HBVdb

Dataset for protein SHBs of genotype RF

[Download (right click)] [Edit] [Sequences] [Repertoires]

1033 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KJ803822_SHBs_P-RF-CB      MENTTSGFLGPPIVLQAGFFLLTRILAMPQSGDSCRNSFNFLGGAPTCRG
EU939631_SHBs_P-RF-BC      MESTTSGFPGPLLVLQAGYFSLTKILTIPQSLDSWWTSLNFQRETPVCHG
KX660685_SHBs_P-RF-DC      MENITSGFLGPLLVLQAALFLLTRMLTIPLSLYSRWTSLGFLGGSTLCLG
AY161145_SHBs_P-RF-AD      MENITSGFLGPLLVLQAGFFLLTSFLTIPQSLDSWWTSLNFLGGSPVCLG
AY161146_SHBs_P-RF-AD      MENITSGFLGPLLVLQAGFFLLTSFLTIPQSLDSWWTSLNFLGGSPVCLG
HE981179_SHBs_P-RF-FG      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY303879_SHBs_P-RF-ED      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
GQ161806_SHBs_P-RF-EA      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCRG
AB195940_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
AB195941_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JQ707474_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707432_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707421_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707430_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707424_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707441_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707445_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGVPVCPG
JQ707448_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707450_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707463_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707465_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707467_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707473_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707475_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KF219922_SHBs_P-RF-GH      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707426_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KX765835_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
FJ361772_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQNLDLWWTSLNFLGGVPVCPG
EU833889_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ272887_SHBs_P-RF-GF      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ272886_SHBs_P-RF-GF      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
KP274926_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AB933279_SHBs_P-RF-AG      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AB933280_SHBs_P-RF-AG      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AB933281_SHBs_P-RF-AG      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
MG826151_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GQ331048_SHBs_P-RF-AE      MENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ161788_SHBs_P-RF-AE      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGPPVCRG
KP148442_SHBs_P-RF-BC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KJ586803_SHBs_P-RF-AF      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPGCLG
GQ161753_SHBs_P-RF-AE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KP997620_SHBs_P-RF-DA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLG
KP148450_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KP148441_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
AY161141_SHBs_P-RF-AD      MENITSGFHGPLLVLQAGFFLLTRILTIPQSIDSWWTSLNFLGGSPVCLG
AB453985_SHBs_P-RF-AC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707460_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707459_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707458_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707457_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707456_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
AY161147_SHBs_P-RF-DA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KF214680_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGESTVCPG
HM146131_SHBs_P-RF-AD      MENIASGYLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU833890_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
EF103282_SHBs_P-RF-AD      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSFNFLGGSTVCLG
AY236161_SHBs_P-RF-DA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY230120_SHBs_P-RF-DA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY161140_SHBs_P-RF-AD      MENITSGFLGPLLVLQAGFFLLTRILTIPQSIDSWWTSLNFLGGSPVCLG
AB933282_SHBs_P-RF-AG      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF925386_SHBs_P-RF-AC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF440022_SHBs_P-RF-AG      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF440019_SHBs_P-RF-AG      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JF439776_SHBs_P-RF-AG      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EF103283_SHBs_P-RF-AD      MHKITSGFLGPLLVLQAGFILLTRILSLPQSLDSWWTSLNFLGGSPVCLG
AF297619_SHBs_P-RF-DA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB194949_SHBs_P-RF-AE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGESPVCLG
KP148586_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KP148449_SHBs_P-RF-GC      MENITSGFLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FR714490_SHBs_P-RF-GB      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MF925404_SHBs_P-RF-AC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MF488705_SHBs_P-RF-AD      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KJ586810_SHBs_P-RF-AF      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
HF571060_SHBs_P-RF-AE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ161837_SHBs_P-RF-AE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
GQ161838_SHBs_P-RF-AE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AY233277_SHBs_P-RF-AC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
AB933283_SHBs_P-RF-AG      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCXG
AB222708_SHBs_P-RF-AD      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU185780_SHBs_P-RF-AD      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ514345_SHBs_P-RF-AD      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KC012653_SHBs_P-RF-AD      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
JQ707461_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707462_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707464_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707466_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707468_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707469_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707470_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707471_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JQ707472_SHBs_P-RF-GA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPVCPG
JN225963_SHBs_P-RF-DG      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849500_SHBs_P-RF-DG      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY470871_SHBs_P-RF-GC      MENITSGFLGPRLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY471004_SHBs_P-RF-GC      MENIRSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLS
KY470858_SHBs_P-RF-GC      MENITSGFLGPRLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ882613_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
JF440021_SHBs_P-RF-AG      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ023666_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
EU835240_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGESTVCLG
EF464099_SHBs_P-RF-AG      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
FJ882610_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FJ882614_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FJ023659_SHBs_P-RF-BC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
FJ023662_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KC172106_SHBs_P-RF-GB      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY470997_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY470998_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY470999_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY471000_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY471001_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY471002_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY471003_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY471005_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY471006_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KY471007_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KF214656_SHBs_P-RF-AC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
EU833891_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FJ023664_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FJ023665_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FJ023667_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FJ023668_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FJ882618_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FJ882617_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFXGGSTVCLG
FJ882612_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FJ023670_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
FJ023673_SHBs_P-RF-GC      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGSTVCLG
AY341335_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF440011_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
AF297620_SHBs_P-RF-DA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU711666_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349221_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPTVCLG
JQ514421_SHBs_P-RF-DC      MENTTSGFLGPLLGLQAGFFLLTRILTILQSLDLWWTSLNFLGGTIVCLG
KJ586811_SHBs_P-RF-DF      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX898690_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF439994_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439995_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439996_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439998_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439999_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF440000_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF440001_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF440002_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF440003_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF440004_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF440005_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF440006_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF440007_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF440008_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF440009_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF440010_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF440012_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF440013_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF440014_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF440015_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF440017_SHBs_P-RF-DA      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
GQ205379_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB033558_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB210819_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AJ344117_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ315779_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ315780_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ205377_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ205378_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ205386_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ205387_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664915_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664925_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664933_SHBs_P-RF-DA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664934_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664935_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664940_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX898686_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX898687_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX898688_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX898698_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX898699_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875338_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875339_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366505_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU668440_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF488699_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MF967563_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
U95551_SHBs_P-RF-DE        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF192840_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700503_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700536_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KC774458_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF192833_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF192836_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF192837_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF192838_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF192839_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF192841_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF618347_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700519_SHBs_P-RF-CB      MESTTSGFLGPLLXLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
KY470853_SHBs_P-RF-DC      MEKITSGFLKPLLALQAGFFSLTRILTIPQSLDSWWTSLSFLGGTTVCRG
HQ700505_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FJ562223_SHBs_P-RF-CD      MESITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPKCPG
HQ700518_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
MF925382_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KP148352_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
JF828936_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ032337_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KJ410520_SHBs_P-RF-CB      MENTTSRFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB014375_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPKCPG
KJ803785_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPKCPG
AP011104_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
AP011105_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
KT003704_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
LC416040_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
JF828933_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JF828934_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JF828935_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JF828938_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GQ475335_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562305_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939606_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939551_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
EU872014_SHBs_P-RF-CB      MESTTSGFPGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871999_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871988_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871981_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871983_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871984_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871985_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871986_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871987_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871989_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871990_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871991_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPTCPG
EU871992_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871993_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871994_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPTCPG
EU871995_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871996_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367419_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB195950_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB195951_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB195956_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB195957_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386586_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964351_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470893_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQGLDSWWTSLNFLGEAPTCPG
KJ173349_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF330110_SHBs_P-RF-CB      MESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826142_SHBs_P-RF-CB      MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173325_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM875422_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB195955_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF461361_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY123041_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU589339_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871997_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB205152_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU872015_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916239_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916240_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916241_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386581_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386635_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562271_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377560_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377611_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279267_SHBs_P-RF-CB      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279266_SHBs_P-RF-CB      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279265_SHBs_P-RF-CB      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279264_SHBs_P-RF-CB      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279263_SHBs_P-RF-CB      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC458432_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881840_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963883_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963870_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963869_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963868_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963867_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963866_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963865_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963864_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963863_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963862_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963861_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963860_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963859_SHBs_P-RF-CB      MESTTSGFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963858_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963857_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774307_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774305_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774294_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774291_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774193_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX429896_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ732168_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN400086_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JF436922_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377633_SHBs_P-RF-CB      MEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM750133_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173326_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSXNFLGGAPTCPG
KU963856_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HQ700530_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
HQ700527_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAXVCXG
HQ700528_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCLG
AP011103_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
HQ700520_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
HQ700523_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
HQ700531_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
HQ700532_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
AB493837_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
AB493838_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
AB493840_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
AB493847_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
GQ358155_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
GQ358156_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
KU695744_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
KY363272_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY363273_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU695745_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700554_SHBs_P-RF-CB      MENTTSGFLGPLLXLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700515_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
HQ700507_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
HQ700508_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
HQ700509_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPVCPG
HQ700499_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700498_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
MG826144_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU695746_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
KU695743_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
KU695741_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
HQ700462_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700485_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700557_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700560_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700580_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEXPRCPG
X75656_SHBs_P-RF-CB        MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSGWTSLNFLGEAPRCPG
MK052976_SHBs_P-RF-BD      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MF925402_SHBs_P-RF-BD      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM577666_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGRTVCLG
FJ349212_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF103284_SHBs_P-RF-AD      MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
KY470845_SHBs_P-RF-DC      MENITSGFLKPLLALQAGFFWLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KY470848_SHBs_P-RF-DC      MENITSGFLKPLLALQAGFFWLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KY470851_SHBs_P-RF-DC      MENITSGFLKPLLALQAGFFWLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KY470852_SHBs_P-RF-DC      MENITSGFLKPLLALQAGFFWLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JN257154_SHBs_P-RF-DE      MENITSGFLGPLLVFQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
AB674434_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFSWLTKILTIPQSLDSWWTSLNFLGGTTVCLG
X68292_SHBs_P-RF-DA        MENITSGFLGPLLVLEAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU679954_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACXG
