HBVdb

Dataset for protein HBe of genotype all

[Download (right click)] [Edit] [Sequences] [Repertoires]

7173 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


FJ356715_HBe_P-H          -IQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ356716_HBe_C-H          -IQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB059659_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
AB116550_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPFKEFGASEELLS--
KP995113_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP995114_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KP995097_HBe_P-F          -MQLFDLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ638660_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLXGMDIDPYKEFGASLELLS--
KC494399_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN792916_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS--
FJ589065_HBe_P-F          -MLLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ899150_HBe_P-F          -MELFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB365446_HBe_P-F          -SQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
X75663_HBe_P-F            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELFS--
EU185743_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ586803_HBe_P-RF-AF      -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
X75658_HBe_C-F            -MQLFHLCLII-SCLCPTVQASKLCLGWLWGMDIDPYKEFGASVELFS--
KT896494_HBe_P-F          -MQLFHLCLII-FCSCLTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
KP995115_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM590474_HBe_P-F          -MQLFHLCLII-FCSCPTAQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ657519_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ589067_HBe_P-F          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ899149_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU185744_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB036905_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB036906_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB036907_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB036909_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB036910_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB036911_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB036912_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB036913_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB036914_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB036915_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB036916_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB036917_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB036919_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB036920_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB116549_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB116551_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB116552_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF223962_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF223963_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF223964_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF223965_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY090458_HBe_C-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY090461_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY179735_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY311369_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY311370_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ776247_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ823086_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ823088_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ823089_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ823090_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ823091_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ823092_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ823093_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ823094_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ823095_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ899142_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ899143_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ899144_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ899145_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ899146_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ899147_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EF576812_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU366116_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU366118_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU670261_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ657522_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ657528_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ657529_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ709457_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ709458_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ709459_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ709460_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ709462_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ709463_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ709464_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ709465_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ709494_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HE981181_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HE981182_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM585186_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM585187_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM585188_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM585189_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM585190_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM585191_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM585192_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM585193_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM585195_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM585196_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM585197_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM585198_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM585199_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM585200_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM590471_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM590472_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM590473_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB036908_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY090459_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP995105_HBe_P-F          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ586805_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN792919_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
HM622135_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
DQ899148_HBe_P-F          -MQHFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP995109_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP995106_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP995104_HBe_P-F          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KP995101_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843225_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC494401_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ823087_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGCLWGMDIDPYKEFGASVELLS--
AB059660_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ272888_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN792920_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU366133_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM585194_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KJ843163_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX896133_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX896129_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB205010_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB064315_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
MH051987_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY476332_HBe_P-F          -MQLFHLCLVI-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY476331_HBe_P-F          -MQLFHLCLVI-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843210_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843198_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843167_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC494404_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC494396_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN792918_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
JX915624_HBe_P-H          -FLLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX896126_HBe_P-H          -MQLFHLCLII-XCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX896125_HBe_P-H          -MXLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP995120_HBe_P-F          -MLLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP718106_HBe_P-F          -MQLFHLCLII-FCSCPTVQAXKLCLGWLWDMDIDXYKEFGASXELLS--
KC494405_HBe_P-F          -MHLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX079936_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX896132_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX757665_HBe_P-F          -MQLFXLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP995111_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX079937_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN792921_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
HE981180_HBe_P-RF-GF      -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HE981179_HBe_P-RF-FG      -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX264501_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC836867_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX896134_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX896131_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX896130_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLX--
JX896128_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX896127_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVEXLS--
JX896124_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM117851_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM117850_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM066946_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU498228_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EF157291_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY090460_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY090457_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY090454_HBe_C-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB818694_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB375164_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB375163_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB375162_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLX--
AB375161_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB375160_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB375159_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB353764_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB275308_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB266536_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB179747_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB059661_HBe_P-H          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDLYKEFGASVELLS--
X69798_HBe_P-F            -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK058437_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH051986_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY476322_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY458062_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY458061_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY382417_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY382416_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY382415_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY382411_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX264499_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX264498_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX264497_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX264496_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP995126_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP995125_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP995124_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP995123_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP995119_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP995118_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP995117_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KP995116_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP995110_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP995098_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP718113_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP718112_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP718111_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP718109_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP718104_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP718103_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KM998715_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KM233681_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843226_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843224_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843223_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843222_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843221_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843220_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843219_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843213_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843212_HBe_P-F          -MQLSHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843211_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843209_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843208_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843207_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843206_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843205_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843204_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843203_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843201_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843200_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843197_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843196_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843195_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLS--
KJ843194_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843193_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843191_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843190_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843189_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843185_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843181_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843180_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843179_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843178_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843177_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843176_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843175_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843174_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGGLWGMDIDPYKEFGASVELLS--
KJ843171_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843170_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843169_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843168_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KJ843164_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ638659_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ586808_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ586807_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ586806_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF199901_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC494403_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC494402_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC494400_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC494398_HBe_P-F          -MQLFHLCLIT-FVSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC494397_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC494395_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC494394_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX899376_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
JN811656_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN811655_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN792922_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN792914_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
JN688703_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN688699_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ843199_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN688691_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ420166_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ420165_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM627320_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ378247_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ638657_HBe_P-F          -MQLFHLCLII-FCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLS--
MF488699_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDLDPYKEFGATVELLS--
AB116092_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY161143_HBe_P-A          -MQLFHLCLII-SCTCSTFQASKLCLGWLWGMDIDPYKEYGATVELLS--
AY161144_HBe_P-A          -MQLFHLCLII-SCTCSTFQASKLCLGWLWGMDIDPYKEYGATVELLS--
AY161142_HBe_P-A          -MQLFHLCLII-SCTCSTFQASKLCLGWLWGMDIDPYKEYGATVELLS--
AJ627226_HBe_P-A          -MQLFHLCLVI-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
AB116088_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDLYKEFGATVELLS--
AB116086_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATADLLS--
KJ854701_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU304331_HBe_P-A          -IQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU366129_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLS--
FN545834_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB453986_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK512456_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477476_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
FJ692607_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB453989_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU185776_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU185777_HBe_P-A          -MQLFHLCLII-XCTCPTVQASKLCXGWLWGMDIDPYKEFGATVELLS--
AB116076_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVQLLS--
FJ868002_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDRYKEFGATVELLS--
FJ692558_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692596_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798266_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX357649_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857065_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ023661_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ023660_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
EF103278_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB126580_HBe_P-A          -MQLFHLCLII-SRTCPTVQASKLCLGWLWGMDIDPHKEFGATVELLS--
AB116089_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVQLLS--
AB014370_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB064314_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB076678_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB116077_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB116078_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB116079_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB116080_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB116081_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB205118_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB246337_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB246338_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB300366_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB300367_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB362931_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB453979_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB453980_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB453981_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB453984_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB480036_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB480038_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB480039_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB480040_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB480041_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB549213_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FN545833_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB116082_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB116085_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB116090_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB116091_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB116093_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB116094_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB241114_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB241115_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB246335_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB246336_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATGELLS--
AB453987_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB453988_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB116084_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798267_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KR905426_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366467_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692600_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692603_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDHYKEFGAXVELLS--
KP857062_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
M57663_HBe_P-A            -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP168428_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF214660_HBe_P-A          -MQLFHLCLIS-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477498_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161813_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
FN545839_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF925372_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366466_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KR905427_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KR905425_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854690_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798265_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ331046_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX357644_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATTELLS--
KT366471_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP168429_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854703_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDFDPYKEFGATVELLS--
KF798308_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB194949_HBe_P-RF-AE      -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF925407_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF925385_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF925373_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF772351_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
M74501_HBe_P-A            -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
LK995385_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
LC051141_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX686607_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX357647_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX357645_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX357643_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX357642_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736919_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736918_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366470_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366469_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366468_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT151618_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT151617_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATSELLS--
KT151616_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT151615_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDHYKEFGATVELLS--
KT151613_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT151612_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATSELLS--
KT151611_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KR905431_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KR905430_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KR905429_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP718086_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP718085_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP168433_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP168432_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP168430_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606673_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM519452_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM243029_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854707_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854706_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854705_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854704_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854702_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854700_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854699_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854697_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854696_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854694_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854692_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854691_HBe_P-A          -MQLFHLCLIX-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854689_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854688_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854687_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854686_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ843183_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922428_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922427_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922426_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922425_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922424_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798314_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798311_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798310_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798309_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798302_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798292_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798291_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798290_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798289_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798286_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798285_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798279_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798278_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798271_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF214665_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF214663_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF214662_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF214661_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF214659_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF214657_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875260_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875258_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875255_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC836846_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FN545840_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FN545836_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692612_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDXYKEFGATVELLS--
FJ692605_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDXYKEFGATVELLS--
FN545832_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161797_HBe_P-E          -TQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
AB205188_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX357628_HBe_P-RF-DE      -IQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVQLLS--
FN594767_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
HM363576_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FN594758_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU239217_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350117_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ904409_HBe_P-RF-DE      -LQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580626_HBe_P-E          -MQLFDLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
HM363575_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494703_HBe_P-E          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494691_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161796_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF772357_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
KU736911_HBe_P-E          -MXLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVZLLS--
KF192838_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
KF192830_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF192831_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF192832_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF192834_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF192835_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF192833_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF192837_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDLDPYKEFGATVELLS--
KF192839_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDLDPYKEFGATVELLS--
KF192841_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDLDPYKEFGATVELLS--
MF618346_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF618347_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDLDPYKEFGATVELLS--
KU736892_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161778_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161810_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363584_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700551_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350202_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU239223_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736912_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
AF350219_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350220_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350101_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350111_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350191_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606738_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF192840_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDLDPYKEFGATVELLS--
HM363604_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161826_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161792_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161782_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161814_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB201290_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF419539_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWVMDVDPYKEFGATVELLS--
MH725192_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LT623842_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLXDMDIDPYKEFGATVELLS--
AM494711_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477457_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH685719_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX357630_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736916_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524337_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524336_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ315777_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580633_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736909_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
LT623848_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWXMDIDPYKEFGATVELLS--
LT623849_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161815_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350159_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350182_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350203_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB274973_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY739675_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161758_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161766_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161774_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161756_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161795_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY935700_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161790_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161808_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161833_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363583_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB201288_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363591_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF772360_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF849725_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363593_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
FN594770_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
HM363567_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FN545823_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
GQ161760_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ904435_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ178011_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ178012_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ178016_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ178020_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ178015_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ178018_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ178019_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700474_HBe_P-D          -MHLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MG491137_HBe_P-D          -MQLFHLCLII-SCSCPTAQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725011_HBe_P-D          -MQLFPLCLII-SCSCPTVQASQLCLGWLWGMDIDPYKEFGATVELLS--
MH725008_HBe_P-D          -MHLFPLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LK995390_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLEWLWGMDIDPYKEFGATVELLS--
KM524348_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY161141_HBe_P-RF-AD      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPHKEIGATVELLS--
AY161140_HBe_P-RF-AD      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPHKEFGATVELLS--
