_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEKELPRLADEDLNRRVAEDLNLG
MH746813_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEKELPRLADEDLNRRVAEDLNLG
KP148447_Pol_P-RF-GC      MPLSYQQFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP148586_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP148441_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP148449_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KP148442_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP148450_Pol_P-RF-GC      MPLSYQQFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MH368022_Pol_P-RF-GC      MPLSYQHFRKLLLLD--V--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY470996_Pol_P-RF-GC      MPLSYQQFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471007_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY470999_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471000_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471002_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY470998_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471001_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471003_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471006_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY470997_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471005_Pol_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FR714490_Pol_P-RF-GB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC172106_Pol_P-RF-GB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KF053166_Pol_P-RF-BC      MPLSYPHFLRLLLLE--H--G--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803827_Pol_P-RF-BC      MPLSYPHFLRLLLLE--H--G--AGPLEEELPRLADEGLNRRVAEDLNLG
FR714496_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MF925382_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826147_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826141_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826142_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803785_Pol_P-RF-CB      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRFAEDLNLG
KF053186_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803778_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB674504_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF436923_Pol_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVVEDLNLG
KJ803798_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925389_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925370_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ924618_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ027310_Pol_P-RF-CB      MPLSYQHFRKLLLLD--X--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925381_Pol_P-RF-CB      MPLSYQHFRKLLLLD--N--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB031265_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ410506_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GU177079_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--GTEAGPLEEELPRLADADLNRRVAEDLNLG
KF779353_Pol_P-RF-DA      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
JF440017_Pol_P-RF-DA      MPLSYQHFLKLLLLD--D--GTEAGPLEEELPRLADEDLNRRVAEDLNLG
KC774450_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MH464835_Pol_P-RF-DE      MPLSYQHFRRLVLLD--D--EXXAGPLEEELPRLADEGLNRRVAEDLNLG
MH464851_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--EXXAGPLEEELPRLADEGLNRRVAEDLNLG
MH464846_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--EXXAGPLEEELPRLADEGLNRRVAEDLNLG
MH464852_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--EXXAGPLEEELPRLADEGLNRRVAEDLNLG
MH464850_Pol_P-RF-DA      MPLSYQHFRKLLLLD--D--EXXAGPLEEELPRLADEDLNRRVAEDLNLG
JN664935_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
KF679991_Pol_P-RF-DE      MPLSYQHFRSVLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM386676_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ464164_Pol_P-RF-DE      MPLSYPHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVEEDLNLG
DQ464167_Pol_P-RF-DE      MPLSYPHFRRLLLLD--D--E--AGPLEEELPRLPDEDLNRRVPEDLNLG
DQ464165_Pol_P-RF-DE      MPLSYPHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
DQ464166_Pol_P-RF-DE      MPLSYPHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC793112_Pol_P-RF-BC      -----------------D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ586803_Pol_P-RF-AF      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLQ
FN594767_Pol_P-RF-DE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLQ
GQ161806_Pol_P-RF-EA      MPLSYQHFRXLLLLD--X--E--AGPLEEELPRLADEDLNRRVAEDLNLQ
AF297619_Pol_P-RF-DA      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
AF297620_Pol_P-RF-DA      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
MF925402_Pol_P-RF-BD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ586811_Pol_P-RF-DF      MPLSYQHFRRLLLLD--D--E--AGPLEELPPRLADEGLNRRVAEDLNLQ
MK052957_Pol_P-RF-DE      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN040803_Pol_P-RF-DE      MPLSYQHFRRLLLLD--N--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EF103283_Pol_P-RF-AD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357641_Pol_P-RF-DE      MPLSYQHFRRLLFLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MH685719_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736914_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736915_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736917_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736916_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP168420_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP168421_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FN594769_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FN594770_Pol_P-RF-DE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FN594771_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ161754_Pol_P-RF-DE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904436_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AM494716_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904442_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLKEELPRLADKGLNLRVAEDLNLG
FJ904444_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904405_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGVNRRVAEELNLG
FJ904396_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP288875_Pol_P-RF-DE      MPLSYQYFRRLLLLD--E--E--AGPLEEELPHLADEGLNRRVAEDLNLG
FJ349207_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEDELPRLADEGLNRRVAEDLNLG
FJ904414_Pol_P-RF-DE      MPLSYQHFRRLLFLD--E--D--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904401_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904416_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGXNRRVAEDLNLG
FJ904417_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGXNRRVAEDLNLG
KX357632_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904409_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904406_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904404_Pol_P-RF-DE      MPLSYQHFRRLVLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM606741_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904394_Pol_P-RF-DE      MPLSYQHFRXLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904400_Pol_P-RF-DE      MPLSYQSFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLHLG
FJ904441_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357627_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904447_Pol_P-RF-DE      MPLSYQHFRRLVLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904425_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736921_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736922_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--X--AGPLEEELPRLADEGLNRRVAXDLNLG
KX357636_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904407_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904398_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGXNRRVAEDLNLG
KP168417_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP168418_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904437_Pol_P-RF-DE      MPLSYQQFRRLVLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357629_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357625_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357630_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--D--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357626_Pol_P-RF-DE      MPLSYQHFRRLLLLE--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357628_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLHLG
KX357634_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357623_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357633_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357635_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904440_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX827299_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904408_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KP995112_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM606750_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM606751_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLANEGLNRHVAENLNLG
KP168416_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904403_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF170740_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925360_Pol_P-RF-DB      MPLSYQHFRRLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562223_Pol_P-RF-CD      MPLSYHHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377627_Pol_P-RF-CD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ647351_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADQGLNRRVAEDLNLG
KJ647356_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AY233295_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY233293_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GU563560_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF440002_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF440003_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF440011_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF439999_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF440013_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF440010_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF440009_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF440006_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF440001_Pol_P-RF-DE      MPLSYQHFRKLALLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF440012_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF440000_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF439994_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF439995_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF439998_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF440004_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF440005_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF440007_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF440014_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF440015_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF439996_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU185780_Pol_P-RF-AD      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC012653_Pol_P-RF-AD      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AJ627221_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX898693_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX898698_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX898699_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX898690_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB210819_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AJ344117_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX898695_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX898696_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX898686_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX898687_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX898688_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ349212_Pol_P-RF-DE      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF967563_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
U95551_Pol_P-RF-DE        MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
X65259_Pol_P-RF-DA        MPLSYQHFRRLLLLH--D--E--AGPLEEELPRLPDQGLNRRVAEDLNLG
MK052969_Pol_P-RF-DE      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU668440_Pol_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGHLEEELPRLADEGLNRRVAEDLNLG
KM577666_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257154_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AY236161_Pol_P-RF-DA      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF618346_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192833_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF618347_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192840_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192836_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192837_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192838_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192839_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192841_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192835_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470897_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470891_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470898_Pol_P-RF-DE      MPLSYQHFRRLVLLD--N--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KJ470887_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470888_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470890_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470884_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470886_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700492_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEELNLG
MH481861_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MH481858_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MH481859_Pol_P-RF-DE      TPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AB048702_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AB048703_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ692536_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLR
AB033559_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700536_Pol_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLAXEDLNRRVAEDLNLG
HQ700494_Pol_P-RF-DE      MPLSYQHFRRLVLLD--N--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700579_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700585_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700524_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700525_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700584_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700541_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700503_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700540_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700535_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700534_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--SGPLEEELPRLADEDLNRRVAEDLNLG