KU679950_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873519_SHBs_P-RF-CB      MENTPSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KU679952_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLSFLGXAPACXG
KF873511_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KU679956_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KU679940_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873518_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873530_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873531_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873532_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873533_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873534_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KU679945_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KU679939_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873543_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873542_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873540_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPACLG
KF873538_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873535_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873537_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPACLG
KF873527_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873521_SHBs_P-RF-BC      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873517_SHBs_P-RF-BC      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873513_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873515_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KU679948_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACLG
KU679955_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KU679953_SHBs_P-RF-BC      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KU679944_SHBs_P-RF-BC      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KU679946_SHBs_P-RF-BC      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KU679958_SHBs_P-RF-CB      MESTXXGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGEAPACLG
KU679943_SHBs_P-RF-BC      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KU679942_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KU679941_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873523_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873524_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873522_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
MF925360_SHBs_P-RF-DB      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
MF682475_SHBs_P-RF-DC      MENITSGFLRPLLGLQAGFFLLTRILTIPQSLDSWLTSLSFLGGTTVCLG
GU563560_SHBs_P-RF-DE      MANSISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF488702_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF679991_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
FN594767_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ464167_SHBs_P-RF-DE      MESITSGFLQPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
AY817513_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257204_SHBs_P-RF-DE      MENITSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JN664929_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCRG
MF925396_SHBs_P-RF-DC      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
AB188243_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLG
AY057948_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM750145_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
X80925_SHBs_P-RF-DE        MENITSDFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF925389_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAHVCLG
KT991419_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM359442_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGTTVCLG
JX036354_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX036350_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
J02202_SHBs_P-RF-DE        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN594770_SHBs_P-RF-DE      MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
DQ464166_SHBs_P-RF-DE      MENITSGFLQPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KU736917_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU736916_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774479_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN594771_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349207_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLG
AJ627221_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCPG
MF618346_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY629632_SHBs_P-RF-DC      MENITSGLLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KY470854_SHBs_P-RF-DC      MENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KY470844_SHBs_P-RF-DC      MENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KX827302_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KX357624_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLSFLGGPTVCLG
KU736914_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366503_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524357_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ803771_SHBs_P-RF-DB      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642160_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904397_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
DQ478890_SHBs_P-RF-DC      MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY862865_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY817510_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY817509_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY800249_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674436_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB270535_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB188245_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774456_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774495_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774453_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX660686_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ622864_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KY470843_SHBs_P-RF-DC      MENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KY470846_SHBs_P-RF-DC      MENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KY470847_SHBs_P-RF-DC      MENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KY470849_SHBs_P-RF-DC      MENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KY470850_SHBs_P-RF-DC      MENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KY470855_SHBs_P-RF-DC      MENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KY470856_SHBs_P-RF-DC      MENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
FJ562278_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KT991417_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KT991420_SHBs_P-RF-DC      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KT991423_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
MH464835_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGNTVCLG
MF925401_SHBs_P-RF-DB      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KJ647349_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGNTVCLG
KF192835_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX036359_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX036355_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX036348_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX036347_SHBs_P-RF-DC      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX036332_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN688715_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTTVCLG
JF754613_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGNTVCLG
HQ700492_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLXFLGGTTVCLG
FJ904430_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCLG
FJ904417_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904416_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904409_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ464164_SHBs_P-RF-DE      MENITSGFLQPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
DQ464165_SHBs_P-RF-DE      MENITSGFLQPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
DQ478886_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904394_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFQGGTTVCLG
KX660680_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX660674_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357628_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357626_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774498_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774481_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774476_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774454_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774431_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774420_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642152_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLVTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642141_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF491451_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700534_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904425_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904407_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904398_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904405_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904414_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB270538_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674412_SHBs_P-RF-DE      MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357627_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ991753_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357631_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP288875_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM386676_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ470892_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471643_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX036330_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642139_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040803_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCLG
FN594769_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904436_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
FJ904447_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700494_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257174_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP168421_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY817512_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ478898_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU787435_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF925397_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
MF925384_SHBs_P-RF-DB      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ647356_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KJ470887_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040798_SHBs_P-RF-DE      MENITSGFPGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JF491456_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF491455_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700582_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ622875_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594406_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664943_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664946_SHBs_P-RF-DA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN688717_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ687532_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX898693_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX898695_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX898696_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KR905422_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF925371_SHBs_P-RF-DC      MENITSGFLGPLLVLLAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF925388_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF925392_SHBs_P-RF-DB      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH685719_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH481861_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLG
MH481860_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLARILTIPQSLDSWWTSLNFLGGTTVCLG
MH481859_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTISQSLDSWWTSLNFLGGTTVCLG
KX827299_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357641_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357625_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTTVCLG
KT991427_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524359_SHBs_P-RF-DE      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF917451_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774494_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774492_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774487_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774474_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLG
KC774468_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774463_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCLG
KC774452_SHBs_P-RF-DC      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPG
KC774442_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774430_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774428_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF491448_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904400_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KM577665_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
FJ622876_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKPVCLG
AB330368_SHBs_P-RF-DA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
AB033559_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB048702_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB583679_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674432_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674433_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674504_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AJ627217_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AM494716_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY233293_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY233295_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY373430_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY817511_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY817515_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY862864_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY862866_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ111987_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ478887_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ478889_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ478892_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ478897_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF103285_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLA
EU594435_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594436_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU787434_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349241_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ562263_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ622866_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGTTVCLG
FJ622872_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB048703_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904437_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY670781_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ622865_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357634_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774490_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257189_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700540_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700538_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257206_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257207_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257191_SHBs_P-RF-DE      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX660684_SHBs_P-RF-DC      MENITSGFLGPLLVLQAEFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ470898_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
KJ470897_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257210_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257164_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754616_SHBs_P-RF-DE      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF491449_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700584_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700583_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700581_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700541_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700539_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
HQ700537_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700535_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700533_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700525_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700524_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700501_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700500_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700497_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700493_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM750150_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM750149_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM750148_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM750147_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM750146_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM750144_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM750143_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM750142_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU177079_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183486_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ161754_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904444_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904442_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCLG
FJ904441_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904440_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904408_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904406_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
FJ904404_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
FJ904403_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
FJ904396_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692536_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774478_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774480_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366492_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
X65259_SHBs_P-RF-DA        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK052969_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK052957_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH481862_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH481858_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464852_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464851_SHBs_P-RF-DE      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464850_SHBs_P-RF-DA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464846_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX660689_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
KX660677_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX660675_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357636_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357635_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357633_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357632_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357630_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357629_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KX357623_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX354997_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU736923_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU736922_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU736921_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU519423_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU519422_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT991424_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366504_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP995112_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPHSLDSWWTSLNFLGGTTVCLG
KP276256_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP276255_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP276254_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP276253_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP168418_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP168417_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP168416_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606751_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606750_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606741_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM577667_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM577664_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM577663_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ647351_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ470891_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ470890_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ470888_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ470886_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ470884_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779353_SHBs_P-RF-DA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170740_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774499_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774497_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774493_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774489_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774488_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774486_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774485_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774484_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774483_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774482_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774475_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774472_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774471_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774470_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774466_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774461_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774457_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774455_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774450_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774449_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774448_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774447_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774443_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774439_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774435_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774434_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774433_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774432_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774426_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774425_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774424_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774423_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774422_SHBs_P-RF-DC      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849628_SHBs_P-RF-DA      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX429898_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN688689_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642137_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN257216_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642127_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ622874_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