MH725030_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X85302_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MG491169_HBe_P-D          -MQLFHLSLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MG491138_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725209_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725191_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725175_HBe_P-D          -MPIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725164_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725161_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725142_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725127_HBe_P-D          -MQLLSLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725106_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725095_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725082_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725072_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725070_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725040_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725037_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725035_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725032_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725029_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725025_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725016_HBe_P-D          -MQLFPLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725013_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724997_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724961_HBe_P-D          -MQLFPLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724956_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196227_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196214_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP671692_HBe_P-D          -MQLFHLCLII-SWSCSTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP671690_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF018194_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875309_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875295_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875278_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875276_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC774445_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN558562_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN132131_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN132128_HBe_P-D          -MQLFHLFLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040790_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF754618_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700473_HBe_P-D          -MHLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725208_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725174_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724968_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724967_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF061170_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040808_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ377627_HBe_P-RF-CD      -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725173_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725160_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724973_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MG491192_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MG491190_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MG491168_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MG491165_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MG491161_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MG491157_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MG491136_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MG491127_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724976_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF584161_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF584163_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
KF584165_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
KF584166_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
AY161146_HBe_P-RF-AD      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY161145_HBe_P-RF-AD      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X85297_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X85294_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X85259_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X02496_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725211_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725210_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725207_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725206_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725205_HBe_P-D          -MQLFHLCLII-SCSCPAVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725203_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725201_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725195_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725193_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725190_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725188_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725187_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725185_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725184_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725183_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725182_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725181_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725180_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725179_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725178_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725176_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725170_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725169_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725166_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725165_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725163_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725162_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725158_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725157_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725156_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725155_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725154_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725149_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725148_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGVDIDPYKEFGATVELLS--
MH725146_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725145_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725143_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725138_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725137_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725136_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725134_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725133_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725132_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725131_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725129_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725128_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725122_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725121_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725119_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725117_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725116_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725115_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725105_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725104_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725103_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725101_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725100_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725099_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725098_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725093_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725092_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725091_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725090_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725085_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725083_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725078_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725076_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725074_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725073_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725071_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725069_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725062_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725060_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725059_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725058_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725057_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725056_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725055_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725053_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725052_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725051_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725049_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725048_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725047_HBe_P-D          -MQLFHLCLII-SWSCPTVQASKLCLGWLWGMDIDPYKEFGATGELLS--
MH725046_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725044_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725041_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725039_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725034_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725028_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725027_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725026_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725023_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725022_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDSYKEFGATVELLS--
MH725019_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725017_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725015_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725012_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725009_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725007_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725005_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725003_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725002_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725001_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724998_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724991_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724989_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724987_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724986_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724984_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYREFGATVELLS--
MH724983_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724982_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724981_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724979_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724975_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724964_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724963_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724958_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724955_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724954_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LC365689_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KY382414_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX827300_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196215_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196211_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196208_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366508_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366502_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366500_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366499_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366498_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857106_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857105_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857104_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP671699_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP671697_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP671696_HBe_P-D          -MQLSHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP671694_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP671693_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP671691_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP671689_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP671688_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP671687_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP671686_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP671685_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP671684_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP322599_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524339_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798283_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798260_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF584164_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
KF584162_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF471656_HBe_P-D          -MQLFHLCLIV-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF471652_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF471651_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF471647_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF018191_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF018184_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF018180_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875308_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDRYKEFGATVELLS--
KC875294_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875293_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875288_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875285_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875282_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875280_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875277_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC774462_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC774444_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN642131_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN558561_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257199_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257196_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257194_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257193_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257185_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257182_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257171_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257155_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257151_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN132132_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN132130_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN132127_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040826_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040807_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040806_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040805_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040794_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040793_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040792_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040791_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040786_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040759_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040758_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF754628_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF754624_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF754591_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ833471_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ833470_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ833467_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ833465_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700488_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700487_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700484_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700482_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700480_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700479_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700471_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700469_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700466_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700464_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700455_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700459_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350161_HBe_P-E          -MQLFNLCLII-CCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494791_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPHKEFGATVELLS--
JQ687530_HBe_P-D          -MQFFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ399006_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
KF471650_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857115_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH725014_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707704_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707682_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707683_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707684_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707685_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707686_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707687_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707688_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707689_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707690_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707691_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707692_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707693_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707694_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707696_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707697_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707698_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707699_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707700_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707701_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707702_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707703_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707705_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707706_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
JQ707695_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELLS--
AB555497_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN792903_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350142_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC774179_HBe_P-C          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC774297_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707498_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707509_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707484_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594408_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX096955_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB090268_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY603433_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606745_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ922001_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707476_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707478_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707479_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707481_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707482_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707485_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707487_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707488_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707489_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707490_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH932714_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707508_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707507_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707506_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707505_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707503_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707500_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707499_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707496_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707491_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707494_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707480_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF849720_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMVIDPYKEFGATVELLS--
AF350153_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB106564_HBe_C-E          -MQLFDLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ060822_HBe_P-E          -MQLFDLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ060823_HBe_P-E          -MQLFDLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ060830_HBe_P-E          -MQLFDLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF849717_HBe_P-E          -MQLFDLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350105_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATEELLS--
KM606750_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606751_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP995112_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707529_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY796031_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707483_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707486_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707512_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707513_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707514_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707515_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707516_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707517_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707519_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707520_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707522_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707523_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707524_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707525_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707526_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707527_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707528_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707530_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU620071_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
GQ161803_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATEELLS--
MH725042_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
AF350179_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
MF925396_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161837_HBe_P-RF-AE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161791_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494698_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350154_HBe_P-E          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVESLS--
AF350155_HBe_P-E          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350136_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350134_HBe_P-E          -MQLFHLCLII-SCSCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350135_HBe_P-E          -MQLFHLCLII-SCSCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350139_HBe_P-E          -MQLFHLCLII-SCSCPTLQACKLCLGWLWGMDIDPYKEFGATVELLS--
AF350123_HBe_P-E          -MQLFHLCLII-SCSCPTVQAFKLCLGWLWGMDIDPYKEFGATVELLS--
AF350109_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707521_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF419526_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ687532_HBe_P-RF-DE      -MQFFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594435_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363595_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKMSLGWLWGMDIDPYKEFGATVELLS--
HM363589_HBe_P-E          -MQLFHLCLII-SCSCPTAQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363570_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLSLGWLWGMDIDPYKEFGATVELLS--
HM363569_HBe_P-E          -MQLFHLCLII-SCACPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161781_HBe_P-E          -MHLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161780_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ349226_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350206_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350188_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN792907_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF849713_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF849721_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350099_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350100_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350102_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350103_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350106_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350107_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350108_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350112_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVEILS--
AF350114_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350115_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATEELLS--
AF350116_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350118_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350119_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350120_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350121_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350122_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350124_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350125_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350126_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350128_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350130_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350131_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350132_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350133_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350137_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATEELLS--
AF350138_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350140_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350141_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350143_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350146_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350147_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350148_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350149_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350150_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350151_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350152_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350156_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350157_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350158_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350160_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350162_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350163_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350164_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350165_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350166_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350167_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350169_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350170_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350171_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350172_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350173_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350174_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350178_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350180_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350181_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350183_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350185_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350186_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350189_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350190_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350192_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350193_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350194_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350195_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350196_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350197_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350198_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350199_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350200_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350201_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350210_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350212_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350213_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350214_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350215_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350216_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350217_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350218_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB091255_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB091256_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB194947_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB201287_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB201289_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB205129_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB205189_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB205190_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB205191_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB205192_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB274969_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB274970_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB274971_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB274972_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB915175_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494689_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494690_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494693_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494694_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494696_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494697_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494699_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494700_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494701_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494702_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494704_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494705_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494706_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494707_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494708_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494709_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494710_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494712_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494713_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494715_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494717_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY738144_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY738145_HBe_C-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY738146_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY738147_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY739674_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ060824_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ060825_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ060826_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ060827_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ060828_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ060829_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU239219_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU239221_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU239226_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ349237_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ349238_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ349239_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FN545841_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161755_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161759_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161761_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161763_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161764_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161765_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161769_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161770_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161771_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161772_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161776_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161777_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161779_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161784_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161787_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161789_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161793_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161794_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161798_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161800_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161801_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161804_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161816_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161817_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161819_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736921_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FN594771_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EF103285_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464856_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKGFGATVELLS--
KF170741_HBe_P-E          -MQLFHPCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X85318_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725186_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464844_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440011_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF849715_HBe_P-E          -MLLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X85295_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB205127_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF170742_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ000009_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ000008_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700552_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700550_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363592_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363590_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363588_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363582_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363581_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363580_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363579_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363577_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363574_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363573_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363572_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM363568_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161836_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161835_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161832_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161829_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161828_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161820_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161827_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736922_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU177079_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC774450_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724992_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