HQ700533_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700493_Pol_P-RF-DE      MPLSYQHFRRLVLLD--N--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700581_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700582_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700583_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700537_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700497_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700500_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700501_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700538_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
EF103284_Pol_P-RF-AD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB188243_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KJ647349_Pol_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB270538_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN688689_Pol_P-RF-DE      MPLSYQHFRRLLLLD--N--K--AGPLEEELPRLADQGLNRRVAEDLNLG
FJ349221_Pol_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB188245_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM359442_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN688715_Pol_P-RF-DE      MPLSYQSFRRLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
MF488702_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLKEELPHLADEGLNRRVAEDLNLG
KX827302_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--D--AGPLEEELPRLADEGLNRRVAEDLNLG
EF103285_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
EU594436_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AJ627217_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ183486_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY373430_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
DQ111987_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU594435_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT366504_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM577665_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT366492_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
KM524359_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
KM577663_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM577664_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB583679_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM577667_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--D--AGPLEEELPRLADEGLNRRVAEDLNLG
EF103282_Pol_P-RF-AD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803771_Pol_P-RF-DB      MPLSYQRFRRLLLLD--A--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN688717_Pol_P-RF-DE      MPLSYQLFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MF925396_Pol_P-RF-DC      MPLSYQYFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN664929_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
AB033558_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ205379_Pol_P-RF-DE      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN664925_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC875338_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN664915_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC875339_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ205377_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ205386_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ205378_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ205387_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN664933_Pol_P-RF-DA      MPLSYQHFRKLLLLDVEG--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT366505_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ315779_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN664940_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY341335_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MF925401_Pol_P-RF-DB      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925371_Pol_P-RF-DC      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925388_Pol_P-RF-DC      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU594406_Pol_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MF925392_Pol_P-RF-DB      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN642160_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
JN664946_Pol_P-RF-DA      MPLSYQHFRKLLLLDVEG--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257204_Pol_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM524357_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ687532_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KR905422_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT366503_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF754613_Pol_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904430_Pol_P-RF-DE      MPLSYQHFRRLVLLD--E--E--AGPLEDELPRLADEGLNRRVAEDLNLG
JN664943_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925384_Pol_P-RF-DB      MPLSYQHFRRLLLLD--N--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925397_Pol_P-RF-DC      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB330368_Pol_P-RF-DA      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
KU711666_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF754616_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB674432_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736923_Pol_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN642137_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
JN040798_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB674436_Pol_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AB674433_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257189_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN642141_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN642127_Pol_P-RF-DE      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN642152_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN642139_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--SGPLEEELPRLADEGLNRRVAEDLNLG
JN257210_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--D--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257216_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257164_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257191_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257174_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257206_Pol_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ161753_Pol_P-RF-AE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ161767_Pol_P-RF-AE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
JQ801476_Pol_P-RF-CG      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
JQ272886_Pol_P-RF-GF      MPLSYPHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLQ
JQ272887_Pol_P-RF-GF      MPLSYPHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLQ
EF464099_Pol_P-RF-AG      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
EU833890_Pol_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
AB933279_Pol_P-RF-AG      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
AB933280_Pol_P-RF-AG      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
AB933281_Pol_P-RF-AG      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
HE981180_Pol_P-RF-GF      MPLSYPHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
KF219922_Pol_P-RF-GH      MPLSYQHFRRLLLLD--X--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
KU679952_Pol_P-RF-CB      MPLSYQHFRKLLLLD--N--E--AGPLXEELPRLABEGLNRRVAXDLNLG
FJ023659_Pol_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023662_Pol_P-RF-GC      MPLSYQQFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ475335_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ410520_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY862864_Pol_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700580_Pol_P-RF-CB      MPLSYQRFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAXDLSLG
HQ700532_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU919167_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939606_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KM875422_Pol_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
                                                  * :              .   :: * 

JN664934_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFPNIHLHQDIINKCEQ
HE981179_Pol_P-RF-FG      LPNVSIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQ
KJ586810_Pol_P-RF-AF      LPNVSIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQ
EF494378_Pol_P-RF-CA      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPDIHLKEDIFDRCQQ
KP274926_Pol_P-RF-GA      LPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQ
GQ331048_Pol_P-RF-AE      NPNVSIPWTHKVGNFTGLYSTTVPTFNPDWQTPSFPKIHLHEDIINRCQH
JQ707426_Pol_P-RF-GA      LPDVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQ
AB194949_Pol_P-RF-AE      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLHEDIINRCQQ
HF571060_Pol_P-RF-AE      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLHEDIVNRCQQ
AB222708_Pol_P-RF-AD      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQ
AB453985_Pol_P-RF-AC      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQ
JF440022_Pol_P-RF-AG      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQ
JF440019_Pol_P-RF-AG      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIDRCQQ
AB933282_Pol_P-RF-AG      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQ
AB933283_Pol_P-RF-AG      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQ
MF925386_Pol_P-RF-AC      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIIKRCQQ
AY161140_Pol_P-RF-AD      NLNVSIPWTHKVGNFTGLYSSTVPILNPEWQTPSFPKIHLHEDIANRCQQ
AY161141_Pol_P-RF-AD      NLNVSIPWTHKVGNFTGLYSSTVPILNPEWQTPSFPKIHLHEDIANRCQQ
KF214656_Pol_P-RF-AC      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLHEDIANRCQQ
AY161145_Pol_P-RF-AD      NLNVSIPWTHKVGNFTGPYSSSVPIFNPEWQTPSFPKIHLHEDIINRCQQ
AY161146_Pol_P-RF-AD      NLNVSIPWTHKVGNFTGPYSSSVPIFNPEWQTPSFPKIHLHEDIINRCQQ
MF488705_Pol_P-RF-AD      NPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLHEDIINRCQQ
AY233277_Pol_P-RF-AC      NLNVSIPWTHKVGTFTGLYSSTVPIFNPEWQTPSFPKIHLHEDIINRCQQ
MF925404_Pol_P-RF-AC      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLHEDIANRCQQ
KF053179_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVSRCER
KJ803772_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVSRCER
KJ717794_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPPFPDIHLKEDIINRCQR
KJ803788_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPPFPDIHLKEDIINRCQR
KX765835_Pol_P-RF-GC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLHQDIITKCEQ
AB241109_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSNVPVFNPEWQTPSFPDIHLQEDIINRCQQ
FJ386674_Pol_P-RF-BC      NPNVSIPWTHKVGNFTGLYSSTVPCFNPEWQTPSFPDIHLKEDIVDRCKQ
KC774461_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KU679958_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIIBRCQQ
KF873522_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KU679941_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KF873523_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KF873524_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KF873521_Pol_P-RF-BC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KU679955_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KF873511_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KU679944_Pol_P-RF-BC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KU679953_Pol_P-RF-BC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KF873519_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KU679950_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KF873517_Pol_P-RF-BC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KF873518_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KU679946_Pol_P-RF-BC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KU679948_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KF873513_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KF873515_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KU679954_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KU679942_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KU679943_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KF873527_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KU679956_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KF873530_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPQFPDIHLKEDIISRCQQ
KF873531_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLHEDIINRCQQ
KF873532_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLHEDIINRCQQ
KF873533_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLHEDIINRCQQ
KF873534_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLHEDIINRCQQ
KU679940_Pol_P-RF-CB      BPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLHEDIIHRCQQ
KF873535_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLHEDIIHRCQQ
KU679939_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLHEDIIHRCQQ
KU679945_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQ
KF873540_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQ
KF873537_Pol_P-RF-CB      DPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQ
KF873538_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQ
KF873542_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQ
KF873543_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQ
KC774475_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
AY057948_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
DQ478890_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KX660684_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSSVPVFNPQWQTPSFPHIHLQEDIINRCQQ
KT991424_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
FJ562263_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KT991427_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KX660689_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KP276253_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSSVPVFNPQWQTPSFPHIHLQEDIINRCQQ
AY817511_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KP276256_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
KC774485_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
HM750146_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KX660686_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSSVPVFNPQWQTPSFPHIHLQEDIIDRCQQ
KX354997_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
HM750144_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
HM750150_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
HM750145_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
HM750149_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774482_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774456_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
HM750148_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
HM750143_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
HM750147_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQ
FJ349241_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
HM750142_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KY470854_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQ
KY470843_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQ
KY470846_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQ
KY470847_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQ
KY470849_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQ
KY470850_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQ
KY470855_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQ
KY470853_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774433_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774486_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQMPSFPHIHLQEDIINRCQQ
KY629632_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AY817512_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774478_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSTTAPVFNPEWQIPSFPHIHLQEDILNRCQQ
KC774480_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSTTVPVFNPEWQIPSFPHIHLQEDILNRCQQ
KC774425_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTIPVFNPEWQIPSFPHIHLQEDIINRCQQ
AB270535_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQ
KC774431_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774428_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
AY817510_Pol_P-RF-DC      NLNVSVPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AY817513_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KP276254_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KP276255_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774476_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774481_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
JF491455_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
DQ478886_Pol_P-RF-DC      NLNVSIPWSHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIMNRCQQ
KC774452_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774449_Pol_P-RF-DC      DPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIIERCQQ
KC774439_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774435_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774455_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774442_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774443_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774470_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
JF491449_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774484_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774420_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774426_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPSIHLQEDIINRCQQ
KX660677_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774498_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774490_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIIDRCQQ
KC774483_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774422_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDILNRCQQ
AY862865_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
KC774458_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774454_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774448_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
AY800249_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KX660674_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KX660680_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774474_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774453_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIIDRCQQ
EU787434_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774492_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
DQ478898_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU787435_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774495_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774447_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
AY817515_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774457_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774466_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPLIHLQEDIINRCQQ
KC774499_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KU519422_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
JF491451_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KT991420_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774463_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KT991421_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KT991419_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
FJ562278_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KT991417_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KT991423_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
DQ478897_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774423_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774471_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774488_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774493_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KX660675_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU519423_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774487_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
JF491448_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AY817509_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774424_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774489_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774479_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774468_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774432_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
JF491456_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KF917451_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774472_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774434_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
DQ478887_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
DQ478892_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774494_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
KC774430_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
DQ478889_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774497_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
JX429898_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KJ803822_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU660227_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KJ717832_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQ
KJ803804_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQ
KJ717816_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQ
KJ717815_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
KJ803803_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
KJ717800_Pol_P-RF-CB      NLNVSIPWTHKVGNYTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVDRCEQ
KJ803791_Pol_P-RF-CB      NLNVSIPWTHKVGNYTGLYSSTVPSFNPKWQTPSFPDIHLQEDIVDRCEQ
KF053188_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
KJ803782_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
KJ717814_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCQQ
KJ803802_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCQQ
GQ377556_Pol_P-RF-CB      NLNVNIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCEQ
KF053160_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIVDRCKQ
KJ803753_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIVDRCKQ
KC315400_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
GQ377595_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPGFNPEWQTPSFPDIHLQEDIVNRCKQ
JQ801477_Pol_P-RF-BC      BLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPNIHLQEDIVDRCKQ
MK052968_Pol_P-RF-BD      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
MK052976_Pol_P-RF-BD      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
MK052967_Pol_P-RF-BD      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
MK052970_Pol_P-RF-BD      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
EU939627_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
KJ410497_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
KC774414_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
MH094410_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
EU939623_Pol_P-RF-CB      TLNVNIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCER
GQ377592_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQ
EU939620_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCQQ
FJ562328_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
HQ684848_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQ
EU939630_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
GQ377539_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
EU939621_Pol_P-RF-CB      NLSVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDKCKQ
GQ377604_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPNIHLQEDIVDRCKQ
GQ377602_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVARCEQ
GQ377634_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDKCKQ
GQ377594_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
FJ562247_Pol_P-RF-CB      DLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQ
GQ377573_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
GQ377613_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
GQ377626_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
GQ377549_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
JQ040174_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
GQ377565_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
GQ377590_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
GQ377596_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
GQ377564_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
GQ377614_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
KT003704_Pol_P-RF-CB      NLNVSIPWTHKVGNLTGLYSSTVPVFNPEWQTPSFPDIHLREDVINRCQQ
KP148352_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
AP011104_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINKCQQ
AP011105_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINKCQQ
LC416040_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
MG826148_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIKRCQQ
EU522070_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSTTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU919166_Pol_P-RF-CB      DLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AB105172_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQ
AP011102_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQ
AB493842_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQ
AP011103_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQ
AB493838_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNAEWQTPSFPDIHLKEDIIHRCQQ
AB493847_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNAEWQTPSFPDIHLKEDIIHRCQQ
AB493837_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNTEWQTPSFPDIHLQEDIINRCQQ
AB493840_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTQPVFNTEWQTPSFPDIHLQEDIINRCQQ
GQ358155_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNTEWQTPSFPDIHLHEDIINRCQQ
GQ358156_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNTEWQTPSFPDIHLQEDIINRCQQ
HQ700542_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTIPVFNPEWQIPSFPNIHLREDIINRCRQ
HQ700509_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNTEWQTPSFPDIHLQEDIINRCQQ
HQ700515_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNTEWQTPSFPDIHLQEDIINRCQQ
HQ700508_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPDIHLQEDIINRCQQ
KU695744_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQ
KU695746_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQ
KU695741_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
KU695743_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLREDIINRCQQ
HQ700505_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQ
KU695742_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQ
X75656_Pol_P-RF-CB        NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQ
HQ700462_Pol_P-RF-CB      NLNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQ
HQ700560_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQ
HQ700498_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPDIHLKEDIINRCQQ
HQ700499_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPDIHLKEDIINRCQQ
HQ700485_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQ
KU695745_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQ
HQ700554_Pol_P-RF-CB      DPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQ
HQ700557_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLKEDIINRCQQ
HQ700530_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQ
HQ700523_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQ
HQ700531_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQ
HQ700518_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIIDRCQQ
HQ700527_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQ
HQ700528_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQ
HQ700519_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTTPVFNPEWQTPSFPDIHLREDIINRCQQ
HQ700521_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTTPVFNPEWQTPSFPDIPXREDIINRCQQ
KC774246_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
HQ700520_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
GQ377635_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPVYNPEWQTPSFPNIHLQEDIINRCQQ
EU939631_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCEQ
EU939629_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQ
KC774178_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774364_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
GQ377630_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIINRCQQ
KP148337_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
KJ173350_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
KJ173349_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
KJ173358_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPCFNPKWQTPSFPDIHLQEDIVDRCKQ
EU882006_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KJ598675_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLQEDIIDRCQQ
EU881995_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPHIHLQEDIINRCQQ
JX504540_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EF494376_Pol_P-RF-CA      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQ
AP011108_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
MG826146_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
FJ562302_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KX096713_Pol_P-RF-CA      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
FJ562317_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQD
JF436919_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
HQ684849_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQ
AB300369_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
KC774198_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPYIHLQEDIIDRCQQ
KC774201_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPYIHLQEDIIDRCQQ
AY206374_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSPTAPVFNPEWQTPSFPHVHLKEDIIDRCQQ
KC774323_Pol_P-RF-CB      DLNVSIPWTHKVGNFTGAYYSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774307_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774193_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