HQ700579_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700585_SHBs_P-RF-DE      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF436919_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPVCPG
KF053186_SHBs_P-RF-BC      MENIASGLLEPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGGTTVCLG
KJ803778_SHBs_P-RF-BC      MENIASGLLEPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGGTTVCLG
FJ751342_SHBs_P-RF-CB      KESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF053188_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPTCPG
KJ803782_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPTCPG
KJ717800_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFPGGAPACPG
KJ803791_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFPGGAPACPG
KF053166_SHBs_P-RF-BC      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ803827_SHBs_P-RF-BC      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
JF436923_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTEILTIPQSLDSWWTSLNFLGGTPVCLG
KX777261_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ386674_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCRG
EU882006_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EF494378_SHBs_P-RF-CA      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777355_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JX504540_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGVPACPG
JX036329_SHBs_P-RF-CD      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562328_SHBs_P-RF-CB      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWLSLNFLGGAPTCPG
AB241109_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751336_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302989_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361539_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX096713_SHBs_P-RF-CA      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPACPG
HQ700542_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
GQ377592_SHBs_P-RF-CB      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751277_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652157_SHBs_P-RF-BC      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
GU357843_SHBs_P-RF-CB      MENITSGLLGPLLVLQAGFFLLTKILTMPQSLDSWWTSHNFLGGTPVCLG
KF053179_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
KJ803772_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
FR822117_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821810_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR821925_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HE652175_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777382_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX777386_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
EU589337_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ032343_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MH094410_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386643_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AP011102_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
M38454_SHBs_P-RF-CB        MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLHSWWTSLNFLGAAPTCLG
KC315400_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040146_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
HQ700521_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
GQ377564_SHBs_P-RF-CB      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FJ751340_SHBs_P-RF-CB      KESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562302_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774188_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ751609_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX036358_SHBs_P-RF-DC      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ027310_SHBs_P-RF-CB      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLEGAPACPG
GQ377604_SHBs_P-RF-CB      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562294_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
EU939630_SHBs_P-RF-CB      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939547_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALKCPG
EU919167_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU919166_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089798_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AP011108_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
AB493842_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
AB367800_SHBs_P-RF-CB      MENTTSGFLGPLLGLQAGFFLLTKILTIPQSLDLWWTSLNFLGGAPACPG
AB105172_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
HE652156_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822069_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY206374_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU695742_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
KJ803802_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPTCPG
KJ717832_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KJ717814_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPTCPG
KJ173350_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JX036352_SHBs_P-RF-CD      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HQ684848_SHBs_P-RF-CB      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU385774_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079330_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377602_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FR714496_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562267_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCLG
FJ562247_SHBs_P-RF-CB      MENIASGLLGPLLVLQAGFFXLTXILTIPQSLDSWWTSLNFLGGAPACPG
EU939632_SHBs_P-RF-CB      MENIASGLPGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
EU939620_SHBs_P-RF-CB      MENIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916232_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGTTTCPG
AB195939_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF233236_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPG
HQ700526_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JX036328_SHBs_P-RF-CD      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSRDSWWTSLNFLGGAPTCPG
AY247030_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774212_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826149_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826220_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598675_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
JQ707714_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040175_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTLPQSLDSRWTSLNFLGGAPACPG
GQ377614_SHBs_P-RF-CB      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377573_SHBs_P-RF-CB      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377534_SHBs_P-RF-CB      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ562336_SHBs_P-RF-CB      MENTASGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPRCPG
FJ562317_SHBs_P-RF-CB      MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939668_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939621_SHBs_P-RF-CB      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916228_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU881995_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY123424_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
AB367400_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB300369_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AB198084_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU717211_SHBs_P-RF-CB      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPD
KJ173329_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KC774344_SHBs_P-RF-CB      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU787444_SHBs_P-RF-CB      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939565_SHBs_P-RF-CB      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939577_SHBs_P-RF-CB      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377516_SHBs_P-RF-CB      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377520_SHBs_P-RF-CB      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377544_SHBs_P-RF-CB      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377549_SHBs_P-RF-CB      MENIASGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377613_SHBs_P-RF-CB      MENIASGLLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377626_SHBs_P-RF-CB      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377634_SHBs_P-RF-CB      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KM213033_SHBs_P-RF-CB      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774349_SHBs_P-RF-CB      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774341_SHBs_P-RF-CB      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774332_SHBs_P-RF-CB      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040174_SHBs_P-RF-CB      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774263_SHBs_P-RF-CB      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367393_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386649_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787446_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPA
FJ787480_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377627_SHBs_P-RF-CD      MENXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377607_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377581_SHBs_P-RF-CB      MENTXSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377590_SHBs_P-RF-CB      MENXXSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377596_SHBs_P-RF-CB      MENIASGLLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
Y18857_SHBs_P-RF-CB        MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ803803_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ717816_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ717815_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173358_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774234_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774183_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX661486_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652155_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079271_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377565_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715345_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
EU939581_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774324_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040142_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ803804_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826146_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826147_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826148_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB033557_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB049609_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB642096_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF411409_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY040627_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY167095_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EF494376_SHBs_P-RF-CA      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU522070_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939589_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939623_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386585_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386593_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715347_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFQGGAPTCPG
FJ715346_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFQGGAPTCPG
JQ040148_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLXTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX026887_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
Y18856_SHBs_P-RF-CB        MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK321265_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG893561_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG893559_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG893555_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGEAPTCPG
MG893554_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KY363263_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY363262_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964317_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964316_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964315_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964314_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964313_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964312_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964311_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964310_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964309_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964308_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964307_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964306_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964305_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964304_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964303_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964010_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964009_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964008_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964007_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964006_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964005_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964003_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964001_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963999_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963998_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963995_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963994_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963993_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963991_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963990_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963944_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963943_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963942_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963941_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963940_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963939_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963938_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963936_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963935_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963934_SHBs_P-RF-CB      MENTTSGFLVPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963933_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963932_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963931_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963930_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013843_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013816_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013806_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173330_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173322_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173320_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173300_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173299_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173280_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173279_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774328_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774323_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774322_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774317_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774258_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774246_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774230_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774222_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774201_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774198_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774186_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX661498_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
JX661494_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX661487_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX661485_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HQ700547_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377594_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377556_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377522_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715414_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715413_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715412_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715411_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715384_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562314_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562287_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562277_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562229_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562227_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386646_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLXSWWTSLNFLGGAPTCPG
FJ562226_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715385_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715387_SHBs_P-RF-CB      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF053160_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KJ803753_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514432_SHBs_P-RF-CD      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514447_SHBs_P-RF-CD      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826141_SHBs_P-RF-CB      MESTTSGFLGPLLVYRAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF925370_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ803798_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ410506_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801476_SHBs_P-RF-CG      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB031265_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ924618_SHBs_P-RF-CB      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939629_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826150_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCRG
KC793112_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTPVCLG
JQ801477_SHBs_P-RF-BC      MENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
EU660227_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KX774505_SHBs_P-RF-BC      MENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JQ412091_SHBs_P-RF-BC      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
GQ377635_SHBs_P-RF-BC      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
MG826145_SHBs_P-RF-BC      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MH746811_SHBs_P-RF-BC      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MH746813_SHBs_P-RF-BC      MENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MH746812_SHBs_P-RF-BC      MENIASGLLGPLLVLPAGFFLLTNILTIPQSLDSRWTSLNFLGGTPVCLG
HQ684849_SHBs_P-RF-BC      MENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGETPVCLG
GQ377595_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPECLG
MK052968_SHBs_P-RF-BD      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KP148337_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ410497_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPVCLG
KC774414_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KC774364_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGTPVCLG
KC774178_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGTPVCLG
EU939627_SHBs_P-RF-BC      MENIASGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXTPVCLG
GQ377630_SHBs_P-RF-BC      MENTASGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTPVCLG
MK052970_SHBs_P-RF-BD      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MK052967_SHBs_P-RF-BD      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
GU079357_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
MG826358_SHBs_P-RF-BC      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
                                     * :   *     : .*::  .      *         *  

KJ803822_SHBs_P-RF-CB      QNSQSPTSNHSPTCCPPTCPGYHWRCLRGFIIFLLIPVTCLIFLLVLLDY
EU939631_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KX660685_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRRMCVRRFIIFLFILLLCLIFLLVLPDY
AY161145_SHBs_P-RF-AD      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIYLFILHACLIFLLVLLDY
AY161146_SHBs_P-RF-AD      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIYLFILHACLIFLLVLLDY
HE981179_SHBs_P-RF-FG      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY303879_SHBs_P-RF-ED      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161806_SHBs_P-RF-EA      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB195940_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDY
AB195941_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDY
JQ707474_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707432_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707421_SHBs_P-RF-GA      LNSQSPTSNHSPISCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707430_SHBs_P-RF-GA      LNSQSPTSNHSPISCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707424_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707441_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707445_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFITFLFILLLCLIFLLVLLDY
JQ707448_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707450_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707463_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707465_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707467_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707473_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707475_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF219922_SHBs_P-RF-GH      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707426_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX765835_SHBs_P-RF-GC      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ361772_SHBs_P-RF-GC      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU833889_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ272887_SHBs_P-RF-GF      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ272886_SHBs_P-RF-GF      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP274926_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB933279_SHBs_P-RF-AG      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB933280_SHBs_P-RF-AG      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB933281_SHBs_P-RF-AG      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG826151_SHBs_P-RF-BC      QNSQSQISNHSPTCCPPTCPGYRWMYLRRSIIFLFILLLCLIFLLVLLDY
GQ331048_SHBs_P-RF-AE      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161788_SHBs_P-RF-AE      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
KP148442_SHBs_P-RF-BC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ586803_SHBs_P-RF-AF      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161753_SHBs_P-RF-AE      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997620_SHBs_P-RF-DA      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP148450_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP148441_SHBs_P-RF-GC      QNSQSPTSNHSPISCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY161141_SHBs_P-RF-AD      QNSQSPTSNHSPTSCAPICTGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB453985_SHBs_P-RF-AC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707460_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707459_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707458_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707457_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707456_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY161147_SHBs_P-RF-DA      QNSQSPTSNHSPTSWAPTCPGYRWMCLRRFIIFRFILLLCLIFLLVLLDY
KF214680_SHBs_P-RF-GC      QNSQSPTCNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM146131_SHBs_P-RF-AD      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU833890_SHBs_P-RF-GA      LNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF103282_SHBs_P-RF-AD      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY236161_SHBs_P-RF-DA      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY230120_SHBs_P-RF-DA      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY161140_SHBs_P-RF-AD      QNSQSPTSNHSPTSCAPICTGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB933282_SHBs_P-RF-AG      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925386_SHBs_P-RF-AC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF440022_SHBs_P-RF-AG      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF440019_SHBs_P-RF-AG      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439776_SHBs_P-RF-AG      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF103283_SHBs_P-RF-AD      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF297619_SHBs_P-RF-DA      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB194949_SHBs_P-RF-AE      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP148586_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP148449_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FR714490_SHBs_P-RF-GB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925404_SHBs_P-RF-AC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF488705_SHBs_P-RF-AD      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ586810_SHBs_P-RF-AF      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HF571060_SHBs_P-RF-AE      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
GQ161837_SHBs_P-RF-AE      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
GQ161838_SHBs_P-RF-AE      QNSQSPTSNHSPXSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
AY233277_SHBs_P-RF-AC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB933283_SHBs_P-RF-AG      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB222708_SHBs_P-RF-AD      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU185780_SHBs_P-RF-AD      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514345_SHBs_P-RF-AD      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC012653_SHBs_P-RF-AD      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707461_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707462_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707464_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707466_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707468_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707469_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707470_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707471_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707472_SHBs_P-RF-GA      LNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225963_SHBs_P-RF-DG      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849500_SHBs_P-RF-DG      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470871_SHBs_P-RF-GC      QNSQSPTSNPSLTSCPPICPGYRWMCLQRFIIFLFILLLCLIFLLVLLDY
KY471004_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470858_SHBs_P-RF-GC      QNSQSPTSNPSLTSCPPICPGYRWMCLQRFIIFLFILLLCLIFLLVLLDY
FJ882613_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF440021_SHBs_P-RF-AG      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023666_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU835240_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF464099_SHBs_P-RF-AG      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ882610_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ882614_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023659_SHBs_P-RF-BC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLXDY
FJ023662_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC172106_SHBs_P-RF-GB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470997_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470998_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470999_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY471000_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY471001_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY471002_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY471003_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY471005_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY471006_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY471007_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF214656_SHBs_P-RF-AC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU833891_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023664_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023665_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023667_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023668_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ882618_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ882617_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ882612_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023670_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ023673_SHBs_P-RF-GC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY341335_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF440011_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
AF297620_SHBs_P-RF-DA      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFFLVLLDY
KU711666_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349221_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514421_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ586811_SHBs_P-RF-DF      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX898690_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439994_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF439995_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF439996_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF439998_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF439999_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF440000_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF440001_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF440002_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF440003_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF440004_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF440005_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF440006_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF440007_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF440008_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF440009_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF440010_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF440012_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF440013_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF440014_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF440015_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF440017_SHBs_P-RF-DA      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
GQ205379_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB033558_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB210819_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ344117_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ315779_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ315780_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ205377_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ205378_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ205386_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ205387_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664915_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGCRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664925_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664933_SHBs_P-RF-DA      QNSQSPTSNHSPTSCPPTCPGCRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664934_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664935_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664940_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX898686_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX898687_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX898688_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX898698_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX898699_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875338_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875339_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366505_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU668440_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF488699_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF967563_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U95551_SHBs_P-RF-DE        QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF192840_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
HQ700503_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700536_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774458_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF192833_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KF192836_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KF192837_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KF192838_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KF192839_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KF192841_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
MF618347_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
HQ700519_SHBs_P-RF-CB      QNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIVLFILLLCLIFLLVLLDY
KY470853_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700505_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562223_SHBs_P-RF-CD      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700518_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925382_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP148352_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF828936_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ032337_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWVCLRRFIIFLFILLLCLTFLLVLLDY
KJ410520_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB014375_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ803785_SHBs_P-RF-CB      QNSQSPTSNHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AP011104_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AP011105_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT003704_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC416040_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF828933_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF828934_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF828935_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF828938_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ475335_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562305_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU939606_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU939551_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU872014_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU871999_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
EU871988_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
EU871981_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
EU871983_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
EU871984_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
EU871985_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
EU871986_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
EU871987_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
EU871989_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
EU871990_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
EU871991_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
EU871992_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
EU871993_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
EU871994_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
EU871995_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
EU871996_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
AB367419_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB195950_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB195951_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB195956_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB195957_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ386586_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964351_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470893_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ173349_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF330110_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG826142_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ173325_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM875422_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB195955_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF461361_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY123041_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU589339_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU871997_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205152_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRSMCLRRFIIFLFILLLCLIFLLVLLDY
EU872015_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU916239_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU916240_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFPFILLLCLIFLLVLLDY
EU916241_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ386581_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ386635_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562271_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377560_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILQLCLIFLLVLLDC
GQ377611_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC279267_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC279266_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC279265_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC279264_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC279263_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC458432_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY881840_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963883_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963870_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963869_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963868_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963867_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963866_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963865_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963864_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963863_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963862_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963861_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963860_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963859_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963858_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963857_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774307_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774305_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KC774294_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774291_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774193_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX429896_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ732168_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN400086_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF436922_SHBs_P-RF-CB      QNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377633_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM750133_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ173326_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963856_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700530_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700527_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700528_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AP011103_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700520_SHBs_P-RF-CB      QNSQSLTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700523_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700531_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700532_SHBs_P-RF-CB      QSSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB493837_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB493838_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB493840_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB493847_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ358155_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ358156_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU695744_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY363272_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY363273_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU695745_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700554_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700515_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700507_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLXVLLDY
HQ700508_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700509_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700499_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700498_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG826144_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU695746_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU695743_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDF
KU695741_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDF
HQ700462_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700485_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700557_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700560_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700580_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
X75656_SHBs_P-RF-CB        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK052976_SHBs_P-RF-BD      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
MF925402_SHBs_P-RF-BD      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM577666_SHBs_P-RF-DE      QNSQSPTSKHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349212_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIICLFILLLCLIFLLVLLDY
EF103284_SHBs_P-RF-AD      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470845_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470848_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470851_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470852_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257154_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
AB674434_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
X68292_SHBs_P-RF-DA        QNSQSPTSHHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU679954_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDX
KU679950_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDC
KF873519_SHBs_P-RF-CB      QNSQSQTSNHSXTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU679952_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMXLRHFIIFLFILLLCLIFLLVLLDY
KF873511_SHBs_P-RF-CB      QNLQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU679956_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRXFIIFLFILLLCLIFLLVLLDY
KU679940_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873518_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873530_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KF873531_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873532_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873533_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873534_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU679945_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU679939_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873543_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873542_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873540_SHBs_P-RF-CB      QNSQSQTSNHSXTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873538_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873535_SHBs_P-RF-CB      QNSQSQTSNHSXTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873537_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873527_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873521_SHBs_P-RF-BC      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873517_SHBs_P-RF-BC      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873513_SHBs_P-RF-CB      QNXQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873515_SHBs_P-RF-CB      QNSQSQTSNHSXTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU679948_SHBs_P-RF-CB      QNSQSQTSNHXPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU679955_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU679953_SHBs_P-RF-BC      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU679944_SHBs_P-RF-BC      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU679946_SHBs_P-RF-BC      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU679958_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU679943_SHBs_P-RF-BC      QNSQSQTSNHSPTSCPPTCXGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU679942_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU679941_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873523_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