U95551_HBe_P-RF-DE        -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF967563_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF925371_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366504_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366503_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KR905422_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524357_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX898699_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX898698_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX898696_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX898695_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX898693_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX898690_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX898688_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX898687_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX898686_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440002_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU563560_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY236161_HBe_P-RF-DA      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233295_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AJ344117_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798270_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798259_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
Z35716_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
V01460_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464852_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464851_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464846_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464840_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464854_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464834_HBe_P-D          -MQLFHLCLII-SCXCPTXQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464836_HBe_P-D          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X80925_HBe_P-RF-DE        -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF925388_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LK995391_HBe_P-RF-ED      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX827299_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX357623_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736923_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736917_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736914_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366492_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP168418_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP168417_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP168416_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM577664_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM577663_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524359_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF170740_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ183486_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594436_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594406_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ111987_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY373430_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB583679_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725024_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725010_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798298_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350205_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350127_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X97848_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X72702_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X65257_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366507_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366497_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366491_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798306_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798282_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF679993_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF679992_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN792910_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN792909_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM750151_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ183478_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ349218_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ349205_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU414056_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU414141_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594382_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161838_HBe_P-RF-AE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HF571060_HBe_P-RF-AE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161754_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736904_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
KU736893_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT192626_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X75657_HBe_P-E            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK321264_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725114_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725021_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725020_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580652_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580651_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580650_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATEELLS--
MH580649_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580647_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580646_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580644_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580641_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580640_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580638_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580637_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580636_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580635_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580634_HBe_P-E          -MQLFHLCLII-SRSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580632_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580631_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580630_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580629_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580628_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580625_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580624_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580623_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580622_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580621_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580620_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580619_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580618_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580617_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580616_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580615_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580614_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF772362_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF772354_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LT623850_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LT623846_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX186584_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736910_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736908_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736907_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736906_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736905_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736903_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736902_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736901_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736900_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736899_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736898_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736897_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736896_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736895_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLX--
KU736894_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736891_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF849727_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF849723_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF849722_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF849716_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF849719_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVEFLS--
KF849714_HBe_P-E          -MQLFHLCLII-XXSXPTVQASKLCLGWLWGMDIDPYKEFGATVELXS--
JQ801523_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774240_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU717214_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASRELLS--
EU872005_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASRELLS--
JF754629_HBe_P-D          -IRLFHLCLIT-SCSCPTIQASKLCLGWLWDMDIDPYKEFGASVELLS--
MH725171_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668003_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
AB674434_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857117_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN257165_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
JN257166_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
MG491186_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN642166_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB674403_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725123_HBe_P-D          -MQLFHLCLII-FFSCPTVQASKLCLGWLWGKGIDPYKEFGATVELLS--
MH725068_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLL--
AB674430_HBe_P-D          -MQLFHLCLII-SCSCPTIQASKLCLGWLWDMDIDPYKEFGATVELLS--
KU668448_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524338_HBe_P-D          -MQLFHLCLII-TCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF584078_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN687947_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ236016_HBe_P-D          -MQLFHLCLII-SCSCPTVQASRLCLGWLWGMDIDPYKEFGATVELLS--
GU456636_HBe_P-D          -MQHFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
EU726879_HBe_P-D          -IQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726860_HBe_P-D          -TQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725086_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X85301_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725094_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725168_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725050_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725109_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF471654_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
HQ700470_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF471649_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ904432_HBe_P-D          -TQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726899_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ486023_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MG491187_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
FJ867966_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
FJ867984_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
FJ867996_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
FJ868004_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
FJ867964_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ867970_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDRYKEFGATVELLS--
FJ867973_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ867974_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ867975_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ867979_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDRYKEFGATVELLS--
FJ867981_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ867983_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDRYKEFGATVELLS--
FJ867998_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ867999_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ868009_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDRYKEFGATVELLS--
FJ868011_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY373431_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726876_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU456649_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU414055_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
EU414142_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
MH725167_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725081_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725080_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725065_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725064_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724999_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724994_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF754608_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ833469_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700489_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWXMDIDPYKEFGATVELLS--
HQ700468_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
JN040817_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
DQ464167_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM750155_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU456671_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726844_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MG491134_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
AB270548_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY721611_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726960_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ349216_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700444_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725079_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725063_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725045_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725018_HBe_P-D          -MPIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF925391_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257148_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040813_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGGFWGMDIDPYKEFGATVELLS--
AB674429_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
AF151735_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
JN040816_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
MH724965_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
MH724966_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
MH725125_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP671698_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF061167_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MG491181_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725141_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725198_HBe_P-D          -MQLFHLCLII-SRSCPTVQASKLCLGWFWGMDIDPYKEFGATVELLS--
MH725194_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725152_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724972_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF471657_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875292_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707493_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN642155_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257187_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
JN257188_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
JN132126_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040756_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726959_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257174_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGATVELLS--
X85308_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X85304_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X85303_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X85298_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725204_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725177_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725159_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725151_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725150_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725147_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725130_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725113_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725112_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725111_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725108_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725102_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725067_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725066_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724993_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724988_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724985_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724977_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724974_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KY629630_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX827291_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857107_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857097_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857094_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
KP322600_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF061169_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWXMDIDPYKEFGATVELLS--
KF018190_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF018187_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN558564_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN558563_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257203_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257179_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040815_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040814_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040788_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040785_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700483_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700454_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700451_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700450_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700449_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC012653_HBe_P-RF-AD      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257191_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
EU185780_HBe_P-RF-AD      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF061168_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWXMDIDPYKEFGATVELLS--
KC012652_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX470760_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257152_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257209_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257149_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
HQ700448_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700477_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB674426_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY661792_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY661793_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY721609_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857099_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857100_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
Y07587_HBe_P-D            -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY721605_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY721607_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY721608_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725124_HBe_P-D          -MQLFHLCLII-SCSCHTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725004_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725036_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725075_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725084_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725089_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKPCLGWLWGMDIDPYKEFGATVELLS--
MH725107_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725202_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU726855_HBe_P-D          -TQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB674427_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWDMDXDPYKEFGAXVELLS--
EU939541_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AM494692_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVDLLS--
AB915178_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU667659_HBe_P-B          -MQLFHLSLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924638_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
MH725153_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLGLGWLWGMDIDPYKEFGASVELLS--
KF471640_HBe_P-D          -LQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVNLLS--
AM494695_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
AF350168_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS--
EU939552_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AM494714_HBe_P-E          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KP671700_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN688678_HBe_P-D          -LRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN642129_HBe_P-D          -LQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
GQ184322_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLKDMDIDPYKEFGASVELLS--
FJ386662_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDLYKEFGASVELLS--
KU667640_HBe_P-B          -MQLFHLSLIN-SCSCPTVQASKQCLGRLWGMDIDPYKEFGASVELLS--
KU668173_HBe_P-B          -MQLFHLSLII-SCSCPTVQASKLCLGWLWGMDIDPYKESGASVELLS--
MH725135_HBe_P-D          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF754625_HBe_P-D          -RQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF214677_HBe_P-C          -MQLFPLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
FJ562248_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
DQ089788_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASLELLS--
KJ803785_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
FJ899792_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470913_HBe_P-C          -MQLFYLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803757_HBe_P-C          -MQLFHLCLII-SCSCPTVQASRLCLGWLWGMDIDPYKEFGASVELLS--
AB697510_HBe_P-C          -IQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173373_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK052970_HBe_P-RF-BD      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700520_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
FJ562336_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939681_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410518_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089756_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU576624_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576015_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576018_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ027316_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS--
MG826151_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY233293_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725088_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
MH725054_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881872_HBe_P-C          -MQLFHDYIII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470908_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX276844_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLXWLXGMDIDPYKEFGASVELLS--
KJ803777_HBe_P-C          -MQLFHLLLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
JQ801472_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
HM011491_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
FJ386594_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
EU939603_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
EU939599_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939544_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
AB670246_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367392_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
MG893561_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX660685_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KU577083_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ882612_HBe_P-RF-GC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875306_HBe_P-D          -TQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN664922_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KY881994_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881987_HBe_P-C          -MHLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881810_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013861_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASTELLS--
KJ410511_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASMELLS--
JX507212_HBe_P-C          -MQLFHLCLII-SCSCPTVQAYKLCLGWLWGMDIDPYKEFGASAQLLS--
JQ801517_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
JQ801500_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
JQ027324_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700543_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924642_HBe_P-C          -MQLFHLCLII-YCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
GQ377620_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDLDPYKEFGASVELLS--
AB014375_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
FJ715391_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
FJ715390_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
FJ562327_HBe_P-C          -MQLFHSCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023655_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939626_HBe_P-C          -MKLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU939625_HBe_P-C          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU939536_HBe_P-C          -MELFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU560438_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--
AB367434_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576300_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576088_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGAFVELLS--
EU589341_HBe_P-C          -MQLFHLFLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU439021_HBe_P-B          -MQLFHLXLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ032349_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700523_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ882618_HBe_P-RF-GC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875331_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN664948_HBe_P-D          -VQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KY881989_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881961_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964208_HBe_P-C          -MQLFYLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KR014059_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KR013801_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYIEFGASVELLS--
JX870000_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040165_HBe_P-C          -MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828937_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715344_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715343_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU570072_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLVWLWGMDIDTYKEFGASVELLS--
MG571360_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689444_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELIS--
KX276806_HBe_P-B          -LXLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX276805_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX276777_HBe_P-B          -XQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDXYKEFGASVELLS--
KU576307_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576304_HBe_P-B          -MQLFPLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576299_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576288_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU575976_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU575921_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
KJ843165_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
EU882004_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB908299_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB713528_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AB212626_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
JQ027323_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KF214676_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KY670781_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--
KU679945_HBe_P-RF-CB      -XQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--
KJ803804_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774449_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774178_HBe_P-RF-BC      -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN664935_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
FJ882613_HBe_P-RF-GC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871985_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY817512_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN664921_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
MF925378_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674390_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY882003_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY882002_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881997_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881977_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881963_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881890_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881888_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881885_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881881_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881878_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470975_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KY470967_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470920_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KY470917_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KY470910_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470907_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KY363266_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KX276851_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963926_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVQLLS--
KU963917_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR014060_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KR014055_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KR013974_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013860_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS--
KR013859_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS--
KR013831_HBe_P-C          -MQLFHLCLII-SCSCPTVQTSKLCLGWLWGMDIDPYKEFGASVELLS--
KR013819_HBe_P-C          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148566_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148557_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148548_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148525_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803776_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KJ803754_HBe_P-C          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410508_HBe_P-C          -MQLFHLCIII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410505_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873539_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KF214675_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774288_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661495_HBe_P-C          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661491_HBe_P-C          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707774_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707773_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707772_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707771_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707770_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707769_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707768_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040149_HBe_P-C          -MQFFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ027333_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750135_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924658_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELIS--
FJ787465_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLYLGWLWGMDIDPYKEFGASVELLS--
FJ787461_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787457_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELFS--
FJ787455_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
FJ562324_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562304_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ518810_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ386603_HBe_P-C          -LQLFHLCLIF-SCSCPTGQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939550_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
EU916227_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871998_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871980_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089795_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
DQ089772_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089768_HBe_P-C          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASSELLS--
AY206385_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF411410_HBe_P-C          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670266_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLS--
HM011488_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLXXMDIDPYKEFGASXELLS--
AB300368_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
AB014380_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
AB014379_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLXDMDIDPYKEFGASVELLS--
AB014361_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
MF674487_HBe_P-B          -MQLFHLCLVI-SRSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689564_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470841_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470837_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470834_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576331_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU575982_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803795_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ151413_HBe_P-C          -MQLFHLCLII-SCSCPTVQAFKLCLGWLWGMDIDPYKEFGASVELLS--
KU964010_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964006_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU357843_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ882617_HBe_P-RF-GC      -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
EU939577_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY206374_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLS--
AB367393_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG826122_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS--
MF925409_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925405_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925395_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF488701_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY882001_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881978_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881973_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881969_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881959_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881892_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881883_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881882_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881877_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881871_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689435_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470972_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470971_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470911_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470887_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY363274_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013853_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013780_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148564_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148559_HBe_P-C          -MQLFHLCLII-SCSCPSVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803814_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803779_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KJ173316_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF214651_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774355_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774354_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661493_HBe_P-C          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801495_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