GQ377560_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQ
KC774291_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KR013843_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQ
FJ032337_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTAPVFNPEWKTPSFPHIHLQEDIINRCQQ
MG826144_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQ
FJ386646_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLHEDIINRCQQ
AB033557_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSSVPVFNPDWQTPSFPHIHLQEDIINRCQQ
HQ700547_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCEQ
KJ173320_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLKEDIIDRCQQ
KJ173322_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLKEDIIDRCQQ
KJ173279_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
JQ040146_Pol_P-RF-CB      NLNVSIPWTHKVGXFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AB367419_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
EU939547_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
AB195955_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AB195956_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AB195957_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AB195939_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AB195940_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCEQ
AB195941_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCEQ
KC774188_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLQEDIINRCQQ
FJ562267_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
FJ562294_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIVNRCQQ
FJ386586_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774212_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTAPVFNPEWQTPSFPHIHLQEDIINRCEQ
JQ732168_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
HQ700526_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQ
GU385774_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQ
GU357843_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFSPEWQTPSFPHIHLQEDIINRCQQ
FJ386635_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPHIHLQEDIIDRCQQ
JX661485_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLKEDIINRCQQ
JX661486_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLREDIIDRCQQ
JQ040142_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
MG893555_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
JQ040148_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLXSSTVPVXNPEWQTPSFPNXHLQEDIIXRCZQ
MG893554_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
KC774344_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU787444_Pol_P-RF-CB      NLGVNIACTHRAGNFTGLYSSTVPIFNSEWQTPSFPHIHLQEDIIDRCQQ
AY247030_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPNIHLQEDIINRCQQ
AB367800_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCEQ
AB049609_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCEQ
JX661487_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
EU916232_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
GQ377534_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU939668_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AY040627_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
DQ089798_Pol_P-RF-CB      ILNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774222_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KJ173329_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIVNRCQQ
KC774324_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
FJ562305_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964306_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964308_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964005_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964006_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964007_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964009_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964010_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964303_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964304_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964305_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964307_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964309_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964310_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964311_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964312_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964313_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964314_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964315_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964316_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964317_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964008_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
MG826149_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774349_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774234_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AB670303_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AB195950_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQ
AB195951_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQ
FJ386578_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
FJ386585_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
FJ386649_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KJ173299_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KJ173300_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KY363263_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
FJ562227_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU939589_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQ
AB367400_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCEQ
AB642096_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCEQ
M38454_Pol_P-RF-CB        NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPHIHLQEDIINRCQQ
KR013806_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774258_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
GQ377548_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU939551_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
JF828933_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
JF828934_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
JF828935_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
JF828938_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
JF828936_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
AY123041_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVLNPEWQTPSFPNIHLQEDIINRCQQ
AB367393_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIIDRCQQ
AB205152_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIIDRCQQ
AF330110_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
HM750133_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLHEDIINRCQQ
MK321265_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLHEDIINRCQQ
KC774305_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
FJ562226_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AF411409_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU916239_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU916241_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU916240_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
JN400086_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
FJ386581_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KM213033_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIIDRCQQ
KC774263_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIINRCQQ
KC774332_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIINRCQQ
KC774341_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIINRCQQ
MG893559_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
FJ562314_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNSEWQTPSFPHIHLQEDIINRCQQ
KU963868_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963856_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963857_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963858_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963860_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963861_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963863_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963864_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963865_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963866_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963867_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963869_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963870_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963859_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU871981_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU871983_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU871984_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU871985_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU871986_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU871989_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU871991_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU871993_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPERQTPSFPHIHLQEDIINRCQQ
EU871996_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU871999_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU871992_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU871987_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU871988_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU871994_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU871990_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963883_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQ
JX661498_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
JX661494_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSSVPVFNPEWQTPSFPHIHLQEDIINRCQQ
JF436922_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
GQ377611_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQ
GQ377520_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
FJ386633_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AF233236_Pol_P-RF-CB      NLNVSTPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
FJ562287_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AB198084_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KY881840_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPHIHLQEDIINRCQQ
GQ377516_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774317_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774322_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AY167095_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
GQ377633_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964351_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
JX429896_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AY123424_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPHIHLQEDIINRCQQ
EU871997_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPHIHLQEDIINRCQQ
FJ787446_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
FJ787480_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
LC458432_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KR013816_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963991_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963990_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963993_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963994_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963995_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963998_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU963999_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964001_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KU964003_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774230_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774183_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQ
JX026887_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
MG893561_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KY470893_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774328_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KC774294_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KJ173325_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQ
KC774186_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
JQ040175_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
KJ173326_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQ
GQ377607_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
GQ377581_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIIDRCQQ
GQ377544_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
LC279265_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPQIHLQEDIINRCQQ
LC279266_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSYTVPVFNPEWQTPSFPQIHLQEDIINRCQQ
LC279267_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSYTVPVFNPEWQTPSFPQIHLQEDIINRCQQ
LC279263_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPQIHLQEDIINRCQQ
LC279264_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPQIHLQEDIINRCQQ
FJ361772_Pol_P-RF-GC      NLNVNIPWTHKVGNFTGLYSSTVPVFNPDWKTPSFPHIHLKEDIVNICQQ
MG826150_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQ
MG826151_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGPYSSTVPVFNPDWQTPFFPHIHLKEDIIPRCQQ
EU835240_Pol_P-RF-GC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
FJ023666_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCEQ
FJ023665_Pol_P-RF-GC      DPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
FJ023670_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
FJ023668_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
FJ023664_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
FJ023673_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
EU833891_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
FJ882610_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
FJ882614_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
FJ023667_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
FJ882611_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
FJ882617_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
FJ882612_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
FJ882613_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
FJ882618_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
MH746811_Pol_P-RF-BC      NPSVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPNIHLHEDIINRCQQ
MH746812_Pol_P-RF-BC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPNIHLHEDIINRCQQ
MG826145_Pol_P-RF-BC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPNIHLHEDIINRCQQ
MH746813_Pol_P-RF-BC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQIPSFPNIHLHEDIINRCQQ
KP148447_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
KP148586_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
KP148441_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
KP148449_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
KP148442_Pol_P-RF-BC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
KP148450_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
MH368022_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTIPVFNPEWQTPSFPNIHLHEDIINRCQQ