KF873524_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF873522_SHBs_P-RF-CB      QNSQSQTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925360_SHBs_P-RF-DB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF682475_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU563560_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF488702_SHBs_P-RF-DE      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF679991_SHBs_P-RF-DE      RNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594767_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
DQ464167_SHBs_P-RF-DE      QNSQSPTSNHSPTSCAPTCVGYRWMCLRRFIIFLFILPVCLIFLLVLLDY
AY817513_SHBs_P-RF-DC      QNSQFPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257204_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664929_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925396_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB188243_SHBs_P-RF-DE      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY057948_SHBs_P-RF-DC      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM750145_SHBs_P-RF-DC      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
X80925_SHBs_P-RF-DE        QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925389_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT991419_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM359442_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDS
JX036354_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYHWMCLRRFIIFLFILLLCLIFLLVLLDY
JX036350_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
J02202_SHBs_P-RF-DE        QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594770_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ464166_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCVGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736917_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736916_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774479_SHBs_P-RF-DC      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594771_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349207_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
AJ627221_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
MF618346_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KY629632_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470854_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470844_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX827302_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX357624_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736914_SHBs_P-RF-DE      QNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366503_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM524357_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ803771_SHBs_P-RF-DB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642160_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904397_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ478890_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY862865_SHBs_P-RF-DC      LNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY817510_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY817509_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY800249_SHBs_P-RF-DC      QNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674436_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB270535_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLLVLLDY
AB188245_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774456_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774495_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774453_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX660686_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ622864_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KY470843_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470846_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470847_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470849_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470850_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470855_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY470856_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562278_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KT991417_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KT991420_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KT991423_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
MH464835_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
MF925401_SHBs_P-RF-DB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ647349_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF192835_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JX036359_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYHWMCLRRFIIFLFILLLCLIFLLVLLDY
JX036355_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX036348_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX036347_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLALLDY
JX036332_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN688715_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754613_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700492_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
FJ904430_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFXIFLFXLLLCLIFLLVLLDY
FJ904417_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
FJ904416_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
FJ904409_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTWPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ464164_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCVGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ464165_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCVGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ478886_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904394_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX660680_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX660674_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX357628_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX357626_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774498_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774481_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRSMCLRRFIIFLFILLLCLIFLLVLLDY
KC774476_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774454_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774431_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774420_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642152_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642141_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF491451_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700534_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904425_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904407_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904398_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904405_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904414_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVHLDY
AB270538_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674412_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX357627_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ991753_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX357631_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP288875_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM386676_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ470892_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRLMYLRRFIIFLFILLLCLIFLLVLLDY
KF471643_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX036330_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642139_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040803_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN594769_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904436_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904447_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700494_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257174_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP168421_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY817512_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ478898_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU787435_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925397_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925384_SHBs_P-RF-DB      QNSQSPTSNHSPTSCPRTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ647356_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ470887_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040798_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF491456_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF491455_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700582_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ622875_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594406_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664943_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664946_SHBs_P-RF-DA      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN688717_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ687532_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX898693_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX898695_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX898696_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KR905422_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925371_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925388_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925392_SHBs_P-RF-DB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH685719_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDS
MH481861_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH481860_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH481859_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX827299_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX357641_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX357625_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT991427_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM524359_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF917451_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
KC774494_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KC774492_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774487_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774474_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774468_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774463_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774452_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774442_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774430_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774428_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF491448_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMYLRHFIIFLFILLLCLIFLLVLLDY
FJ904400_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM577665_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ622876_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB330368_SHBs_P-RF-DA      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB033559_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCAGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB048702_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLCLIFLLVLLDY
AB583679_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674432_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674433_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674504_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ627217_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494716_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY233293_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY233295_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY373430_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY817511_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY817515_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY862864_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY862866_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ111987_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ478887_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ478889_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ478892_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
DQ478897_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF103285_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594435_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594436_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU787434_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349241_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562263_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ622866_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
FJ622872_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB048703_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904437_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY670781_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPXTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ622865_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX357634_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774490_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257189_SHBs_P-RF-DE      QNSQFPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700540_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700538_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257206_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257207_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257191_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX660684_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRRMCLRRFIIFLFILLLCLIFLLVLLDY
KJ470898_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ470897_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257210_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257164_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754616_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF491449_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700584_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700583_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700581_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700541_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700539_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700537_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILLLCLIFLLVLLDY
HQ700535_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700533_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700525_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCAGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700524_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCAGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700501_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700500_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
HQ700497_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700493_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM750150_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM750149_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM750148_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM750147_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM750146_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM750144_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM750143_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM750142_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU177079_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ183486_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ161754_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904444_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904442_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904441_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904440_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904408_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904406_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904404_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904403_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDC
FJ904396_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692536_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774478_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774480_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366492_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
X65259_SHBs_P-RF-DA        QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK052969_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK052957_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MH481862_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH481858_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH464852_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH464851_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH464850_SHBs_P-RF-DA      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH464846_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX660689_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX660677_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX660675_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX357636_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX357635_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX357633_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX357632_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX357630_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX357629_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX357623_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX354997_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736923_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736922_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736921_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU519423_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU519422_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT991424_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366504_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995112_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP276256_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP276255_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP276254_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP276253_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP168418_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP168417_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP168416_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606751_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606750_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606741_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM577667_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM577664_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM577663_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ647351_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ470891_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ470890_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ470888_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ470886_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ470884_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF779353_SHBs_P-RF-DA      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170740_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774499_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774497_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774493_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774489_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774488_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774486_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774485_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774484_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774483_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774482_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774475_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774472_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774471_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774470_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774466_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774461_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774457_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774455_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774450_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774449_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRLMYLRRFIIFLFILLLCLIFLLVLVDY
KC774448_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KC774447_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KC774443_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774439_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774435_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774434_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774433_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774432_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774426_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774425_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774424_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774423_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774422_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849628_SHBs_P-RF-DA      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX429898_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN688689_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642137_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257216_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTXPGYRWMCXRRFIIFLFILLLCLIFLLVLLDY
JN642127_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ622874_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700579_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700585_SHBs_P-RF-DE      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF436919_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLICLLVLLDY
KF053186_SHBs_P-RF-BC      QNSQFQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KJ803778_SHBs_P-RF-BC      QNSQFQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ751342_SHBs_P-RF-CB      QNSQSPTSSHSPTSCPQICPGYRWMCLRRFIIFLCILLPCLISLLVLLDY
KF053188_SHBs_P-RF-CB      QNLQSPTSNHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ803782_SHBs_P-RF-CB      QNLQSPTSNHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ717800_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCHGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KJ803791_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCHGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KF053166_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KJ803827_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JF436923_SHBs_P-RF-CB      QNSQPQISSHSPTCCPPICPGYRWMCLRRFVIFLFILLLCLIFLLVLLDY