JQ040168_HBe_P-C          -MQXFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ855543_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
GQ855541_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ904423_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLS--
FJ787469_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715418_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
FJ715375_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715368_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
FJ715364_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715351_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
FJ032351_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023652_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
EU498227_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306722_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ536410_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ478900_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY247032_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF458665_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
AF384367_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670285_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670278_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLS--
AB670269_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670255_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB202072_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195945_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB074755_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964154_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668369_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--
KU668332_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU668309_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU668093_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668061_HBe_P-B          -MQLLHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU667997_HBe_P-B          -MQLFHLCLII-SCSCPAVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU667987_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU576968_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576718_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU576713_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU576707_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU576702_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU576297_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576022_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU575959_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU575927_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148420_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KM213034_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KF165906_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429899_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750147_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377613_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
EU871997_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB493838_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367419_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
MG893558_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925369_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674430_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881979_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881971_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881940_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881891_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881874_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470966_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765842_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964213_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964212_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964211_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964210_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964209_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964207_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964206_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964205_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964204_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964203_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964202_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964201_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964200_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964077_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013814_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013803_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803774_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598656_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173394_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173393_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774319_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801522_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040156_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGXDIDPXKEFGASSELLS--
JQ040151_HBe_P-C          -MQIFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASAELLS--
HQ700570_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924613_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924612_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
FJ023640_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939571_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU439005_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
D50518_HBe_P-C            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
D50517_HBe_P-C            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670309_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367401_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AB111112_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASXELLS--
MG571334_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881861_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLLGMDIDTYKEFGASVELLS--
KU576778_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576746_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576308_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576306_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS--
KU576303_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576302_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576295_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU575984_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU575983_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU575980_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU575979_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU575978_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU575974_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU575973_HBe_P-B          -MQLFHLCLII-SCSCPTVQAPKLCLGWLWGMDIDPYKEFGASVELLS--
KU575945_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU575928_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU679955_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
KJ803772_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF917451_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774494_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774485_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774484_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774479_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774463_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774461_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774454_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774453_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KC774442_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774364_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707714_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828938_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828936_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828935_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828934_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828933_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700557_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700485_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750148_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750142_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377590_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
FJ715347_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715346_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715345_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386643_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
EU939589_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDVYKEFGASVELLS--
EU872015_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU872014_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871999_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871996_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871995_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871993_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871992_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871990_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871989_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871988_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871987_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871986_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871984_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871983_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871981_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU787435_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLS--
DQ478898_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB493842_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367800_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367400_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
S75184_HBe_P-C            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
MF925406_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925398_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925387_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674514_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
MF674504_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674468_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674417_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
MF674411_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
MF674399_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674398_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY882000_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881999_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881998_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881995_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881993_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881992_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881991_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881986_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881985_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881983_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881982_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881981_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881975_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881974_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881968_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881965_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881960_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881937_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881936_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881935_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881934_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881933_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881932_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881931_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881930_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881929_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881927_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881926_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881925_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881924_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881923_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881922_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881921_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881919_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881918_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881917_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881916_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881915_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881887_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881886_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881884_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881879_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881875_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881873_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881870_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470979_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470978_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470977_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470976_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470974_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470973_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470970_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470969_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470968_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470965_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470936_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470933_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470918_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGVSVELLS--
KY470915_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470914_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470912_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470909_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470906_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY363284_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLRGMDIDPYKEFGASVELLS--
KY363281_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY363267_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KX765852_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765828_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765822_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964180_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963929_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963928_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963927_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963925_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963924_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963923_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963922_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963921_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963920_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963919_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963918_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963916_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963915_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU577049_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT284759_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013935_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013852_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013802_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148570_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148554_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148534_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148528_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148523_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148513_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148462_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803826_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KJ803813_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803762_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598645_HBe_P-C          -RQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173432_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173431_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173337_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF214678_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875265_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875264_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774345_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774340_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774338_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774326_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774301_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774296_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
KC774282_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774279_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774278_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774269_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KC774251_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX504542_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX504541_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
JX504536_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429918_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYEEFGASVELLS--
JX026888_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801509_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801483_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
JQ801481_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
JQ707733_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707732_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707731_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707730_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707729_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707728_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707727_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707726_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707725_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707724_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707723_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707722_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707721_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707720_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707719_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707718_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707717_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707716_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707715_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707713_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707712_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707711_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707710_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707709_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707708_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707707_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040154_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040145_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ027322_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ027321_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ027318_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASXELLS--
JN315779_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828931_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828930_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828929_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828928_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828926_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828925_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828924_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828923_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828922_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828921_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF436920_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700571_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700476_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ638218_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750134_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM011502_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASXELLS--
GQ924616_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
GQ872211_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
GQ475332_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475326_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475322_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475318_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
GQ377636_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377632_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377628_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377597_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377593_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377583_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377577_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377526_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ899789_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ899788_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787481_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787468_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787467_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787466_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787464_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787463_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787462_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787458_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787443_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787442_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLSGMDIDPYKEFGASVELLS--
FJ562334_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
FJ562319_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
FJ562308_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562299_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562295_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562290_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562281_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562268_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562265_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562243_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386685_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASXELLS--
FJ386679_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ386672_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGSSVELLS--
FJ386637_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386629_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386627_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386620_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
FJ386605_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386601_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386589_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
FJ386579_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
FJ386576_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ032347_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939647_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939618_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939610_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU939592_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
EU939591_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939590_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939578_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939569_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939564_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939561_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU939560_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939540_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU919165_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
EU916218_HBe_P-C          -MQLFHLCLII-SCSRPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
EU916212_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU717212_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
EU589342_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU439015_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
EU305542_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU305541_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EF494379_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASTELLS--
DQ993692_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ993691_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ144604_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ144603_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ144553_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089766_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089761_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY641561_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB971715_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB971714_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670291_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AB670290_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670289_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670277_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670256_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AB670249_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670243_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670240_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670239_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB471851_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB471849_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367424_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367423_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367422_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367418_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367416_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367414_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367412_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367408_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AB367407_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195944_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195943_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195942_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB111122_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB111121_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB111116_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
AB033553_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB014390_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB014378_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB014374_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB014372_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AB014367_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB014365_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
MF674507_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
MF674479_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674462_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
MF674424_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674419_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
MF674414_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674409_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674392_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
MF674382_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF621878_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
LC349878_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC349877_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689507_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689506_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689505_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689410_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470840_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470838_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470835_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470833_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470832_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470830_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964168_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964167_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964166_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964163_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964162_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964161_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964160_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964159_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964158_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964157_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964156_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964153_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU577003_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576970_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576969_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576460_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KU575966_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148373_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148332_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148321_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803796_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774413_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925389_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
KU695745_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148337_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803827_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873530_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801477_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377633_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377602_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU882006_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
MG826129_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925374_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765834_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964237_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148489_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148487_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148465_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598725_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598681_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598661_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598660_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598658_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598657_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598655_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598654_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598653_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598652_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598651_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598650_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598649_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598648_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598647_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598646_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598644_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
JX560520_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX026885_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040152_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700577_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
EU916229_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU916223_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF533983_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF363961_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670281_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670253_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB642099_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367435_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367410_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB111123_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
AB111117_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
MG571362_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148348_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148347_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148343_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148339_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148338_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148336_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873523_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
MF674486_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040132_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB014377_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089757_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873536_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--
KU679956_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
KU679941_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873522_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
KF873521_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873519_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873518_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674463_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KY629637_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
KF873526_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341544_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700559_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700506_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089799_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670311_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341530_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700517_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU679937_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLS--
JQ341515_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU679940_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLXXMDIDPYKEFGASVELLS--
KP857091_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EF494382_HBe_P-B          -MQLFHLCLII-SCSCPTFQASKLCLGWLWDMDIDTYKEFGASVELLS--
LT623847_HBe_P-E          -MQLFHLCLII-SCSCPTLQASKLCLGWLWDMDIDPYKEFGATVQLLS--
KJ647351_HBe_P-RF-DE      -IQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
DQ486021_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLRDMDIDPYKEFGASVELLS--
KP857066_HBe_P-A          -MQLFHLCLVI-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP857072_HBe_P-A          -MQLFHLCLFT-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX357632_HBe_P-RF-DE      -LQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVQLLS--
KJ803788_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVEIPF--
GQ477456_HBe_P-D          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ904402_HBe_P-D          -IQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU787439_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB048701_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU576069_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU576070_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KP857068_HBe_P-A          -MQLFHLCLFI-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH725172_HBe_P-D          -MQLFHLCLII-FCSCPTVQAFQLCLGWLWGMDLDPYKEFGGIVELLF--
JN688713_HBe_P-D          -IQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF488703_HBe_P-C          -MQLFHLRLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ377552_HBe_P-C          -KQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGGSEELLS--