KY470996_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIIHRCQQ
KY471007_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIIHRCQQ
KY470999_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIIHRCQQ
KY471000_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIIHRCQQ
KY471002_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIIHRCQQ
KY470998_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIIHRCQQ
KY471001_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIIHRCQQ
KY471003_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIIHRCQQ
KY471006_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIIHRCQQ
KY470997_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIIHRCQQ
KY471005_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIIHRCQQ
FR714490_Pol_P-RF-GB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
KC172106_Pol_P-RF-GB      NPNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPNIHLHEDIINRCQQ
KF053166_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSSVPVFNPDWQTPSFPHIHLKEDIINRCQQ
KJ803827_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSSVPVFNPDWQTPSFPHIHLKEDIINRCQQ
FR714496_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
MF925382_Pol_P-RF-CB      NLNVDIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQ
MG826147_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQ
MG826141_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQ
MG826142_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQ
KJ803785_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQ
KF053186_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQ
KJ803778_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLKEDIINRCQQ
AB674504_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIITRCQQ
JF436923_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQ
KJ803798_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQ
MF925389_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQ
MF925370_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQ
GQ924618_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQ
JQ027310_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPNIHLKEDIINRCQQ
MF925381_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNSDWQTPSFPHIHLKEDIINRCQQ
AB031265_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLKEDIINRCQQ
KJ410506_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWKTPSFPHIHLKEDIINRCQQ
GU177079_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTAPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KF779353_Pol_P-RF-DA      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF440017_Pol_P-RF-DA      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLHEDIVNRCQQ
KC774450_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
MH464835_Pol_P-RF-DE      NLNVSIPWTHKVGNHTGLYSSTIPVFNPHWKTPSFPNIHLHEDIVKKCEQ
MH464851_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFPNIHLHEDIIKKCEQ
MH464846_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFPNIHLHQDIIKKCEQ
MH464852_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFPNIHLHQDIIKKCEQ
MH464850_Pol_P-RF-DA      NLNVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN664935_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFPNIHLHQDIINKCEQ
KF679991_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPIFPNIHLHQDIIKKCEQ
KM386676_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
DQ464164_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
DQ464167_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIRLHQDIIKKCEQ
DQ464165_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIRLHQDIIKKCEQ
DQ464166_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIRLHQDIIKKCEQ
KC793112_Pol_P-RF-BC      NLNVSIPWTHKVGNFTGLYSSTVPCFNPNWQTPSFPDIHLQEDIVDRCKQ
KJ586803_Pol_P-RF-AF      LPNVSIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQ
FN594767_Pol_P-RF-DE      LPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQ
GQ161806_Pol_P-RF-EA      LPDVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQ
AF297619_Pol_P-RF-DA      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQ
AF297620_Pol_P-RF-DA      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLQEDIINRCQQ
MF925402_Pol_P-RF-BD      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KJ586811_Pol_P-RF-DF      LPNVSIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQ
MK052957_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLRQDIIKKCEQ
JN040803_Pol_P-RF-DE      DLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
EF103283_Pol_P-RF-AD      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KX357641_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIEKCEQ
MH685719_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KU736914_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIEKCEQ
KU736915_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIEKCEQ
KU736917_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIEKCEQ
KU736916_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIEKCEQ
KP168420_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIEKCEQ
KP168421_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIEKCEQ
FN594769_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
FN594770_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
FN594771_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
GQ161754_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
FJ904436_Pol_P-RF-DE      NLNVDIPWTHKVGNFTGLYSSTVPVFNSQWKTPSFPNIHLHQDIIKKCEQ
AM494716_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTAPVFNPQWKTPSFPNIHLHQDIIKKCEQ
FJ904442_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNTHWKTPSFPNIHLHQDIIKKCEQ
FJ904444_Pol_P-RF-DE      NPNVNIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKRCEQ
FJ904405_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSYTVPVFNPHWKTPSFPNIHLHQDIIKRCEQ
FJ904396_Pol_P-RF-DE      DLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKRCEQ
KP288875_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSSVPVFNPHWRTPSFPNIHLHQDIIKRCEQ
FJ349207_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTAPVFNPHWKTPSFPNIHLDQDIIKKCEQ
FJ904414_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
FJ904401_Pol_P-RF-DE      DLNVSIPWTHKVGNFTGLYSSNVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
FJ904416_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKRCEQ
FJ904417_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKRCEQ
KX357632_Pol_P-RF-DE      NPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDILQKCEQ
FJ904409_Pol_P-RF-DE      NLNVSIPWTHKVGQFTGLYSSTEPVFNPHWKTPSFPNIHLHQDIIXRCEQ
FJ904406_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLSQDIIKKCEQ
FJ904404_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KM606741_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLNPDIIKKCEQ
FJ904394_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKRCEQ
FJ904400_Pol_P-RF-DE      DLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLNQDIIKKCEQ
FJ904441_Pol_P-RF-DE      DLNVSIPWTHKVGNFTGLYSSTAPVFNPHWKTPSFPNIHLNQDIIKKCEQ
KX357627_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDILKKCED
FJ904447_Pol_P-RF-DE      DLNVSIPWTHKVGNFTGIYSSTVPVFNPHWKTPSFPNIHLHQDIIKRCEQ
FJ904425_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTLPVFNPHWKTPSFPNIHLNQDIIKKCEQ
KU736921_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPQWKTPSFPNIHLHQDIINKCEQ
KU736922_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPQWKTPSFPNIHLHQDIINKCEQ
KX357636_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
FJ904407_Pol_P-RF-DE      NLTVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKRCEQ
FJ904398_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKRCEQ
KP168417_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIINKCEQ
KP168418_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIINKCEQ
FJ904437_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKRCEQ
KX357629_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDILKKCEQ
KX357625_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDILKKCEQ
KX357630_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDILNKCEQ
KX357626_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHEDILKKCEQ
KX357628_Pol_P-RF-DE      DLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDILKKCEQ
KX357634_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDILKKCEQ
KX357623_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDILKKCEQ
KX357633_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDILKKCEQ
KX357635_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDILKKCEQ
FJ904440_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLNQDILKKCEQ
KX827299_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLNQDIIKKCEQ
FJ904408_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGFYSSTVPVFNPHWKTPSFPNIHLHQDIIKRCEQ
KP995112_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLNPDIIKKCEQ
KM606750_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLNPDIIKKCEQ
KM606751_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLNPDIIKKCEQ
KP168416_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPVFPNIHLHQDIIRKCEQ
FJ904403_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KF170740_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIINKCEQ
MF925360_Pol_P-RF-DB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
FJ562223_Pol_P-RF-CD      NPNVSIPWTHKVGNFTGLYSSTVPVFNPDWKTPSFPNIHLHQDIIKKCEQ
GQ377627_Pol_P-RF-CD      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KJ647351_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPXWKTPSFPNIHLHQDIIKKCEQ
KJ647356_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
AY233295_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFPNIHLHQDIIKKCEQ
AY233293_Pol_P-RF-DE      DLNVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFPNIHLHQDIIKKCEQ
GU563560_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF440002_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTSSFPNIHLHQDIIKKCEQ
JF440003_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTSSFPNIHLHQDIIKKCEQ
JF440011_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVLNPHWKTPSFPNIHLHQDIIKKCEQ
JF439999_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF440013_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF440010_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF440009_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF440006_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF440001_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF440012_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF440000_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF439994_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF439995_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF439998_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF440004_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF440005_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF440007_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF440014_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF440015_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF439996_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
EU185780_Pol_P-RF-AD      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KC012653_Pol_P-RF-AD      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
AJ627221_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSNVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JX898693_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JX898698_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JX898699_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JX898690_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
AB210819_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
AJ344117_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JX898695_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JX898696_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JX898686_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JX898687_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTAPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JX898688_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTAPVFNPHWKTPSFPNIHLHQDIIKKCEQ
FJ349212_Pol_P-RF-DE      NLNVSVPWTHKVGSFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
MF967563_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
U95551_Pol_P-RF-DE        NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
X65259_Pol_P-RF-DA        NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
MK052969_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KU668440_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFPNIHLHQDIINKCEQ
KM577666_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFPNIHLHQDIIKKCEQ
JN257154_Pol_P-RF-DE      NPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHEDIIKKCEH
AY236161_Pol_P-RF-DA      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDTIKKCEQ
MF618346_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KF192833_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
MF618347_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KF192840_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KF192836_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KF192837_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KF192838_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KF192839_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KF192841_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KF192835_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHENIIEKCEQ
KJ470897_Pol_P-RF-DE      NLNVDIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KJ470891_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KJ470898_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KJ470887_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KJ470888_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KJ470890_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KJ470884_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
KJ470886_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQNIIEKCEQ
HQ700492_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
MH481861_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDISKKCEQ
MH481858_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDISKKCEQ
MH481859_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDISKKCEQ
AB048702_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
AB048703_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
FJ692536_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
AB033559_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700536_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700494_Pol_P-RF-DE      ILNXXIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIRKCEQ
HQ700579_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700585_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700524_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700525_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700584_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSVTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700541_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPIFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700503_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700540_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700535_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700534_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSTTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700533_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700493_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700581_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700582_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700583_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700537_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700497_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700500_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700501_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
HQ700538_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
EF103284_Pol_P-RF-AD      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
AB188243_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KJ647349_Pol_P-RF-DE      NLNVSIPWTHKVGNXTGLYSSTVPVFNPHWKPPSFPNIHLHQDIIKKCEH
AB270538_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN688689_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
FJ349221_Pol_P-RF-DE      DLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
AB188245_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKRCEQ
KM359442_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN688715_Pol_P-RF-DE      NLNVNIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
MF488702_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPIFNPHWKTPSFPNIHLHQDIIKKCEQ
KX827302_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
EF103285_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFPNIHLHQDIIKKCEQ
EU594436_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
AJ627217_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
GQ183486_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSTTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
AY373430_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
DQ111987_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
EU594435_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KT366504_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KM577665_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFPNIHLHQDIIKKCEQ
KT366492_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KM524359_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KM577663_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFPNIHLHQDIIKKCEQ
KM577664_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFPNIHLHQDIIKKCEQ
AB583679_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFPNIHLHQDIIKKCEQ
KM577667_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFPNIHLHQDIIKKCEQ
EF103282_Pol_P-RF-AD      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KJ803771_Pol_P-RF-DB      NLNVSIPWTHKVGNFTGLYSSTAPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN688717_Pol_P-RF-DE      NLSVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
MF925396_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN664929_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFPNIHLHQDIINKCEQ
AB033558_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSSVPVFNPHWKTPTFPNIHLHQDIINKCEQ
GQ205379_Pol_P-RF-DE      NLNVSIPWTHTVGNFTGLYSSTVPVFNPHWKTPTFPNIHLHQDIINKCEQ
JN664925_Pol_P-RF-DE      TLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIINKCGQ
KC875338_Pol_P-RF-DE      TLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIINKCEQ
JN664915_Pol_P-RF-DE      TLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIINKCGQ
KC875339_Pol_P-RF-DE      TLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIINKCEQ
GQ205377_Pol_P-RF-DE      TLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIINKCEQ
GQ205386_Pol_P-RF-DE      TLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIINKCEQ
GQ205378_Pol_P-RF-DE      TLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIINKCGQ
GQ205387_Pol_P-RF-DE      TLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIINKCEQ
JN664933_Pol_P-RF-DA      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIINKCGQ
KT366505_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFPNIHLHQDIINKCEQ
DQ315779_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFPNIHLHQDIIYKCEQ
JN664940_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPTFPNIHLHQDIINKCEQ
AY341335_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHPDIIKKCEQ
MF925401_Pol_P-RF-DB      NLNVSIPWTHKVGNFTGLYSATVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
MF925371_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
MF925388_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPDIHLHQDIIKKCEQ
EU594406_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPKIHLHQDIIKKCEQ
MF925392_Pol_P-RF-DB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN642160_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN664946_Pol_P-RF-DA      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN257204_Pol_P-RF-DE      NPNVSIPWTHKVGNFTGLYSSTVPVFNPHWQTPSFPNIHLHQDIIKKCEQ
KM524357_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JQ687532_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KR905422_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KT366503_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF754613_Pol_P-RF-DE      DLNVSIPWTHKVGNFTGLYSSTVPVFNPRWKTPSFPNIHLHQDIIKKCER
FJ904430_Pol_P-RF-DE      DLNVDIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKRCEQ
JN664943_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
MF925384_Pol_P-RF-DB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKRCEQ
MF925397_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKRCEQ
AB330368_Pol_P-RF-DA      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KU711666_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JF754616_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
AB674432_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
KU736923_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKRCEQ
JN642137_Pol_P-RF-DE      NPNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIQKCEQ
JN040798_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
AB674436_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNSHWKTPSFPNIHLHQDLIKKCER
AB674433_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN257189_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN642141_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN642127_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN642152_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN642139_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN257210_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN257216_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN257164_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN257191_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN257174_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
JN257206_Pol_P-RF-DE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPHWKTPSFPNIHLHQDIIKKCEQ
GQ161753_Pol_P-RF-AE      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPKIHLHEDIVNRCQQ
GQ161767_Pol_P-RF-AE      NLNVSIPWTHKVGNFTGLYSSTVPIFNPEWQTPSFPKIHLHEDIVKRCQQ
JQ801476_Pol_P-RF-CG      NLNVSIPWTHKVGSFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQ
JQ272886_Pol_P-RF-GF      LPNVSIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQ
JQ272887_Pol_P-RF-GF      LPNVSIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQ
EF464099_Pol_P-RF-AG      LPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQ
EU833890_Pol_P-RF-GA      LPDVSIPWTHKVGNFTGLYSSTTPVFNPDWQTPSFPNIHLHQDIITKCEQ
AB933279_Pol_P-RF-AG      LPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQ
AB933280_Pol_P-RF-AG      LPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQ
AB933281_Pol_P-RF-AG      LPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQ
HE981180_Pol_P-RF-GF      LPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQ
KF219922_Pol_P-RF-GH      LPNVSIPWTHKVGNFTGLYSSTIPVFNPDWQTPSFPNIHLHQDIITKCEQ
KU679952_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLHEDIINRCZQ
FJ023659_Pol_P-RF-BC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
FJ023662_Pol_P-RF-GC      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLHEDIINRCQQ
GQ475335_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLKEDIINRCQQ
KJ410520_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
AY862864_Pol_P-RF-DC      NLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLQEDIINRCQQ
HQ700580_Pol_P-RF-CB      NXNVNIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPNIHLKEDIINRCQQ
HQ700532_Pol_P-RF-CB      NPNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPDIHLQEDIINRCQQ
EU919167_Pol_P-RF-CB      DLNVSIPWTHKVGNFTGLYSSTVPVFNPEWQTPSFPHIHLQEDIINRCQQ
EU939606_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPIFNPDWQTPSFPHIHLQEDIINRCQQ
KM875422_Pol_P-RF-CB      NLNVSIPWTHKVGNFTGLYSSTVPVFNPDWQTPSFPHIHLQEDIINRCQQ
                                . :* .*  **    . *  .. .  . **      :    *  

JN664934_Pol_P-RF-DE      FVGPLTVNEKRRLQLIMPARFYPKVTKYLPLDKGIKPYYPEHLVNHYFQT
HE981179_Pol_P-RF-FG      FVGPLTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKT
KJ586810_Pol_P-RF-AF      FVGPLTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKT
EF494378_Pol_P-RF-CA      FVGPLTINEKRRLKLIMPARFFPKLTKYLPLDKGIKPYYPEHTVNHYFKT
KP274926_Pol_P-RF-GA      FVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQT
GQ331048_Pol_P-RF-AE      FVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQT
JQ707426_Pol_P-RF-GA      FVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPENVVNHYFQT
AB194949_Pol_P-RF-AE      FVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQA
HF571060_Pol_P-RF-AE      FVGPLTVNEKRRLQLIMPARFYPIRTKYFPLDKGIKPYYPDHVVNHYFQT
AB222708_Pol_P-RF-AD      FVGPLTANERRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQA
AB453985_Pol_P-RF-AC      FVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQT
JF440022_Pol_P-RF-AG      FVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQT
JF440019_Pol_P-RF-AG      FVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQT
AB933282_Pol_P-RF-AG      FVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQT
AB933283_Pol_P-RF-AG      FVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQT
MF925386_Pol_P-RF-AC      FVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFQT
AY161140_Pol_P-RF-AD      FVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQT
AY161141_Pol_P-RF-AD      FVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQT
KF214656_Pol_P-RF-AC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPDHVVNHYFQT
AY161145_Pol_P-RF-AD      FVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVFNHYFQA
AY161146_Pol_P-RF-AD      FVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVFNHYFQA
MF488705_Pol_P-RF-AD      FVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQT
AY233277_Pol_P-RF-AC      FVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDQVVNHYFQT
MF925404_Pol_P-RF-AC      FVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPDHVVNHYFQT
KF053179_Pol_P-RF-BC      FVGPLTVNERRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQT
KJ803772_Pol_P-RF-BC      FVGPLTVNERRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVNHYFQT
KJ717794_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQT
KJ803788_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFQT
KX765835_Pol_P-RF-GC      FVGPLTVNEKRRLKLVMPARFFPNSTKYLPLDKGIKPYYPEHTVNHYFQT
AB241109_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHIVNHYFKT
FJ386674_Pol_P-RF-BC      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
KC774461_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
KU679958_Pol_P-RF-CB      YVGPLTVNEKRXLKLIMPARFYPXLTKYLPLDKGIKPYYPEHAVNHYFKT
KF873522_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KU679941_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KF873523_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KF873524_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KF873521_Pol_P-RF-BC      YVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KU679955_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KF873511_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KU679944_Pol_P-RF-BC      YVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KU679953_Pol_P-RF-BC      YVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KF873519_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KU679950_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KF873517_Pol_P-RF-BC      YVGPLTINEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KF873518_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KU679946_Pol_P-RF-BC      YVGPLTINEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KU679948_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KF873513_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KF873515_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KU679954_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KU679942_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KU679943_Pol_P-RF-BC      YVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KF873527_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KU679956_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHAVNHYFKT
KF873530_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNHTKYLPLEKGIKVHYPEHVVNHYFKT
KF873531_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
KF873532_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
KF873533_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
KF873534_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
KU679940_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLEKGIKPYYPEHAVNHYFKT
KF873535_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNXTKYLPLEKGIKPYYPEHAVNHYFKT
KU679939_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLEKGIKPYYPEHAVNHYFKT
KU679945_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNITXYLPLDKGIKPYYPEHAVNHYFKT
KF873540_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
KF873537_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNSTKYLPLDKGIKPYYPEHAVNHYFKT
KF873538_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
KF873542_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
KF873543_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
KC774475_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
AY057948_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
DQ478890_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
KX660684_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEQAVNHYFKT
KT991424_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
FJ562263_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
KT991427_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
KX660689_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KP276253_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AY817511_Pol_P-RF-DC      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
KP276256_Pol_P-RF-DC      FVGPLTVNEKRRLQLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774485_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPWDKGIKPYYPEHAVNHYFKT