KX777261_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FJ386674_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU882006_SHBs_P-RF-CB      QNSQSPTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EF494378_SHBs_P-RF-CA      QNSQSPTSNHLLTSCPPTCPGYRWMCLRRFIIFLFVLLLCLIFLLVLLDY
KX777355_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX504540_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
JX036329_SHBs_P-RF-CD      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFIPLLCLIFLLVLLDY
FJ562328_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB241109_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ751336_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY302989_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY361539_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX096713_SHBs_P-RF-CA      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700542_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377592_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ751277_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HE652157_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU357843_SHBs_P-RF-CB      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF053179_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
KJ803772_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
FR822117_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFSLGLLDH
FR821810_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
FR821925_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HE652175_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KX777382_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KX777386_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU589337_SHBs_P-RF-CB      RNSQSQTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLLALLDY
FJ032343_SHBs_P-RF-CB      RNSQSQTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLLALLDY
MH094410_SHBs_P-RF-BC      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ386643_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
AP011102_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
M38454_SHBs_P-RF-CB        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC315400_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ040146_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700521_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377564_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ751340_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562302_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774188_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLWVLLDY
FJ751609_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX036358_SHBs_P-RF-DC      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ027310_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIISLFILLLCLIFLLVLLDY
GQ377604_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562294_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVEY
EU939630_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU939547_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU919167_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU919166_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ089798_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AP011108_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB493842_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB367800_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB105172_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HE652156_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLTLLLVLLDY
FR822069_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVHPDY
AY206374_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
KU695742_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLALLDY
KJ803802_SHBs_P-RF-CB      QNLQSPTSNHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ717832_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ717814_SHBs_P-RF-CB      QNLQSPTSNHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ173350_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
JX036352_SHBs_P-RF-CD      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ684848_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU385774_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU079330_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377602_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FR714496_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562267_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562247_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU939632_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
EU939620_SHBs_P-RF-CB      QNSQSPTSSHSPTSCPPICPGYRWICLRRFIIFLFILLLCLIFLLVLLDY
EU916232_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB195939_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF233236_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700526_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX036328_SHBs_P-RF-CD      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY247030_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774212_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
MG826149_SHBs_P-RF-CB      QNSQSPTSNPSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG826220_SHBs_P-RF-CB      QNSQSPTSNPSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ598675_SHBs_P-RF-CB      QNLQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707714_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ040175_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIXFLXILLLCLIFLLVLLDY
GQ377614_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377573_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377534_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLLFLLVLLDY
FJ562336_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562317_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU939668_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU939621_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFIVLLCLIFLLVLLDY
EU916228_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU881995_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFLIFLFILLLCLIFLLVLLDY
AY123424_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB367400_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB300369_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB198084_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU717211_SHBs_P-RF-CB      QNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ173329_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774344_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU787444_SHBs_P-RF-CB      PNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU939565_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
EU939577_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377516_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377520_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377544_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377549_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377613_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377626_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377634_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM213033_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774349_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774341_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774332_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ040174_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774263_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB367393_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ386649_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ787446_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ787480_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377627_SHBs_P-RF-CD      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377607_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377581_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377590_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377596_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
Y18857_SHBs_P-RF-CB        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ803803_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ717816_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ717815_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ173358_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774234_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774183_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX661486_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
HE652155_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU079271_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377565_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ715345_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU939581_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774324_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ040142_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KJ803804_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG826146_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG826147_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
MG826148_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB033557_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB049609_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB642096_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF411409_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY040627_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY167095_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF494376_SHBs_P-RF-CA      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU522070_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU939589_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU939623_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
FJ386585_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ386593_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ715347_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ715346_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ040148_SHBs_P-RF-CB      XNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILXLCLIFLLVLVDY
JX026887_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
Y18856_SHBs_P-RF-CB        QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK321265_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG893561_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG893559_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG893555_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG893554_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY363263_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY363262_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964317_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964316_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964315_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964314_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964313_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964312_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964311_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964310_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964309_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964308_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964307_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964306_SHBs_P-RF-CB      QNSQSPTSNHSPTSCHPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964305_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964304_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964303_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964010_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964009_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964008_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964007_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964006_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964005_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964003_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU964001_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963999_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963998_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963995_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963994_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963993_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963991_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963990_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963944_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963943_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963942_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963941_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963940_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963939_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963938_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963936_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963935_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963934_SHBs_P-RF-CB      QNSHSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963933_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963932_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963931_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU963930_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KR013843_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KR013816_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KR013806_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ173330_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ173322_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ173320_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ173300_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ173299_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ173280_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KJ173279_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KC774328_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774323_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774322_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774317_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774258_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774246_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774230_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774222_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774201_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774198_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774186_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX661498_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX661494_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX661487_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX661485_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700547_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377594_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377556_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377522_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ715414_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ715413_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ715412_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ715411_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ715384_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562314_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562287_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562277_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562229_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562227_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ386646_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562226_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPTCPGYRWMWLRRFIIFLFILLLCLIFLLVLLDY
FJ715385_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ715387_SHBs_P-RF-CB      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF053160_SHBs_P-RF-CB      QNLQSPTSNHSLTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ803753_SHBs_P-RF-CB      QNLQSPTSNHSLTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514432_SHBs_P-RF-CD      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLXDY
JQ514447_SHBs_P-RF-CD      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLXDY
MG826141_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925370_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ803798_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ410506_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ801476_SHBs_P-RF-CG      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB031265_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ924618_SHBs_P-RF-CB      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU939629_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG826150_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPTCPGYRWMCLRRSIIFLCILLLCLIFLLVLLDY
KC793112_SHBs_P-RF-BC      QNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ801477_SHBs_P-RF-BC      QNSQSPISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU660227_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KX774505_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JQ412091_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ377635_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
MG826145_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
MH746811_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
MH746813_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
MH746812_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
HQ684849_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ377595_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
MK052968_SHBs_P-RF-BD      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KP148337_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KJ410497_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC774414_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC774364_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KC774178_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EU939627_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ377630_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
MK052970_SHBs_P-RF-BD      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
MK052967_SHBs_P-RF-BD      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU079357_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
MG826358_SHBs_P-RF-BC      QNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
                            . :   .     .      * .    .           **       : 

KJ803822_SHBs_P-RF-CB      QGMLPGCHVLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
EU939631_SHBs_P-RF-BC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAHGTSMFPSCCCTKPTDGNCTCI
KX660685_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCI
AY161145_SHBs_P-RF-AD      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
AY161146_SHBs_P-RF-AD      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
HE981179_SHBs_P-RF-FG      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AY303879_SHBs_P-RF-ED      HGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ161806_SHBs_P-RF-EA      HGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB195940_SHBs_P-RF-CB      KGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
AB195941_SHBs_P-RF-CB      KGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
JQ707474_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTSAQGTSMFPSCCCTKPTDGNCTCI
JQ707432_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCI
JQ707421_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCI
JQ707430_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCI
JQ707424_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCI
JQ707441_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCI
JQ707445_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCI
JQ707448_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCI
JQ707450_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCI
JQ707463_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSMGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCI
JQ707465_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSMGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCI
JQ707467_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCI
JQ707473_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCI
JQ707475_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTSAQGNSMFPSCCCTKPTDGNCTCI
KF219922_SHBs_P-RF-GH      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JQ707426_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
KX765835_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ361772_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
EU833889_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPSDGNCTCI
JQ272887_SHBs_P-RF-GF      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JQ272886_SHBs_P-RF-GF      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KP274926_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AB933279_SHBs_P-RF-AG      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMYPSCCCTKPTDGNCTCI
AB933280_SHBs_P-RF-AG      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMYPSCCCTKPTDGNCTCI
AB933281_SHBs_P-RF-AG      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMYPSCCCTKPTDGNCTCI
MG826151_SHBs_P-RF-BC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
GQ331048_SHBs_P-RF-AE      QGMLPVCPLIPGTTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
GQ161788_SHBs_P-RF-AE      QGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCI
KP148442_SHBs_P-RF-BC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTRPTDGNCTCI
KJ586803_SHBs_P-RF-AF      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCI
GQ161753_SHBs_P-RF-AE      QGMLPVCPLIPGSTITSTGPCRTCTTPAQGDSMFPSCCCTKPTDGNCTCI
KP997620_SHBs_P-RF-DA      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KP148450_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPTDGNCTCI
KP148441_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGSCKTCTTPAQGNSMYPSCCCTKPTDGNCTCI
AY161141_SHBs_P-RF-AD      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNRTCI
AB453985_SHBs_P-RF-AC      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JQ707460_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JQ707459_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JQ707458_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JQ707457_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JQ707456_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
AY161147_SHBs_P-RF-DA      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCI
KF214680_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGTCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
HM146131_SHBs_P-RF-AD      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
EU833890_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPTDGNCTCI
EF103282_SHBs_P-RF-AD      QGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCI
AY236161_SHBs_P-RF-DA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
AY230120_SHBs_P-RF-DA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
AY161140_SHBs_P-RF-AD      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNRTCI
AB933282_SHBs_P-RF-AG      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
MF925386_SHBs_P-RF-AC      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JF440022_SHBs_P-RF-AG      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JF440019_SHBs_P-RF-AG      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JF439776_SHBs_P-RF-AG      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
EF103283_SHBs_P-RF-AD      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
AF297619_SHBs_P-RF-DA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPSDGNCTCI
AB194949_SHBs_P-RF-AE      QGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCI
KP148586_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPTDGNCTCI
KP148449_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPTDGNCTCI
FR714490_SHBs_P-RF-GB      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPTDGNCTCI
MF925404_SHBs_P-RF-AC      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
MF488705_SHBs_P-RF-AD      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
KJ586810_SHBs_P-RF-AF      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
HF571060_SHBs_P-RF-AE      QGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCI
GQ161837_SHBs_P-RF-AE      QGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCI
GQ161838_SHBs_P-RF-AE      QGMLPVCPLIPGSTTTSTGPCRTCTTPAQGNSMFPSCCCTKPTDGNCTCI
AY233277_SHBs_P-RF-AC      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
AB933283_SHBs_P-RF-AG      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMXPSCCCTKPTDGNCTCI
AB222708_SHBs_P-RF-AD      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
EU185780_SHBs_P-RF-AD      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JQ514345_SHBs_P-RF-AD      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
KC012653_SHBs_P-RF-AD      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JQ707461_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JQ707462_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JQ707464_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JQ707466_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JQ707468_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JQ707469_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JQ707470_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JQ707471_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JQ707472_SHBs_P-RF-GA      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCI
JN225963_SHBs_P-RF-DG      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGNSMYPSCCCTKPSDGNCTCI
JX849500_SHBs_P-RF-DG      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGNSMYPSCCCTKPSDGNCTCI
KY470871_SHBs_P-RF-GC      QGMLPVCPLLPGSSTTSTGPCKICTTPAQGNSMNPSCCCTKPSDGTCTCI
KY471004_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KY470858_SHBs_P-RF-GC      QGMLPVCPLLPGSSTTSTGPCKICTTPAQGNSMNPSCCCTKPSDGNCTCI
FJ882613_SHBs_P-RF-GC      RGTLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
JF440021_SHBs_P-RF-AG      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYHSCCCTKPSDGNCTCI
FJ023666_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
EU835240_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGTCRTCTTPAQGNSMYPLCCCTKPSDRNCTCI
EF464099_SHBs_P-RF-AG      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ882610_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ882614_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023659_SHBs_P-RF-BC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023662_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KC172106_SHBs_P-RF-GB      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KY470997_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KY470998_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KY470999_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KY471000_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KY471001_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KY471002_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KY471003_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KY471005_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KY471006_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KY471007_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGNSMYPSCCCTKPSDGNCTCI
KF214656_SHBs_P-RF-AC      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPSDGNCTCI
EU833891_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023664_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023665_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023667_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023668_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ882618_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ882617_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ882612_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023670_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
FJ023673_SHBs_P-RF-GC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSMYPSCCCTKPSDGNCTCI
AY341335_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSAGPCINCTTTAQGTSMHPSCCYTKPSGRNCTCI
JF440011_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
AF297620_SHBs_P-RF-DA      QGMLPVCPLIPGSSTTSTGPCKTCMTTAQGTSMYPSCCCTKPSDGNCTCI
KU711666_SHBs_P-RF-DE      HGILPVCPLIPGSSTTSTGPCRTCTTPARGTSMYPSCCCTKPSDGNCTCI
FJ349221_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
JQ514421_SHBs_P-RF-DC      HGMLPVCPLIPGSTTTSTGPCKTCTTPARGTSMYPSCCCTKPSDGNCTCI
KJ586811_SHBs_P-RF-DF      HGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
JX898690_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPLDGNCTCI
JF439994_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF439995_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF439996_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF439998_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF439999_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF440000_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF440001_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF440002_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF440003_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF440004_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF440005_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF440006_SHBs_P-RF-DE      QGMLPVCPLIPGSATTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF440007_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF440008_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF440009_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF440010_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF440012_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF440013_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
JF440014_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF440015_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
JF440017_SHBs_P-RF-DA      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCIKPSDGNCTCI
GQ205379_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
AB033558_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
AB210819_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
AJ344117_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
DQ315779_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
DQ315780_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMNPSCCCTKPSDGNCTCI
GQ205377_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
GQ205378_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
GQ205386_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
GQ205387_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
JN664915_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMNTAQGTSMYPSCCCTKPSDGNCTCI
JN664925_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
JN664933_SHBs_P-RF-DA      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
JN664934_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
JN664935_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
JN664940_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
JX898686_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
JX898687_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
JX898688_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
JX898698_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
JX898699_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
KC875338_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
KC875339_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCYCTKPSDGNCTCI
KT366505_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
KU668440_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
MF488699_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMLPSCCCTKPSDGNCTCI
MF967563_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
U95551_SHBs_P-RF-DE        QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
KF192840_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGTCRTCMTPARGTSMYPSCCCTKPSDGNCTCI
HQ700503_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPARGTSMYPSCCCTKPSDGNCTCI
HQ700536_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPARGTSMYPSCCCTKPSDGNCTCI
KC774458_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPARGTSMYPSCCCTKPSDGNCTCI
KF192833_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGTCRTCTTPARGTSMYPSCCCTKPSDGNCTCI
KF192836_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGTCRTCTTPARGTSMYPSCCCTKPSDGNCTCI
KF192837_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGTCRTCTTPARGTSMYPSCCCTKPSDGNCTCI
KF192838_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGTCRTCTTPARGTSMYPSCCCTKPSDGNCTCI
KF192839_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGTCRTCTTPARGTSMYPSCCCTKPSDGNCTCI
KF192841_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGTCRTCTTPARGTSMYPSCCCTKPSDGNCTCI
MF618347_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGTCRTCTTPARGTSMYPSCCCTKPSDGNCTCI
HQ700519_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KY470853_SHBs_P-RF-DC      QGMLPVCPLLPGNSTTSTGSCRTCTTPAQRNSTYPSCCCTKPSDGNCTCI
HQ700505_SHBs_P-RF-CB      QGMLPVCPLLPGTTTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
FJ562223_SHBs_P-RF-CD      QGMLPVCPLLPGTSTTSTGPCKTCTNPANGTSMFPSCCCTKPSDGNCTCI
HQ700518_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPALGTSMFPSCCCTKPSDGNCTCI
MF925382_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
KP148352_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGASMFPSCCCTKPSDGNCTCI
JF828936_SHBs_P-RF-CB      RGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCI
FJ032337_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KJ410520_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCI
AB014375_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KJ803785_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
AP011104_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
AP011105_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KT003704_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCI
LC416040_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
JF828933_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCI
JF828934_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCI
JF828935_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCI
JF828938_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCTTCTIPAQGTSMFPSCCCTKPSDGNCTCI
GQ475335_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
FJ562305_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
EU939606_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
EU939551_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
EU872014_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
EU871999_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
EU871988_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
EU871981_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
EU871983_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
EU871984_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
EU871985_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
EU871986_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
EU871987_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
EU871989_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
EU871990_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
EU871991_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
EU871992_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
EU871993_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
EU871994_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
EU871995_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
EU871996_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
AB367419_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
AB195950_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
AB195951_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
AB195956_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
AB195957_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
FJ386586_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU964351_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KY470893_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KJ173349_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
AF330110_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTXPAQGTSMFPSCCCTKPSDGNCTCI
MG826142_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDRNCTCI
KJ173325_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSKGPCKTCTIPAQGTYMFPSCCCTKPSDRNCTCI
KM875422_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDANCTCI
AB195955_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
AF461361_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
AY123041_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
EU589339_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMLPSCCCTKPSDGNCTCI
EU871997_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
AB205152_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDXNCTCI
EU872015_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
EU916239_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
EU916240_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
EU916241_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
FJ386581_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
FJ386635_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
FJ562271_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTVPAQGTSMYPSCCCTKPSDGNCTCI
GQ377560_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
GQ377611_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
LC279267_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
LC279266_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
LC279265_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
LC279264_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
LC279263_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
LC458432_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCRTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KY881840_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU963883_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU963870_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU963869_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU963868_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU963867_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU963866_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU963865_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU963864_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU963863_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU963862_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQRTPMFPSCCCKKPSDGNCTCI
KU963861_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU963860_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU963859_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU963858_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU963857_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KC774307_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KC774305_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KC774294_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KC774291_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KC774193_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
JX429896_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
JQ732168_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
JN400086_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
JF436922_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
GQ377633_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
HM750133_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KJ173326_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU963856_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700530_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700527_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
HQ700528_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
AP011103_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700520_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700523_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700531_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700532_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
AB493837_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
AB493838_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
AB493840_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
AB493847_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
GQ358155_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
GQ358156_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU695744_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KY363272_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KY363273_SHBs_P-RF-CB      QGMLPVCPLLPGTPTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU695745_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700554_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700515_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700507_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700508_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700509_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700499_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700498_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
MG826144_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU695746_SHBs_P-RF-CB      QGMLPVCPLLPGTTTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU695743_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KU695741_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700462_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700485_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700557_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700560_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
HQ700580_SHBs_P-RF-CB      QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
X75656_SHBs_P-RF-CB        QGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
MK052976_SHBs_P-RF-BD      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCI
MF925402_SHBs_P-RF-BD      QGMLPVCPLIPGSSNTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCI
KM577666_SHBs_P-RF-DE      QGMLPVCPLIPRNSTTSTGPCRTCTTPAQGTSMYLSCCCTKPSDGNCTCI
FJ349212_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCCCTKPSDGNCTCI
EF103284_SHBs_P-RF-AD      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPMDGNCTCI
KY470845_SHBs_P-RF-DC      QGMLPVCPLLPGNSTTSTGPCRTCTTPAQRTSTYPSCCCTKPSDGNCTCI
KY470848_SHBs_P-RF-DC      QGMLPVCPLLPGNSTTSTGPCRTCTTPAQRTSTYPSCCCTKPSDGNCTCI
KY470851_SHBs_P-RF-DC      QGMLPVCPLLPGNSTTSTGPCRTCTTPAQRTSTYPSCCCTKPSDGNCTCI
KY470852_SHBs_P-RF-DC      QGMLPVCPLLPGNSTTSTGPCRTCTTPAQRTSTYPSCCCTKPSDGNCTCI
JN257154_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSSFPSCCCTKPSDGNCTCI
AB674434_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGTCRACTTPAQGTSMYPSCCCTKPSDGNCTCI
X68292_SHBs_P-RF-DA        QGMLPVCPLIPGTSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KU679954_SHBs_P-RF-CB      HGMLPVCPLLXGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDXNCTCI
KU679950_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873519_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KU679952_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873511_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KU679956_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCXKPSDGNCTCI
KU679940_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873518_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873530_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873531_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873532_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873533_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873534_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KU679945_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KU679939_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873543_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873542_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873540_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873538_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873535_SHBs_P-RF-CB      QGMLPVCPLLPGSTTXSTGPCRTCTXTAQGTSMXPSCCCTKPSDXNCTCI
KF873537_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873527_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873521_SHBs_P-RF-BC      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873517_SHBs_P-RF-BC      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873513_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873515_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KU679948_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQXTSMFPSCCCTKPSDGNCTCI
KU679955_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KU679953_SHBs_P-RF-BC      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KU679944_SHBs_P-RF-BC      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KU679946_SHBs_P-RF-BC      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KU679958_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KU679943_SHBs_P-RF-BC      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KU679942_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KU679941_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873523_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873524_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
KF873522_SHBs_P-RF-CB      QGMLPVCPLLPGSTTTSTGPCRTCTITAQGTSMFPSCCCTKPSDGNCTCI
MF925360_SHBs_P-RF-DB      QGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCI
MF682475_SHBs_P-RF-DC      QGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMSPSCCCTKPSDGNCTCI
GU563560_SHBs_P-RF-DE      RGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
MF488702_SHBs_P-RF-DE      PGMLPVCPIIPGSSTTSKGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KF679991_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FN594767_SHBs_P-RF-DE      QGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ464167_SHBs_P-RF-DE      QGMLPAGPLIPGSSTTSTGPCRTCTTPAQRTSMYPSCCCTKPSDGNCTCI
AY817513_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDRNCTCI
JN257204_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCI
JN664929_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCI
MF925396_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCI
AB188243_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AY057948_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HM750145_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