FJ562329_HBe_P-C          -KQLFHLCLII-SCSCPTVQASKLLIGWLWGMDIDPYKEFGAPVDILF--
KP857067_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KY689469_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY689516_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU589339_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDINTYKEFGASVELLS--
KX276776_HBe_P-B          -LQLFHLCLIX-SCSCPTVQASKLCLGWLXDMDIDTYKEFGASVELLS--
KY470843_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLS--
KY470844_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLS--
KY470846_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLS--
KY470847_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLS--
KY470849_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLS--
KY470850_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLS--
KY470854_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLS--
KY470855_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLS--
KY470856_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASLELLS--
KJ803822_HBe_P-RF-CB      -MQLFHLLLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KJ410510_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGRLWGMDIDPYKEFGASVELLS--
JQ040164_HBe_P-C          -MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASXELLS--
D00630_HBe_P-C            -MQLFHLCLII-SCSCPTVQASKLCLGWLRGMDIDTYKEFGASVELLS--
MG571368_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576807_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--
GQ924624_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU576809_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--
FJ386648_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASLELLS--
FJ386598_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803780_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939658_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY206378_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY689488_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKPFGASVELLS--
KU668358_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB073822_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
AF335738_HBe_P-B          -MQLFHLCPII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU939676_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ386600_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKENGASVELLS--
GQ377525_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY470853_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLS--
EU916228_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY363275_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDLDTYKEFGASVELLS--
EU916233_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
AB112472_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPNKEFGASVELLS--
KU668318_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
JX429910_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ848339_HBe_P-C          ---FFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASGELLS--
Y18857_HBe_P-RF-CB        -MQIFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774414_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881802_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013961_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKKFGASVELLS--
KJ803770_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
KC774253_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040143_HBe_P-C          -MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
AY596108_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB202071_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB111946_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB014364_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU575922_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803752_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY363277_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLP--
KR013862_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
GQ475342_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562285_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386647_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386632_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU939652_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939643_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU916234_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU872013_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
AB367395_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774408_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040169_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--
JQ040157_HBe_P-B          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDTYKEFGASVELLS--
KF873540_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--
KF873542_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803782_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410497_HBe_P-RF-BC      -MQLFHLCLII-SGSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KF873543_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040148_HBe_P-RF-CB      -MQIFHLCLII-SCSCPTVQASKLXLGWLWGMDIDPYKEFGASXELLS--
HQ700532_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700531_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700530_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562229_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDTYKEFGASVELLS--
EU939627_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--
MF674471_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881889_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKPCLGWLWGMDIDPYKEFGASAELLS--
KY470937_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX276852_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--
KU963891_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013773_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148464_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148315_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873541_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
HQ700522_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924620_HBe_C-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377518_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ715376_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562266_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ386638_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB112471_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPNKEFGASVELLS--
MG571323_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674420_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
MF674396_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLS--
KY881850_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881799_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY470961_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470960_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964101_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KU964088_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU964084_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KJ803781_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410490_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM011494_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
GU815677_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
Y18856_HBe_P-RF-CB        -MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KJ803798_HBe_P-RF-CB      -MQLLHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX026887_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
JQ040175_HBe_P-RF-CB      -MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040174_HBe_P-RF-CB      -MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040146_HBe_P-RF-CB      -MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040130_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ349241_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939581_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
AY057948_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVEVLS--
MF925394_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674475_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KR013943_HBe_P-C          -MQLLHLCLII-SCSCPTVQASKLCLGWLWGMDLDTYKEFGASVELLS--
KJ598638_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KJ598637_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KF214672_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774357_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774331_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774316_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040172_HBe_P-C          -MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--
GQ872210_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKKFGASVELLS--
GQ377543_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ562332_HBe_P-C          -MQLSHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562318_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ562272_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ562238_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDLYKEFGASVELLS--
FJ562232_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386618_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386609_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386595_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023648_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939641_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
DQ089759_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY247031_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF241411_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670275_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
AB300372_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
AB113876_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
AB113875_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
AB112348_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGGLWGMDIDPYKVFGASVELLS--
AB105174_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
AB014376_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK052964_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
MG571331_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674481_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674480_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674421_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674400_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674391_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
LC416037_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881808_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881801_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881800_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881798_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881797_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881796_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDTDPYKEFGASVELLS--
KY881795_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881794_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881793_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881791_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881790_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881789_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGTDIDTYKEFGASVELLS--
KY881788_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881787_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881784_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881783_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDKYKEFGASVELLS--
KY881782_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881781_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881780_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY629635_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU964106_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU964103_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU964099_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU964097_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU964095_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU964094_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU964093_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU964092_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU964090_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU964089_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU964087_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU964085_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU964083_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU964081_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU964079_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU576879_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU576877_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU576875_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU576808_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU576803_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU576046_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KP148435_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP036970_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KJ173419_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KJ173418_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KJ173413_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173382_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173356_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040128_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYXEFGASVELLS--
GQ924611_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939565_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881806_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148568_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKAFGASVELLS--
JX507213_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
JQ341460_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KX660682_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
JQ040167_HBe_P-C          -MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ341475_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--
MG571374_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924606_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689413_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670297_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689557_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKXFGASVELLS--
JQ341468_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--
JQ341473_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--
JQ341494_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--
JQ341467_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
JN664947_HBe_P-D          -MELFHLCLII-FCSCPTVQVSKLCLGWLWGMDIDPYKEFGATVELLS--
JN664943_HBe_P-RF-DE      -MELFHLCLII-FCSCPTVQVSKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477462_HBe_P-A          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB937797_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP857109_HBe_P-D          -MQLFHLCLLI-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
JN040796_HBe_P-D          -MHLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKELGATVELLS--
GQ205385_HBe_P-D          -MQLFDLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EF103281_HBe_P-D          -MELFHLFLIL-SWSCPTGPTSQLCLGWLWGMDIDRYKEFGATVELLS--
MF674425_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674458_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089775_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
GQ924635_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU667438_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLS--
KU667569_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLS--
KU667540_HBe_P-B          -MQLFHLCLII-SCSCPTVQASELCLGWLWGMDIDPYKEFEASVELLS--
KU667460_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLS--
KU667469_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLS--
KU667508_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLS--
KU667493_HBe_P-B          -MKLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFEASVELLS--
MF925403_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KU668216_HBe_P-B          -MQLFHLSLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341517_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFXASVELLS--
GQ377623_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023677_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013800_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU833891_HBe_P-RF-GC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT991420_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JF436919_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU916241_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU916239_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH220971_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG826123_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148474_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN400086_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386633_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG826126_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674444_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013904_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013771_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700526_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT991423_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KT991419_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYEEFGASVELLS--
KT991417_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
FJ562278_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
FJ386581_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964023_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF485390_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKESGASVEILS--
KP148563_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLP--
GQ924629_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY090455_HBe_P-F          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924636_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787456_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AB111118_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
FJ386626_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576848_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT991427_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT991424_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562263_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASXELLS--
JX504539_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801501_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU562216_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576325_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148396_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774419_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ023624_HBe_P-C          -MQLIHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341510_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341459_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341461_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689525_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089792_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089770_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341487_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDXYKEFGASVELLS--
JQ341493_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
JQ341504_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
JQ341497_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341496_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341491_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASXELLS--
JQ341490_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341489_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341485_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341482_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341481_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341479_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341477_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341470_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341463_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
JQ341462_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFXASVELLS--
JQ341465_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341483_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
JQ341464_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341484_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341486_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
JQ341502_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB076679_HBe_P-A          -MQLFHLCLII-SCTCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH725126_HBe_P-D          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040780_HBe_P-D          -MQLFHLCLII-SCSCPTLQASKLCLGWLWGMDIDPYKEFGASVQLLS--
EU726901_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB119256_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU667936_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803797_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY596111_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF043593_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
AF043594_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVQLLS--
MF925362_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX276769_HBe_P-A          -LQLFHLCLIX-SCTCPTFQASKLCLGWLWGMDIDPYKEFGASAELLS--
KP857073_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP857070_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KP857071_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
GQ477500_HBe_P-A          -IQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ040872_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY269128_HBe_P-B          -MQLFHLCLII-SCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF488702_HBe_P-RF-DE      -MRLFHLCLII-SCACPTVQASKLCLRWIWGMDIDTYKEFGATVEILS--
KX827302_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATLELLS--
MH725199_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMELDPYKEFGATVQLLS--
KP857116_HBe_P-D          -LQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
KF471655_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707504_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040795_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF754635_HBe_P-D          -TQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU726861_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EF103279_HBe_P-D          -MQLFEVCLII-SCSAQAVRTSKLCLGWLWGMDIDPYKEFGATVELLS--
DQ336692_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MG826152_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS--
KU576691_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLEWLWDMDIDPYKEFGASAELLS--
AB900110_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
KM606696_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATTELVS--
KY629634_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
KU964381_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964382_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964383_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964384_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964385_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964388_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964391_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964393_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964395_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964397_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964386_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964387_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964389_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964390_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964392_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964396_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
JQ341499_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASXELLS--
EF494377_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KF922414_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922415_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922416_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922420_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922418_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922419_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922421_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU668433_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU668435_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664915_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664925_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692588_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ349296_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATGELLS--
AY034878_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF419536_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH725189_HBe_P-D          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH724978_HBe_P-D          -MQLFHLCLIT-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707497_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ904446_HBe_P-D          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ349234_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ464170_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ336688_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB674416_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089787_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
DQ089785_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASQELIS--
AY269140_HBe_P-C          -MQLFHLCLII-SCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668308_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EF473974_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB493827_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ692593_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDLYKEFGATVELLS--
KC875342_HBe_P-D          -MQLFDLCLII-FCSCPTFQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX196229_HBe_P-D          -MQLFDLCLII-FCSCPTFQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB716760_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGLVMGHHKEFGATVELLS--
HE805987_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGLVMGHHKEFGATVELLS--
AB194950_HBe_P-A          -LQLFHLCLII-SCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692564_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692565_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB194951_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692570_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ304548_HBe_P-D          -MQLFHRCLII-SCSCPIVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ304549_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725096_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725110_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725118_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857069_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU563547_HBe_P-A          -LQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATTDLLS--
GQ477504_HBe_P-A          -LQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477497_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLRWLWGMDIDPYKEFGATVELLS--
GQ477488_HBe_P-A          -TQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477475_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLRWLWGMDIDPYKEFGASVELLS--
FJ692604_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692602_HBe_P-A          -TQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692597_HBe_P-A          -LQLFHLCLII-XCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ692586_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB246317_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB194952_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF440012_HBe_P-RF-DE      -MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ904440_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
EF494378_HBe_P-RF-CA      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVQLLS--
MH725140_HBe_P-D          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH724971_HBe_P-D          -MQLFFLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP857114_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875290_HBe_P-D          -MQLFHLCLII-SCSCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196209_HBe_P-D          -MQLFHLCLII-SCSCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196212_HBe_P-D          -MQLFHLCLII-SCSCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040797_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
MH725097_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040771_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700467_HBe_P-D          -LQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
HM750152_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU919197_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPCKEFGATVELLS--
EU726894_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLLLGWLWGMDIDPYKEFGATVELLS--
EU726865_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY236162_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB674405_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB104712_HBe_P-D          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF754601_HBe_P-D          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726883_HBe_P-E          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDAYKEFGATVELLS--
MG826132_HBe_P-C          -MQLFHLCVII-SCACPTVLASPLCLGWVWGMDIDPYIEFGASVEILS--
KY881972_HBe_P-C          -MQLFHLCLII-SCSCPTVQSSELCLGWLWGMDIEPYKEFGASVKLLS--
DQ975272_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU667956_HBe_P-B          -MQLFHLCLII-SCSCPTVKASKLCLGRLWGMDIDPYKEFGASVELLS--
KU667840_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939633_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
EU939634_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
EU919171_HBe_P-B          -LQFFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306699_HBe_P-B          -MQLFHLCLII-TCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB713530_HBe_P-B          -MQLLHLSLII-SGSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB100695_HBe_P-B          -MQLFEFCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP857092_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013996_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
MG491143_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
DQ144564_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ144594_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH481858_HBe_P-RF-DE      -AQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH481859_HBe_P-RF-DE      -MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH481860_HBe_P-RF-DE      -AQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH481861_HBe_P-RF-DE      -AQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB453985_HBe_P-RF-AC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELIS--
KP995108_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGATVELLS--
KP857075_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KP857074_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707577_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707595_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707596_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707600_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707605_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FN545828_HBe_P-A          -MQLFHLCLII-SCSCPTLQASKLCLGXLWGMDIDPYKEFGATVELLS--
KU667980_HBe_P-B          -MQLFHLCLII-SCSCPTVQAYKLCLGWLWGMDIDPYKEFGASVELLS--
KU668300_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ205377_HBe_P-RF-DE      -MQLFDLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU939623_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
MK052972_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH724995_HBe_P-D          -MQLFHFCLFI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH724970_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGATVELIS--
MH724962_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVQLLS--
KP857111_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524346_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875317_HBe_P-D          -MQLFHLCLII-SCSCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196222_HBe_P-D          -MQLFHLCLII-SCSCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196234_HBe_P-D          -MQLFHLCLII-SCSCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN642138_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
JN040752_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
JF754602_HBe_P-D          -LQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU726935_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU185779_HBe_P-D          -MQLFHLCLII-SCACPTGKASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ304547_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ304550_HBe_P-D          -MQLFHLCRII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ304551_HBe_P-D          -MQLFHLCRII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY741797_HBe_P-D          -MQLFHLCLII-SCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY371920_HBe_P-D          -MQLFHLCLII-SCSCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF121240_HBe_C-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF121241_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY371907_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY371912_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ598762_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
JX507211_HBe_P-C          -ALLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
DQ089791_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
AB112063_HBe_P-C          -MQLFHLCLII-SCLRPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB014373_HBe_P-C          -MXLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU667412_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELFS--
KU576692_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576322_HBe_P-B          -MQLFHLCLII-SCSCPTVQASELCLGWLWGMDIDPYKEFGASVELLS--
JX661477_HBe_P-B          -MQLFHLCLVI-SCSCPTVQALQLCLGWLWGMDIDPYKEFGASVELLS--
JX661479_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASQLCLGWLWGMDIDPYKEFGASVELLS--
JF436921_HBe_P-B          -MQLFHLCLII-SCSCPTFQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM011504_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
GQ358137_HBe_P-B          -MQLFPLCLNI-SCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLS--
AB713532_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB212625_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASAELLS--
AF480364_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYIEFRASGELLS--
AF480360_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--
AF480358_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
AF480352_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
AF480340_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
AF480347_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
AF480350_HBe_P-B          -MQLFHLCLII-SCSCPTVRASKLCLGWLWGMDIDPYKEFGASVELLS--
AF480359_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--
AF480361_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF480346_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--
HM146131_HBe_P-RF-AD      -MQLFHLCLIV-SCTCPTSQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP857078_HBe_P-A          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP857077_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP857059_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477501_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477487_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477472_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FN545838_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FM199974_HBe_P-A          -LQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ904434_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692573_HBe_P-A          -LQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN400087_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLVWLWGMDIDPYKEFGASVELLS--
JN400089_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLVWLWGMDIDPYKEFGASVELLS--
KC875338_HBe_P-RF-DE      -MQLFDLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875339_HBe_P-RF-DE      -MQLFDLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664929_HBe_P-RF-DE      -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440007_HBe_P-RF-DE      -MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ205378_HBe_P-RF-DE      -MQLFDLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY254498_HBe_P-F          -MQLFHLCLII-FCACPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH725144_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