HM750146_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYFPLDKGIKPYYPEHAVNHYFKT
KX660686_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KX354997_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HM750144_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HM750150_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
HM750145_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HM750149_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774482_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPWDKGIKPYYPEHAVNHYFKT
KC774456_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HM750148_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HM750143_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HM750147_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
FJ349241_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HM750142_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KY470854_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPERAVNHYFQT
KY470843_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHAVNHYFQT
KY470846_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHAVNHYFQT
KY470847_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHAVNHYFQT
KY470849_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHAVNHYFQT
KY470850_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHAVNHYFQT
KY470855_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHAVNHYFQT
KY470853_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
KC774433_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774486_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
KY629632_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
AY817512_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774478_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774480_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774425_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
AB270535_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774431_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNFPKYLPLDKGIKPYYPEHAVNHYFQT
KC774428_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
AY817510_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKSYYPEYAVNHYFQT
AY817513_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KP276254_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEYAVNHYFQT
KP276255_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEYAVNHYFQT
KC774476_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
KC774481_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
JF491455_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
DQ478886_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
KC774452_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774449_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
KC774439_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFQT
KC774435_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774455_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774442_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774443_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774470_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
JF491449_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774484_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774420_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774426_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KX660677_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
KC774498_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774490_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774483_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774422_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
AY862865_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774458_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
KC774454_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774448_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
AY800249_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KX660674_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KX660680_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774474_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEYAVNHYFQT
KC774453_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
EU787434_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774492_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
DQ478898_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
EU787435_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774495_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774447_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
AY817515_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
KC774457_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774466_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774499_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
KU519422_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPKLTKYLPLDKGIKPYYPEYAVNHYFQT
JF491451_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KT991420_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774463_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KT991421_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KT991419_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
FJ562278_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KT991417_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KT991423_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
DQ478897_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774423_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774471_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774488_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774493_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KX660675_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KU519423_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
KC774487_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKT
JF491448_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
AY817509_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774424_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774489_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774479_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774468_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774432_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
JF491456_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KF917451_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774472_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774434_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEYAVNHYFQT
DQ478887_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEFAVNHYFQT
DQ478892_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEFAVNHYFQT
KC774494_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774430_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHAVNHYFQT
DQ478889_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774497_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
JX429898_Pol_P-RF-DC      YVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEYAVNHYFQT
KJ803822_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU660227_Pol_P-RF-BC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KJ717832_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHIVNHYFQT
KJ803804_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQT
KJ717816_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHIVNHYFQT
KJ717815_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVEHYFQT
KJ803803_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVEHYFQT
KJ717800_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNGTKYLPLDKGIKPYYPEYVVNHYFQT
KJ803791_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNGTKYLPLDKGIKPYYPEYVVNHYFQT
KF053188_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPAGFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
KJ803782_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPAGFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
KJ717814_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
KJ803802_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
GQ377556_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
KF053160_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
KJ803753_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
KC315400_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
GQ377595_Pol_P-RF-BC      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
JQ801477_Pol_P-RF-BC      FVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEYVVNHYFQT
MK052968_Pol_P-RF-BD      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
MK052976_Pol_P-RF-BD      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
MK052967_Pol_P-RF-BD      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
MK052970_Pol_P-RF-BD      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
EU939627_Pol_P-RF-BC      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
KJ410497_Pol_P-RF-BC      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVDHYFQT
KC774414_Pol_P-RF-BC      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
MH094410_Pol_P-RF-BC      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
EU939623_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
GQ377592_Pol_P-RF-CB      FVGPLTVNENRRLRLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
EU939620_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
FJ562328_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPKVTKYLPLDKGIKPYYPEHVVTHYFQT
HQ684848_Pol_P-RF-CB      FVGPLTVNENRRLKFIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
EU939630_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
GQ377539_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
EU939621_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
GQ377604_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNATKYLPLDKGIKPYYPEDVVNHYFQT
GQ377602_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
GQ377634_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
GQ377594_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
FJ562247_Pol_P-RF-CB      FVGPLTVNETRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
GQ377573_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
GQ377613_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
GQ377626_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
GQ377549_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
JQ040174_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
GQ377565_Pol_P-RF-CB      FVGPLTVNENRRLKLVMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
GQ377590_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
GQ377596_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
GQ377564_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
GQ377614_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
KT003704_Pol_P-RF-CB      FVGPLTVNEKRRLSLIMPARFYPNITKYLPLDKGIKPYYPNHVVNHYFKT
KP148352_Pol_P-RF-CB      YVGPLTVNEKRRLSLIMPARFYPNITKYLPLEKGIKPYYPNHAVNHYFKT
AP011104_Pol_P-RF-CB      YVGPLTVNEKRRLSLIMPARFYPNITKYLPLDKGIKPYYPNHAVNHYFKT
AP011105_Pol_P-RF-CB      YVGPLTVNEKRRLSLIMPARFYPNITKYLPLDKGIKPYYPNHAVNHYFKT
LC416040_Pol_P-RF-CB      YVGPRTVNEKRRLSLIMPARFYPNITKYLPLDKGIKPYYPNHAVNHYFKT
MG826148_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU522070_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKT
EU919166_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPHYPEYAVNHYFKT
AB105172_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPDHAVNHYFKT
AP011102_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB493842_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AP011103_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFFPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB493838_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB493847_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB493837_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB493840_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
GQ358155_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
GQ358156_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HQ700542_Pol_P-RF-CB      YVGPLTVNETRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
HQ700509_Pol_P-RF-CB      YVGPLTXNEKRRLKLIMPARFYPNXTKYLPLDKGIKPYYPEHTVNHYFKT
HQ700515_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPEHTVNHYFKT
HQ700508_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENTVNHYFKT
KU695744_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU695746_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU695741_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU695743_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HQ700505_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU695742_Pol_P-RF-CB      YVGPLTVNEKRRLQLIMPARFYPNLTKYLPLDKGIKPYYPAHAVNHYFKT
X75656_Pol_P-RF-CB        YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HQ700462_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HQ700560_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HQ700498_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HQ700499_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HQ700485_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU695745_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HQ700554_Pol_P-RF-CB      YVGPLTANEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HQ700557_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HQ700530_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPSLTKYLPLDKGIKPYYPEHAVNHYFQT
HQ700523_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
HQ700531_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
HQ700518_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKT
HQ700527_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HQ700528_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HQ700519_Pol_P-RF-CB      YVGPLTVNEKRRLKLVMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HQ700521_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774246_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKT
HQ700520_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
GQ377635_Pol_P-RF-BC      YVGPLTVNEKRRLKLIMPARFYPNRTKYLPLDKGIKPYYPEHAVNHYFQT
EU939631_Pol_P-RF-BC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVDHYFKT
EU939629_Pol_P-RF-BC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774178_Pol_P-RF-BC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774364_Pol_P-RF-BC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
GQ377630_Pol_P-RF-BC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KP148337_Pol_P-RF-BC      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHVVNHYFQT
KJ173350_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
KJ173349_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEYVVNHYFQT
KJ173358_Pol_P-RF-CB      FVGPLTVNENRRLKLIMPARFYPNVTKYLPLDKGFKPYYPEHVVNHYFQT
EU882006_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKT
KJ598675_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLSLDKGIKPYYPEHAVNHYFKT
EU881995_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