X80925_SHBs_P-RF-DE        QGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCI
MF925389_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KT991419_SHBs_P-RF-DC      QGMLPVCPLILGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KM359442_SHBs_P-RF-DE      RGMLPVCPQIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JX036354_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JX036350_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
J02202_SHBs_P-RF-DE        QGMLPVCPLIPGSSTTSTGSCRTCTTPAQGISMYPSCCCTKPSDGNCTCI
FN594770_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGNSTYPSCCCIKPSDGNCTCI
DQ464166_SHBs_P-RF-DE      QGMLPAGPLIPGSSTTSTGPCRTCTTPAQRTSMYPSCCCTKPSDGNCTCI
KU736917_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRSCTTPAQGTSMYPSCCCTKPSDGNCTCI
KU736916_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRSCTTPAQGTSMYPSCCCIKPSDGNCTCI
KC774479_SHBs_P-RF-DC      HGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FN594771_SHBs_P-RF-DE      QGMLPVCPLIPESSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCI
FJ349207_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMYPSCCCTKPSDGNCTCI
AJ627221_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCMTTAHGTSMYPSCCCTKPSDGNCTCI
MF618346_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGTCRTCTAPARGTSMYPSCCCTKPSDGNCTCI
KY629632_SHBs_P-RF-DC      QGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KY470854_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQNISMYPSCCCTKPSAGNCTCI
KY470844_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQNTSMYPSCCCTKPSAGNCTCI
KX827302_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX357624_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KU736914_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRSCTTPAQGTSMYPSCCCTKPSDGNCTCI
KT366503_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSIYPSCCCTKPSDGNCTCI
KM524357_SHBs_P-RF-DE      RGMLPVCPLIPRSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCI
KJ803771_SHBs_P-RF-DB      QGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCI
JN642160_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCI
FJ904397_SHBs_P-RF-DE      QGMLPVCPLLPGSTTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
DQ478890_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AY862865_SHBs_P-RF-DC      QGMLPVCPLIPGSSTNSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AY817510_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGPSMYPSCCCTKPSDGNCTCI
AY817509_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AY800249_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AB674436_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AB270535_SHBs_P-RF-DC      QGMLPVCPLLPGTSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AB188245_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774456_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774495_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774453_SHBs_P-RF-DC      QGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX660686_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSEGNCTCI
FJ622864_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTXPAQGTSMYPSCCCTKPSDGNCTCI
KY470843_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQNTSMYPSCCCTKPSVGNCTCI
KY470846_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQNTSMYPSCCCTKPSVGNCTCI
KY470847_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQNTSMYPSCCCTKPSVGNCTCI
KY470849_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQNTSMYPSCCCTKPSVGNCTCI
KY470850_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQNTSMYPSCCCTKPSVGNCTCI
KY470855_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQNTSMYPSCCCTKPSVGNCTCI
KY470856_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQNTSMYPSCCCTKPSAGNCTCI
FJ562278_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KT991417_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KT991420_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KT991423_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
MH464835_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
MF925401_SHBs_P-RF-DB      QGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCI
KJ647349_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KF192835_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGTCRTCTTPARGTSMYPSCCCTKPSDGNCTCI
JX036359_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JX036355_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKSTDGNCSCI
JX036348_SHBs_P-RF-DC      QGMLPVCPLIPGSSTSSTGPCRTCTTPAQGTSMYPSCCCTKPTDGNCTCI
JX036347_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JX036332_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPTDGNCTCI
JN688715_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JF754613_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCI
HQ700492_SHBs_P-RF-DE      QGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904430_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904417_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904416_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904409_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
DQ464164_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
DQ464165_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
DQ478886_SHBs_P-RF-DC      QGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904394_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX660680_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX660674_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX357628_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX357626_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774498_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774481_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774476_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774454_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774431_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774420_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JN642152_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JN642141_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JF491451_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700534_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904425_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904407_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904398_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904405_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904414_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AB270538_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AB674412_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX357627_SHBs_P-RF-DE      QGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
DQ991753_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX357631_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KP288875_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KM386676_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KJ470892_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCI
KF471643_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JX036330_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMHPSCCCTKPSDGNCTCI
JN642139_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JN040803_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FN594769_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904436_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904447_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700494_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JN257174_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KP168421_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AY817512_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCI
DQ478898_SHBs_P-RF-DC      QGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCI
EU787435_SHBs_P-RF-DC      QGMLPVCPLIPGSPTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCI
MF925397_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
MF925384_SHBs_P-RF-DB      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCI
KJ647356_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCKTCTTPVQGTSMFPSCCCTKPSDGNCTCI
KJ470887_SHBs_P-RF-DE      HGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSXYPSCCCTKPSDGNCTCI
JN040798_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMNPSCCCTKPSGGNCTCI
JF491456_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JF491455_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRACTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700582_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ622875_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDRNCTCI
EU594406_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCI
JN664943_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCI
JN664946_SHBs_P-RF-DA      QGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCI
JN688717_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCI
JQ687532_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSAGPCRTCTTTAQGTSMYPSCCCTKPSDGNCTCI
JX898693_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPYCCCTKPSDGNCTCI
JX898695_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPYCCCTKPSDGNCTCI
JX898696_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTTAQGTSMYPYCCCTKPSDGNCTCI
KR905422_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCI
MF925371_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCI
MF925388_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCI
MF925392_SHBs_P-RF-DB      QGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCCCTKPSDGNCTCI
MH685719_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCI
MH481861_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
MH481860_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
MH481859_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX827299_SHBs_P-RF-DE      RGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX357641_SHBs_P-RF-DE      QGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPSDGNCTCI
KX357625_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KT991427_SHBs_P-RF-DC      QGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KM524359_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KF917451_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774494_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCI
KC774492_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCI
KC774487_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMYPSCCCTKPSDGNCTCI
KC774474_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774468_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCI
KC774463_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCI
KC774452_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774442_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQRTSMYPSCCCTKPSDGNCTCI
KC774430_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCI
KC774428_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPLDGNCTCI
JF491448_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMYPSCCCTKPSDGNCTCI
FJ904400_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KM577665_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ622876_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGTCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AB330368_SHBs_P-RF-DA      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AB033559_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AB048702_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AB583679_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AB674432_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AB674433_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AB674504_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AJ627217_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AM494716_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSRGPCRTCTTPAQGTSMHPSCCCTKLSDGNCTCI
AY233293_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AY233295_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AY373430_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AY817511_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AY817515_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AY862864_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AY862866_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
DQ111987_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
DQ478887_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
DQ478889_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
DQ478892_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
DQ478897_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
EF103285_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
EU594435_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
EU594436_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
EU787434_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ349241_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ562263_SHBs_P-RF-DC      QGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ622866_SHBs_P-RF-DC      QGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ622872_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
AB048703_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904437_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KY670781_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ622865_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAHGTSMYPSCCCTKPSDGNCTCI
KX357634_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774490_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JN257189_SHBs_P-RF-DE      QGMLPVCPLXPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700540_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700538_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JN257206_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JN257207_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JN257191_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX660684_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KJ470898_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KJ470897_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMHPSCCCTKPSDGNCTCI
JN257210_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JN257164_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JF754616_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JF491449_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700584_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700583_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700581_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700541_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700539_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700537_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700535_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQRTSMYPSCCCTKPSDGNCTCI
HQ700533_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCIKPSDGNCTCI
HQ700525_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700524_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700501_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700500_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700497_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700493_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSEGNCTCI
HM750150_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HM750149_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HM750148_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HM750147_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HM750146_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HM750144_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMNPSCCCTKPSDGNCTCI
HM750143_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HM750142_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
GU177079_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
GQ183486_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
GQ161754_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904444_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904442_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904441_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCI
FJ904440_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904408_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904406_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904404_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ904403_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCTKPSDGNCTCI
FJ904396_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ692536_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774478_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774480_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KT366492_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
X65259_SHBs_P-RF-DA        QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
MK052969_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
MK052957_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
MH481862_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
MH481858_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
MH464852_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
MH464851_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
MH464850_SHBs_P-RF-DA      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
MH464846_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX660689_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX660677_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX660675_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX357636_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX357635_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX357633_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX357632_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX357630_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX357629_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX357623_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KX354997_SHBs_P-RF-DC      QGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KU736923_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KU736922_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KU736921_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KU519423_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KU519422_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KT991424_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KT366504_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KP995112_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KP276256_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KP276255_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KP276254_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KP276253_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KP168418_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KP168417_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KP168416_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KM606751_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KM606750_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KM606741_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KM577667_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KM577664_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KM577663_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KJ647351_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KJ470891_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KJ470890_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KJ470888_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KJ470886_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KJ470884_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KF779353_SHBs_P-RF-DA      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KF170740_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774499_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774497_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774493_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774489_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774488_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774486_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774485_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774484_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774483_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774482_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774475_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774472_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774471_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774470_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774466_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGSCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774461_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774457_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774455_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774450_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774449_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774448_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSAGNCTCI
KC774447_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774443_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774439_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774435_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774434_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774433_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774432_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774426_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774425_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774424_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774423_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
KC774422_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JX849628_SHBs_P-RF-DA      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JX429898_SHBs_P-RF-DC      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JN688689_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JN642137_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JN257216_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGXCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JN642127_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
FJ622874_SHBs_P-RF-DC      QGMLPVCPLLPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700579_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
HQ700585_SHBs_P-RF-DE      QGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCI
JF436919_SHBs_P-RF-CB      KGMLPVCPLLPGTSTTSMGPCKTCTTPAQGTSMFPSCCCTKPSDGNCTCI
KF053186_SHBs_P-RF-BC      QGMFPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCI
KJ803778_SHBs_P-RF-BC      QGMFPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCI
FJ751342_SHBs_P-RF-CB      QGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCI
KF053188_SHBs_P-RF-CB      QGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCI
KJ803782_SHBs_P-RF-CB      QGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSLFPSCCCTKPTDGNCTCI
KJ717800_SHBs_P-RF-CB      QGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCI
KJ803791_SHBs_P-RF-CB      QGMLPVCPLIPGTSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCI
KF053166_SHBs_P-RF-BC      QGMLPVCPLIPGSSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCI
KJ803827_SHBs_P-RF-BC      QGMLPVCPLIPGSSTTSTG