MH724959_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KM524358_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875340_HBe_P-D          -MQLFDLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774477_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
JN664932_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040821_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040820_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGAAVELLS--
FJ349208_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594399_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU155893_HBe_P-D          -IQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY090453_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVQLLS--
AB119253_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX276846_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWNMDIDPYKEFGASVELLS--
FJ386644_HBe_P-C          -MQIFHLCLII-SCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX276774_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLEWLWDMDIDPYKEFGASVELLS--
KU668009_HBe_P-B          -MQLFHLCLII-PCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576641_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939559_HBe_P-B          -MQLFHLCLII-SCSCPIVQASKLCLGWLWDMDIDTYKEFGASVELLS--
AY269105_HBe_P-B          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASAELLS--
AF480354_HBe_P-B          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
AF480353_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU439013_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ751769_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU796066_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ023576_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
MH464825_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857076_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP857064_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606653_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
GQ477502_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477473_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FN545826_HBe_P-A          -MQLFHLCLII-SCTCPTXQASKLCLGWLWGMDIDPYKEFGATVELIS--
FJ692576_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWDMDIDPYKEFGATVELLS--
EU414050_HBe_P-A          -TQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233290_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AJ627228_HBe_P-A          -MQLFHLCLVI-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AJ344115_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
AB453982_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB116083_HBe_P-A          -MQLFHLCLII-SCSCPTFQASKLCLGWLWDMDIDPYKEFGATVELLS--
DQ995805_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
JX661486_HBe_P-RF-CB      -MQLFHLCLVI-SCSCPTVYWRELCLGWLWGMDIDPYKEFGASVELLS--
GQ205387_HBe_P-RF-DE      -MQLFDLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ161753_HBe_P-RF-AE      -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X85273_HBe_P-D            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH725120_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725061_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH725006_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724980_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH724969_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724960_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX827290_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196236_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668442_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749827_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KT347090_HBe_P-D          -MQLFHLCLII-SCSCPTVQASRLCLGWLWGMDIDPYKEFGATVELLS--
KP857110_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP671695_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP090178_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF679989_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875316_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875315_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875314_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875307_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875303_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875299_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875297_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875289_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875279_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707518_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664931_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257205_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN257186_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDLDPYKEFGATVELLS--
HQ236014_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU456684_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU456650_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDLDPYKEFGASVELLS--
GQ205384_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ183475_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU787436_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726958_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726845_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU414135_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU414054_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EF103276_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY603427_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB246347_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB222713_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB222712_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB222711_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB222710_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB210822_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB210821_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB188244_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB126581_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB119255_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB104711_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB104709_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LC279250_HBe_P-C          -MQLFHLSLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013837_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148476_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX026877_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS--
JN400088_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLVWLWGMDIDPYKEFGASVELLS--
AY641558_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLVWLWGMDIDPYKEFGASVELLS--
AB900115_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS--
AB182589_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLVLGWLGGMDIDPYKEFGASVELLS--
AB112066_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB105173_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF674407_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881906_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--
KY881848_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--
KU668336_HBe_P-B          -MQLFHHSLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668330_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668076_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU667955_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU667448_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KU667422_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148582_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815572_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358148_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF480343_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDLYKEFGASMELLS--
AF282917_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB900112_HBe_P-B          -TQLFHLCLVI-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
AB073850_HBe_P-B          -TQLFHLCLVI-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
AB073825_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT151620_HBe_P-D          -MXLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LT992438_HBe_P-D          -MXLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KR013857_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN104438_HBe_P-RF-CB      -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013854_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410506_HBe_P-RF-CB      -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN104442_HBe_P-RF-CB      -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674457_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
MF674442_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013856_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDTDPYKEFGASVELLS--
KR013855_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013770_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410519_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173286_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173285_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774330_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774329_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774312_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ341518_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDXYKEFGASVELLS--
JQ341541_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASXELLS--
EU414052_HBe_P-A          -LQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU414133_HBe_P-A          -LQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606649_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ477484_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477474_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELIS--
FJ692592_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692587_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB116087_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF925397_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668440_HBe_P-RF-DE      -MQLFHLCLEF-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440003_HBe_P-RF-DE      -VQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF439999_HBe_P-RF-DE      -MQFFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700582_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ205379_HBe_P-RF-DE      -MQLFDLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY862865_HBe_P-RF-DC      -MLLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB048702_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725139_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
MF618342_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF488704_HBe_P-D          -MQLFHLRLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196226_HBe_P-D          -MQLFHLCLII-SCSCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196213_HBe_P-D          -MQLFHLCLII-SCSCPTFQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX196210_HBe_P-D          -MQLFHLCLII-SCSCPTFQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668447_HBe_P-D          -MQLFHLSLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGVTVELLS--
KU668436_HBe_P-D          -MQLFSARLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ470894_HBe_P-D          -MQLFHPCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC875302_HBe_P-D          -MQLFHLCLII-SCSCPTFQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875300_HBe_P-D          -MQLFHLCLII-SCSCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875291_HBe_P-D          -MQLFHLCLII-SCSCPTFQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN040824_HBe_P-D          -MQLFHLCLII-SCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN040822_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
GQ205388_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ205380_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594434_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
DQ464168_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ315778_HBe_P-D          -LQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
AJ627220_HBe_P-D          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB267090_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB188242_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KR013823_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
KR013820_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWNMDIDPYKEFGASVELLS--
KR013796_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KM875412_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KJ410491_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWDMDIDHYKEFGASVELLS--
KF214670_HBe_P-C          -MQLFHLCLII-SCSCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ386650_HBe_P-C          -MQLFHLCLLI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ922649_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY306136_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIGPYKEFGASVELLS--
AY167091_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELIS--
AB670268_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
AB074047_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS--
AB042282_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB014363_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964091_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGAYVELLS--
KU668289_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGTSVELLS--
KU667784_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGAPVELLS--
KU577089_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576845_HBe_P-B          -LQLFYLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576843_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576754_HBe_P-B          -LQLFRLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576703_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576647_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576626_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU575981_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVVLLS--
KP406170_HBe_P-B          -PYYTHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148453_HBe_P-B          -MQLFHLRLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803787_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774368_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
JX661476_HBe_P-B          -MQLFHLCLVI-SCSCPTVHTRKLCLGWLWGMDIDPYKEFGASVELLS--
FJ032358_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
FJ023633_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU660224_HBe_P-B          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU487256_HBe_P-B          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ144550_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY269120_HBe_P-B          -MQLFYLCLII-SCSCSTIQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF480338_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--
AB908303_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ755833_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK512455_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF925368_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX357640_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT749832_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELIS--
KM606695_HBe_P-A          -MQLFHLCLII-SCTCPTVQAYKLCLGWLWGMDIDPYKEFGATVELLS--
KM606647_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDHYKEFGATVELLS--
KJ854685_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMAIDPYKEFGATVELLS--
KF214658_HBe_P-A          -MQLFHLCLII-SCTCPTFQASQLCLGWLWGMDIDPYKEFGATVELLS--
GQ477490_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477478_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477469_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
FJ692567_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU414049_HBe_P-A          -MXLFHLCLII-SCTCPTVQASXLCLGWLWGMDIDPYKEFGATVELLS--
EU185786_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY152726_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
EU939562_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
MF925392_HBe_P-RF-DB      -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF925360_HBe_P-RF-DB      -MQLFHLCLII-FCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
KT366505_HBe_P-RF-DE      -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ470890_HBe_P-RF-DE      -RQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ470888_HBe_P-RF-DE      -RQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ470887_HBe_P-RF-DE      -RQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ470886_HBe_P-RF-DE      -RQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ470884_HBe_P-RF-DE      -RQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX661485_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQGLQLCLGWLWGMDIDPYKEFGASVELLS--
JN664940_HBe_P-RF-DE      -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440001_HBe_P-RF-DE      -MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440000_HBe_P-RF-DE      -MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF439998_HBe_P-RF-DE      -MQLFEEHELS-GRANPTVQASKPCLGWLWGMDIDPYKEFGATVELLS--
JF439996_HBe_P-RF-DE      -MQLFEEHELS-GRANPTVQASKPCLGWLWGMDIDPYKEFGATVELLS--
JF439995_HBe_P-RF-DE      -MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700538_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ315780_HBe_P-RF-DE      -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ315779_HBe_P-RF-DE      -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798275_HBe_P-E          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725197_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH725196_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF618343_HBe_P-D          -TQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366496_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366494_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524361_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524356_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVQLLS--
KJ470889_HBe_P-D          -RQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664927_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664926_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664914_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ922002_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ904433_HBe_C-D          -IQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
EU414143_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU414057_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK321266_HBe_P-C          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881819_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX276841_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
JX661497_HBe_P-C          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWDMDIDHYKEFGASVELLS--
HM011497_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924655_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
EU939605_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
DQ922651_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089786_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089778_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
DQ089776_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
AY167092_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
AB300361_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGGSVEPLS--
AB112408_HBe_P-C          -MQLFEFFLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASEELLS--
MG571351_HBe_P-B          -TQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689523_HBe_P-B          -MQLFHLCLII-SCSCPTVQASXLXLGWLWGMDIDXYKEFGFSVELLS--
KY689419_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU667858_HBe_P-B          -MKLFHLCLII-SYSCPTVQASKLCLGWLWGMDIDPYKESGAPVELLS--
KJ803783_HBe_P-B          -MQHFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040171_HBe_P-B          -MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700546_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLS--
GQ358145_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVEVLS--
FJ562311_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AY269102_HBe_P-B          -MQLFHLCLII-SCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF480337_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWPWGMDIDPYKEFGASGELLS--
AF157024_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF157023_HBe_P-B          -MQLFHRCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
AB493833_HBe_P-B          -MQLFHLCLII-SCSCPTGQASNLCLGWLWGMDIDPYKEFGASVELLS--
AB231909_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB033554_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KF214666_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
V00867_HBe_P-C            ---LFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700544_HBe_P-C          ---LFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925386_HBe_P-RF-AC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440017_HBe_P-RF-DA      -MQLFXXCLII-SCSCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK512467_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK512460_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749833_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGATVELLS--
KP857060_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ843172_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707602_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707388_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707368_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPSKEFGATVELLS--
JQ707346_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477491_HBe_P-A          -TQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVDLLS--
GQ477463_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692561_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692555_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWDMDIDPYKEFGASVELLS--
AF419535_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350087_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350083_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350081_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700535_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
HQ700537_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
HQ700541_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU414061_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
EU414138_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
GQ183482_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
EU414059_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU414139_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692536_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH746813_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG826145_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX660689_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX660684_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX357634_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ803802_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410520_HBe_P-RF-CB      -MQLFHLGIII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873538_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
JN257216_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF436923_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700584_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700583_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700581_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700525_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700524_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700503_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700501_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700497_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FR714496_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU916232_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AM494716_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
AB033559_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X65258_HBe_P-D            -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK052975_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK052973_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH725077_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH724996_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH724990_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF925393_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF925364_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF925358_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF618348_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF618341_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF618339_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LT992454_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX827301_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX827292_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196233_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196232_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196231_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196225_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196224_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196221_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196220_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196219_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196217_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX196216_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736926_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736925_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736924_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU668449_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU668446_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU668445_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU668444_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU668441_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU668439_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU668438_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU668437_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGRDIDPYKEFGATVELLS--
KU668434_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366511_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366510_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366509_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366506_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
KT366501_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT366495_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KR905424_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
KR905423_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP322601_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP090181_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP090180_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP090179_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP090177_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606752_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606744_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524355_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524354_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524353_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524352_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524351_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524350_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524349_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524347_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524345_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM524341_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM519455_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922432_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF798273_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF679997_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF679996_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF679995_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF679994_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875337_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875336_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875334_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875332_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875325_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875324_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875323_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875322_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875321_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875320_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875319_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875313_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875312_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875311_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875310_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875305_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875287_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875286_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875284_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875283_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875281_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875275_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774460_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX898697_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX898694_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX898692_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX898691_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX898689_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX096958_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX096957_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX096956_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX096954_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707511_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707510_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707501_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707495_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707492_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707477_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664938_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664937_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664930_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664928_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664920_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664919_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN664918_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664917_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664913_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664912_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664911_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664910_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664909_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257181_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN257150_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700514_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700513_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700512_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700511_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ205389_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ183484_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ183483_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
GQ183477_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ183476_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ183474_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ183473_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ183471_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692533_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692532_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692507_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692506_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ349232_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594433_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594432_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594431_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594430_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594428_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594427_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594425_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594424_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594423_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594422_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594421_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594416_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594415_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594412_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594411_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594410_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594409_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594407_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594405_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594403_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594402_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594401_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594400_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU414140_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU414060_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU414058_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ464169_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ315776_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGIDIDPYKEFGATVELLS--
AY603445_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY603443_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY603440_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY603437_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY603428_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233296_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
AY233294_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
AY233292_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
AY233291_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM422939_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AJ627223_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AJ131956_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB493846_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB471857_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB471856_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB355452_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB330370_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB330369_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB205128_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB205126_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB116266_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB109476_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB109475_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB090270_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB090269_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB078033_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB078032_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB078031_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X04615_HBe_P-C            -MQLFPLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571345_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
LC279252_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881988_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881876_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470900_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLRLGWLWGMDVDPYKEFGASVELLS--
KY470874_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX276840_HBe_P-C          -LQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
KU964343_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964198_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964078_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964002_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963997_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963996_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT307719_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013975_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLRLGWLWGMDIDTYKEFGASVELLS--
KR013846_HBe_P-C          -MQLFHLCLII-SCSCPPVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013840_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKGFGASVELLS--