JX504540_Pol_P-RF-CB      YVSPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPGHAVNHYFKT
EF494376_Pol_P-RF-CA      FVGPLTVNEKRRLKLIMPARFYPTHTKYLPLDKGIKPYYPDQVVNHYFKT
AP011108_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
MG826146_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
FJ562302_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KX096713_Pol_P-RF-CA      YVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
FJ562317_Pol_P-RF-CB      YVGPLTVNEKRRLRLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
JF436919_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNPTKYLPLDKGIKPYYPEHVVNHYFKT
HQ684849_Pol_P-RF-BC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKT
AB300369_Pol_P-RF-CB      YVGPLTVNEKRRLRLIMPARFYPKLTKYLPLDKGIKPYYPEHAINHYFKT
KC774198_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKT
KC774201_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKT
AY206374_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPGHAVNHYFKT
KC774323_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKT
KC774307_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKT
KC774193_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKT
GQ377560_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774291_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHTVNHYFKT
KR013843_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYCPEYAVNHYFKT
FJ032337_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
MG826144_Pol_P-RF-CB      YVGPLTVNETRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
FJ386646_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB033557_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHTVNHYFQT
HQ700547_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPKPTKYLPLDKGIKPYYPAHAVNHYFKT
KJ173320_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KJ173322_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KJ173279_Pol_P-RF-CB      YVGPLTVNENRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
JQ040146_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB367419_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU939547_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
AB195955_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB195956_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB195957_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB195939_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB195940_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB195941_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774188_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
FJ562267_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEQAVNHYFKT
FJ562294_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNVTKYLPLDKGIKPYYPEHAVNHYFKT
FJ386586_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKT
KC774212_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
JQ732168_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HQ700526_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
GU385774_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
GU357843_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
FJ386635_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
JX661485_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
JX661486_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFQT
JQ040142_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
MG893555_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNFTKYLPLDKGIKPYYPEHAVNHYFQT
JQ040148_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
MG893554_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
KC774344_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
EU787444_Pol_P-RF-CB      YVSPLTVNEKRRLKLLMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AY247030_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHVVNHYFKT
AB367800_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB049609_Pol_P-RF-CB      YVGPLTTNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEQAVNHYFKT
JX661487_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKT
EU916232_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNHTKYLPLDKGIKPYYPENAVNHYFKT
GQ377534_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU939668_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AY040627_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
DQ089798_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKT
KC774222_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KJ173329_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774324_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
FJ562305_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU964306_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964308_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964005_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964006_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964007_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964009_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964010_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964303_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964304_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964305_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964307_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964309_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964310_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964311_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964312_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964313_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964314_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964315_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964316_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964317_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
KU964008_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
MG826149_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774349_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFQT
KC774234_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
AB670303_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLEKGIKPYYPEHAVNHYFKT
AB195950_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKT
AB195951_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKT
FJ386578_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
FJ386585_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
FJ386649_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KJ173299_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KJ173300_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KY363263_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
FJ562227_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU939589_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB367400_Pol_P-RF-CB      YVGPLTTNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB642096_Pol_P-RF-CB      YVGPLTTNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
M38454_Pol_P-RF-CB        YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KR013806_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYWPLDKGIKPYYPEHAVNHYFKT
KC774258_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKT
GQ377548_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU939551_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFQT
JF828933_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
JF828934_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
JF828935_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
JF828938_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
JF828936_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNRYFKT
AY123041_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB367393_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB205152_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AF330110_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
HM750133_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
MK321265_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774305_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPENAVNHYFKT
FJ562226_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AF411409_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU916239_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKT
EU916241_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKT
EU916240_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKT
JN400086_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
FJ386581_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KM213033_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774263_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774332_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774341_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
MG893559_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
FJ562314_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963868_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963856_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963857_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963858_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963860_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963861_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963863_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963864_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963865_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963866_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963867_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963869_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963870_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963859_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU871981_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU871983_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU871984_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU871985_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU871986_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU871989_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU871991_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU871993_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU871996_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU871999_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU871992_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU871987_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU871988_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU871994_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU871990_Pol_P-RF-CB      YVGPLTVNEKGRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963883_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
JX661498_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
JX661494_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
JF436922_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
GQ377611_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
GQ377520_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
FJ386633_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AF233236_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
FJ562287_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AB198084_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KY881840_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
GQ377516_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774317_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774322_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AY167095_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
GQ377633_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU964351_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
JX429896_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
AY123424_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
EU871997_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
FJ787446_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
FJ787480_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPERAVNHYFKT
LC458432_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KR013816_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963991_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963990_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963993_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963994_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963995_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963998_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU963999_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU964001_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KU964003_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774230_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774183_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
JX026887_Pol_P-RF-CB      FVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
MG893561_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KY470893_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774328_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774294_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KJ173325_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
KC774186_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
JQ040175_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKT
KJ173326_Pol_P-RF-CB      YVGPLTINEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
GQ377607_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEYAVNHYFKT
GQ377581_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
GQ377544_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
LC279265_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
LC279266_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
LC279267_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
LC279263_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
LC279264_Pol_P-RF-CB      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
FJ361772_Pol_P-RF-GC      YVGPLTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKNYYPEHTVNHYFQT
MG826150_Pol_P-RF-BC      FVGPLTVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHTVNHYFQA
MG826151_Pol_P-RF-BC      FVGPLPVNEKRRLKLIMPARFYPTLTKYLPLDKGIKPYYPEHTVNHYFQA
EU835240_Pol_P-RF-GC      FVGPMTVNEKRRLKLIMPARFYPNLTKYLPLDKGIKPYYPEHAVNHYFKT
FJ023666_Pol_P-RF-GC      FVGPLTLNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
FJ023665_Pol_P-RF-GC      FVGPLTLNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
FJ023670_Pol_P-RF-GC      FVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
FJ023668_Pol_P-RF-GC      FVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
FJ023664_Pol_P-RF-GC      FVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
FJ023673_Pol_P-RF-GC      FVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
EU833891_Pol_P-RF-GC      FVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
FJ882610_Pol_P-RF-GC      FVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNHYFKT
FJ882614_Pol_P-RF-GC      FVGPLTVNEKRRLKLIMPARFYPNITKYLPLDKGIKPYYPEHAVNH