KR013817_HBe_P-C          -MQLFHLCLII-SCSCPTIQASKLCLGWPWGMDIDHYKEFGASVELLS--
KR013808_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013772_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013762_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148572_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148540_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148532_HBe_P-C          -MQLFHLCLII-SCSCPTVQASRLCLGWLWGMDIDPYKEFGASVELLS--
KP148526_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KM359441_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KJ803815_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803790_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803761_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598699_HBe_P-C          -MQLFPLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598691_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598642_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410514_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
KC774353_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774352_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774334_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774300_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774286_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX661490_HBe_P-C          -MQLFHLCLVI-SCSCTRVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX507214_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801520_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ429078_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLP--
JQ040162_HBe_P-C          -MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN104434_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828910_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
JF828905_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
HM042269_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ377609_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787454_HBe_P-C          -MQPFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715424_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ715422_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ715421_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715389_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715372_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715357_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562282_HBe_P-C          -MQLFLLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562273_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASAELLS--
FJ562264_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ386653_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386640_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
FJ386617_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGGLWDMDIDHYKEFGASVELLS--
FJ032356_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939586_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDHYKEFGASVELLS--
EU939573_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU570074_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU570073_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU554541_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
EU410079_HBe_P-C          -MXLFHLCLII-SCSCPTVQASXLCLGWLWGMDIDPYKEFGASVELLS--
EU306719_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306687_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089801_HBe_P-C          -MQLFHLWLII-SCSCPTVQASKRCLGWLWGMDIDPYKEFGASVELLS--
DQ089780_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY206386_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
AF461363_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF461357_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF411412_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF223961_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670310_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670306_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB246346_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
AB246344_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
AB205124_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195954_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195953_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195952_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AB111125_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
AB111124_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
AB042285_HBe_P-C          -TQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571349_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571321_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
MF674443_HBe_P-B          -MQLFRLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
M54923_HBe_P-B            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689563_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689562_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--
KU964165_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963951_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963824_HBe_P-B          -MQLFFLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668307_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668299_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668108_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668012_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU667996_HBe_P-B          -MQLFHLCLII-SCPCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU667879_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU667859_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU667700_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU667647_HBe_P-B          -MQLFHLSLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU577081_HBe_P-B          -MQLFHLCLII-SCSCPAVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576777_HBe_P-B          -MQPFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576637_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576600_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
KU576324_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576132_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576052_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576043_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148421_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148414_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148411_HBe_P-B          -MQLFHLYLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148394_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148392_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVESLS--
KM392072_HBe_P-B          -MQLFDLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803764_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173379_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774396_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC510646_HBe_P-B          -PWIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661483_HBe_P-B          -MQLFHVSLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661482_HBe_P-B          -MQLFHVSLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX507210_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707744_HBe_P-B          -MQLFHLCLII-SCSCPTVQASTLCLGWLWGMDIDHYKEFGASVELLS--
JQ040173_HBe_P-B          -MQIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040125_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM011474_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU827630_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815748_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815747_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815696_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815688_HBe_P-B          -MQPFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815678_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815676_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815659_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815612_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815610_HBe_P-B          -MQPLHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815577_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815574_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815558_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGVDIDPYKEFGASVELLS--
GQ924607_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475340_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377644_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377625_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377519_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358144_HBe_P-B          -MQLFPLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ751767_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ562296_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASXELLS--
FJ562289_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562257_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
FJ386684_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386675_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386636_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--
FJ032357_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
FJ032353_HBe_P-B          -MQLFHLFLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ032352_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023637_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ023628_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023627_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023610_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023573_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939666_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDTYKEFGASVELLS--
EU939639_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
EU881998_HBe_P-B          -MQLFYLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU570069_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU439023_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLRLGWLWGMDIDPYKEFGASVELLS--
EU330996_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306712_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306709_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306707_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306703_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306677_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EF473977_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EF473973_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
DQ993708_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ993707_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ993697_HBe_P-B          -MQLFNLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ993696_HBe_P-B          -MQLFNLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ993687_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGSSAELLS--
DQ904357_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
DQ144597_HBe_P-B          -MQLVHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ144560_HBe_P-B          -MQLVHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY596110_HBe_P-B          -MQLFHLCLII-SRSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY269110_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AY220704_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AY220703_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AY217360_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY167098_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF480363_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--
AF480362_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--
AF480357_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--
AF480356_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--
AF480355_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLRGMDIDPYKEFGASGELLS--
AF480351_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--
AF480349_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF480348_HBe_P-B          -MQLLHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
AF480344_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--
AF480342_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF480341_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF479684_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF335748_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF335746_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF335740_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF121247_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
AF100308_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB713531_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB493835_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB355453_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB115551_HBe_P-B          -MQLFEFCLVI-SRSCPTVQASKLCLGWLWAMDIDPYKEFGASVELLS--
AB073840_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB073833_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AB073831_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU185765_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EF494376_HBe_P-RF-CA      -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464817_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATXELLS--
KM606650_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDLYKEFGATVELLS--
KJ586809_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX154579_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDLYKEFGATVELLS--
JQ707576_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMNIDPYKEFGATAELLS--
GQ477493_HBe_P-A          -LQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ477464_HBe_P-A          -LQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FN545830_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
FN545829_HBe_P-A          -LQLFHLCLII-SCTCPTXQASKLCLGWLWGMDIDPYKEFGATVELLS--
FM199977_HBe_P-A          -LQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692611_HBe_P-A          -MQLFHLCLII-SCSCPTFQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ692598_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692595_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU414048_HBe_P-A          -LQLFHLCLIT-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AM180624_HBe_P-A          -LQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB222707_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ536414_HBe_P-C          -MHLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ536413_HBe_P-C          -MHLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU576806_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
X68292_HBe_P-RF-DA        -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK052967_HBe_P-RF-BD      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU695742_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU679946_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKQCLEWLWGMDIDPYKEFGASVELLS--
KM386676_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
JX661498_HBe_P-RF-CB      -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661487_HBe_P-RF-CB      -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377611_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ882614_HBe_P-RF-GC      -MXLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ882610_HBe_P-RF-GC      -MHLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562287_HBe_P-RF-CB      -KQLFHLCLII-SCSSPTVQAFKVCLGGLWGMGLDPYKEFGAFGELLF--
EF103282_HBe_P-RF-AD      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY123424_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF461361_HBe_P-RF-CB      -MHLSHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
MH725033_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
MH725031_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
JN688685_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
GQ205382_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB120308_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF674428_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881812_HBe_P-C          -MHLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881807_HBe_P-C          -MHLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881777_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881776_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881775_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881774_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881773_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881772_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881771_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881770_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881769_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881768_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881767_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881766_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881765_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881764_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881763_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881762_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881758_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881755_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881754_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881751_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881750_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881749_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881748_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881744_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881743_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881742_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881739_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881738_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881737_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881736_HBe_P-C          -ILLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470882_HBe_P-C          -MQLFHLCLII-SCSCPTAQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY363256_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964046_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013984_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013826_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
KR013825_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
KR013824_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWPWSMDIDPYKEFGASAELLS--
KR013822_HBe_P-C          -MQLLHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
KR013821_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
KR013818_HBe_P-C          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDAYKEFGASVELLS--
KP148547_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KM875404_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
KJ803823_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS--
KJ803766_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410498_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774361_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774321_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774311_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774306_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774284_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661496_HBe_P-C          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661492_HBe_P-C          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661489_HBe_P-C          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377591_HBe_P-C          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377563_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLEWLWGMDIDPYKEFGASVELLS--
GQ377529_HBe_P-C          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377521_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787449_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715406_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELPS--
FJ715404_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELPS--
FJ715366_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715341_HBe_P-C          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562333_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
FJ032334_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939648_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939554_HBe_P-C          -MLLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
EU796069_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ980551_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
DQ980550_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
DQ975273_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
DQ478899_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ377162_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ361526_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089773_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089764_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
D28880_HBe_P-C            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AB675675_HBe_P-C          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB675674_HBe_P-C          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670241_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
AB042283_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB014369_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
X98077_HBe_P-B            -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
MG571366_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
MF674493_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674437_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689553_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689448_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX276821_HBe_P-B          -TQLFHLCLII-SCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLS--
KU964155_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668116_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIGPYKEFGASVELLS--
KU667612_HBe_P-B          -MQLFHLCLII-SCSRPTVQASKLCLGWLWGMDIDPYKEFGAPVELLS--
KU667484_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELHS--
KU577107_HBe_P-B          -STLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KU576874_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576856_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576854_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576804_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576766_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576751_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576748_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576738_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576714_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576704_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576698_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576693_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576681_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576656_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576645_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576640_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576633_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576630_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576629_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576623_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576620_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576619_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576309_HBe_P-B          -MQLFHLCLII-SCSCPTAQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576240_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576051_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKAFGASVELLS--
KP659234_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP148388_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148371_HBe_P-B          -MQLFHLCLII-SCSCPTAQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148366_HBe_P-B          -MQLFHLCLII-SCSCPTAQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148345_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148335_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCPGWLWGMDIDPYKEFGASVELLS--
KP148334_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148323_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KM392083_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173348_HBe_P-B          -MQLFHLCLII-SCSCPTGQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774392_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC774386_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC774380_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC774374_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC774362_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASGELLS--
KC510642_HBe_P-B          -PRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661484_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661481_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661480_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
JX661478_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661475_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661474_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661473_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661472_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661471_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661470_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ027311_HBe_P-B          -IQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASXXLLS--
HM011487_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATTELVS--
GU815752_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815605_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358147_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWIWGMDIDPYKEFGASVEVLS--
FJ023617_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023613_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU330997_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLRGMDIDPYKGFGASVELLS--
EF494381_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
EF473976_HBe_P-B          -MQLFHLCLNI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ993711_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ448626_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ448625_HBe_P-B          -MHLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
D00329_HBe_P-B            -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY269109_HBe_P-B          -MQLFHLCLII-SCSCHTVQASKLCLGWLWGMDIDPYKEFRASVELLS--
AY269095_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011087_HBe_P-B          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011086_HBe_P-B          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF100309_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB908304_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB908300_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB241117_HBe_P-B          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASTELLS--
AB241116_HBe_P-B          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASTELLS--
AB219429_HBe_P-B          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB219426_HBe_P-B          -MQLFHLCLII-SCSCPTIQASKLCLGWLWGMDIDPYKEFGASMELLS--
AB073851_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB073846_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
AB048705_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN182323_HBe_P-A          ---LFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440016_HBe_P-A          ---LFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ867986_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWDMDIDRYKEFGATVELLS--
FJ867960_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWDMDIDPYKEFGATVELLS--
AY903452_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK512472_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK512466_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK512461_HBe_P-A          -LQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK512457_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF925400_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF772348_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
MF772344_HBe_P-A          -MQLFHLCLII-SCTCPTIQASKLCLGWLWGMDIDPYKEYGATVELLS--
KP857080_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KM606658_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KF922430_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM535200_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU827640_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ477495_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477486_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477482_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGATVELLS--
GQ477480_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASTELLS--
GQ477479_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477468_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477466_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ331047_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FN545825_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692613_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692577_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692566_HBe_P-A          -LQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859952_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859944_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY738141_HBe_P-A          -XQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY738140_HBe_P-A          -XQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY603446_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY603438_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY603432_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
AY233287_HBe_P-A          -MQLFHLCLII-TCTCPTLQASKLCLGWLWDMDIDPYKEFGATVELLS--
AJ309371_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF536524_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF419534_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ040127_HBe_P-C          -MQLFXLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASXELLS--
KX660680_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTXQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148442_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVALLS--
KF873533_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDXYKEFGASVELLS--
KF214656_HBe_P-RF-AC      -MQLFPLCLII-SSSCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ377516_HBe_P-RF-CB      -RQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ161806_HBe_P-RF-EA      -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ882611_HBe_P-RF-GC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
LT992439_HBe_P-D          -MQLFHLCLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KY470925_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFRASVELLS--
KP148558_HBe_P-C          -MQLFHLCLII-PCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KM875430_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KJ410494_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KJ410492_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410489_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN104437_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924609_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377631_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377605_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377559_HBe_P-C          -TQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715402_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLS--
FJ715392_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU916210_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVVLLS--
EU871976_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
EU306727_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLS--
EF688062_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ246215_HBe_P-C          -MQLFHSCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089790_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
DQ089789_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089783_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089782_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089781_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
DQ089779_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089777_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
DQ089760_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY862869_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF473543_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF223959_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF223956_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF223955_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670300_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AB670265_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
AB205125_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB112065_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AB014387_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLXDMDIDPYKEFGASAELLS--
MF674476_HBe_P-B          -MQLFHLCLVI-SRSCPTVQASKLCLGWLWAMDIDPYKEFGASVELLS--
MF674385_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX276830_HBe_P-B          -IQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASTELLS--
KX276809_HBe_P-B          -LQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU668149_HBe_P-B          -VQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU667457_HBe_P-B          -MQLFHLCLII-PCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576940_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576794_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148440_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148438_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148433_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148429_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148424_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148418_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148410_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148407_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148391_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC510660_HBe_P-B          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC510659_HBe_P-B          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC510658_HBe_P-B          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC510657_HBe_P-B          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC510656_HBe_P-B          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC510655_HBe_P-B          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC510654_HBe_P-B          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC510653_HBe_P-B          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC510652_HBe_P-B          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC510651_HBe_P-B          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC510650_HBe_P-B          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC510649_HBe_P-B          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC510648_HBe_P-B          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC510647_HBe_P-B          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC510643_HBe_P-B          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC510641_HBe_P-B          -MRLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815764_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLS--
GU815761_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWPWGMDIDPYKEFGASVELLS--
GU815722_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMGIDPYKEFGASVELLS--
GU815668_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815627_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVDLLS--
GQ924605_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ448624_HBe_P-B          -MQLFHLCLII-PCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ144598_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ144561_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY269108_HBe_P-B          -MQLFHLCLII-SCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY269100_HBe_P-B          -MQLFHLCLII-SCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY269093_HBe_P-B          -FQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY269091_HBe_P-B          -MQLFHLCLII-SCSCHTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF157020_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB355455_HBe_P-B          -MQLFHLCLII-TCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB073821_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--
KJ854698_HBe_P-A          ---LFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854693_HBe_P-A          ---LFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ868008_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ867995_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ867994_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ867985_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ867961_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ867958_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDRYKEFGATVELLS--
FJ867949_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDRYKEFGATVELLS--
FJ867948_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDRYKEFGATVELLS--
FJ867947_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ867946_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDRYKEFGATVELLS--
EU185775_HBe_P-A          -LQLFHLXLII-SCTCPTVGASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ751770_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EF197911_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ586810_HBe_P-RF-AF      -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY161147_HBe_P-RF-DA      -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB222708_HBe_P-RF-AD      -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX026879_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLSFF
MK512471_HBe_P-A          -LQLFHLCLII-SCSCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK512463_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK512458_HBe_P-A          -MQLFHLCLII-SCSSPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF925361_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF772353_HBe_P-A          -MQLFHLCLII-FCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX827296_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX827295_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX827294_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX827293_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU736920_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKXFGATVELLS--
KT749839_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749824_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857061_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP718101_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP168427_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP168426_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP168425_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606742_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606688_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
KM606656_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922409_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922408_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875252_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX154582_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDLYKEFGATVELLS--
JX154581_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDLYKEFGATVELLS--
JX154580_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDLYKEFGATVELLS--
JX096953_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELPS--
JQ707582_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707565_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707555_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707414_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707387_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707345_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELVS--
JQ707336_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707329_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707315_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707312_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707300_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ687533_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN182332_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN182318_HBe_P-A          -XXLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477465_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ222208_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FN545835_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
FN545831_HBe_P-A          -MQLFHLCLII-SCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLS--
FM199975_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692608_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692606_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692601_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692599_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692591_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692590_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692585_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692584_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692583_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692582_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692581_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692580_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692579_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692578_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692575_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692574_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692571_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692563_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692562_HBe_P-A          -MQLFHLCLII-SCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692559_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692557_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ692554_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU410082_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU054331_HBe_C-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ788725_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ315784_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ020003_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY934774_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY934771_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY934770_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY934769_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY934768_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY934767_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY934765_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY934764_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY934763_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY373432_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY373429_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY373428_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233286_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233278_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233276_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM494718_HBe_P-A          -MQLFHLCLII-SCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM184126_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM184125_HBe_P-A          -MQLFHLCLII-SCTCPTIQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350098_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350097_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350096_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350095_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350094_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350093_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350092_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350091_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350090_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350089_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350088_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350086_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350085_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350084_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350082_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF350080_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF297625_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF090842_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF043560_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB937796_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB937795_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB937791_HBe_P-A          -MQLFHLCLII-SCTCPTFQASKLCLGWLWGMDIDPYKEFGATVELLS--
KY881814_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470885_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ536411_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KP148341_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
X75656_HBe_P-RF-CB        -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK321265_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK052976_HBe_P-RF-BD      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK052968_HBe_P-RF-BD      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH746812_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH746811_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH094410_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG893559_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG893555_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG893554_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG826148_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG826147_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG826146_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG826144_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925401_HBe_P-RF-DB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925370_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC458432_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC416040_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
LC279267_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279266_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279265_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279264_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279263_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881840_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470893_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGTSVELLS--
KY363263_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY363262_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KX660677_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
KX660675_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX660674_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTXQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX354997_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964317_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964316_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964315_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964314_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964313_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964312_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964311_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964310_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964309_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964308_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964307_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964306_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964305_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964304_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964303_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964009_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964008_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964007_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964005_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964003_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964001_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963999_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963998_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963995_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963994_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963993_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963991_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963990_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU695746_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU695744_HBe_P-RF-CB      -MQLFHLCLII-SCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU695743_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU695741_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU679953_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU679948_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--
KU679944_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU679942_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU679939_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU519423_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU519422_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT991421_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT003704_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013816_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP276256_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP276255_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP276254_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP276253_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148352_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KM875422_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803753_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KJ173358_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGAFVELLS--
KJ173350_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173349_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173330_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173329_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173326_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173325_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173322_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173320_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173300_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173299_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173280_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173279_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873534_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873532_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873531_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873527_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873524_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873517_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873515_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF873513_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASVELLS--
KF873511_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774499_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774497_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC774495_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774492_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC774490_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQAPKLCLGWLWGMDIDPYKEFGASVELLS--
KC774489_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774487_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC774482_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC774480_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774471_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774470_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774458_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774457_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774456_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774455_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774452_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774448_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774447_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774426_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774425_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774424_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774423_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774349_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774344_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774341_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774332_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774328_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774324_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774322_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774317_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774305_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774294_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774258_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774234_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774212_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774201_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774198_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774186_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774183_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC315400_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC172106_HBe_P-RF-GB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661494_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429898_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429896_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801476_HBe_P-RF-CG      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ732168_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF491456_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF491455_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF491451_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF491449_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF491448_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700560_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700547_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700542_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700528_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700527_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700521_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700519_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700518_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700509_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700508_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700507_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700505_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700499_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700498_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750150_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750149_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750146_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750145_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750144_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKQCLGWLWGMDIDPYKEFGASVELLS--
HM750143_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750133_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924618_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377635_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377634_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377630_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377626_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377614_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377596_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377595_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377594_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377581_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377573_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377565_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377564_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377560_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377549_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377548_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377544_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377539_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377534_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377520_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358156_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358155_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FR714490_HBe_P-RF-GB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787480_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787446_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715414_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715413_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715412_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715411_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715387_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715385_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715384_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562314_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562305_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ562302_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ386649_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386585_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386578_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023673_HBe_P-RF-GC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023670_HBe_P-RF-GC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023667_HBe_P-RF-GC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023664_HBe_P-RF-GC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023659_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939629_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU939606_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU916240_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU881995_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
EU835240_HBe_P-RF-GC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU787434_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU522070_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ478897_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ478892_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ478890_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ478889_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ478887_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ478886_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
DQ144601_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY862866_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY862864_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY817515_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY817513_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY817511_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY817510_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY800249_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY247030_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY167095_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY123041_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY040627_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011108_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011105_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011104_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011103_HBe_P-RF-CB      -MQLFHLCLII-SCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011102_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB674504_HBe_P-RF-DC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670303_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB493847_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB493840_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB493837_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB241109_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB198084_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195957_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195956_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195955_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195951_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195950_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195941_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195940_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195939_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB105172_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB033557_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB031265_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH725087_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX196235_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX196230_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX196218_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875335_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875333_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875330_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875329_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875326_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875318_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ183481_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ183479_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB110075_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X75665_HBe_P-C            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH891502_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH887433_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH094411_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG893560_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG893557_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG893556_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG893553_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
MG826135_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG826134_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG826133_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG826131_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
MG826128_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG826127_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG725248_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925410_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925408_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925377_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925376_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925375_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925367_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
MF925365_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF925359_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674502_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674501_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674494_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674489_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
MF674484_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674474_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674472_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674467_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674454_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674435_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674429_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674418_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674412_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674408_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674403_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674402_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674388_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674386_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC373512_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC373511_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC318703_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC318702_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279276_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279275_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279274_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279262_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279261_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279260_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279259_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279258_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279257_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279256_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279255_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279254_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279253_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279251_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279249_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279248_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279247_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279246_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC279245_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC090200_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881984_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881980_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881970_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881967_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881928_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881920_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
KY881880_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881818_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881815_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881803_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689518_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDHYKEFGASVELLS--
KY689471_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY670782_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY629631_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470991_HBe_P-C          -MQLFHLCLII-SCPCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470990_HBe_P-C          -MQLFHLCLII-SCPCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470988_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470987_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470986_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470985_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470984_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470983_HBe_P-C          -MQLFHLCLII-SCPCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470982_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470981_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470980_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470934_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470929_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470916_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470905_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470904_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470903_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470902_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470901_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470899_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470897_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470896_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470895_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470894_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470892_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470891_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470890_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470889_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470888_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470886_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470884_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470883_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470881_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470880_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470879_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470878_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470876_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470875_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470873_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY363279_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY363278_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY363276_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY363257_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KY022423_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX774506_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765855_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765853_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765851_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765850_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765849_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765848_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765847_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765846_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765845_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765844_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765843_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765840_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765839_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765838_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765837_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765836_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765833_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765832_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765831_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765830_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765829_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765827_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765826_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765825_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765824_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765823_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765821_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765820_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765819_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765818_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964348_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964347_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964346_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964345_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964344_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964342_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964341_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964340_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964339_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964338_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964337_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964336_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964334_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964332_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KU964329_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964326_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964324_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964323_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964321_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964228_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964227_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964226_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KU964225_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964224_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964223_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KU964222_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KU964221_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964220_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964218_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964217_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964216_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964214_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964199_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964197_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964196_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964195_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964194_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964193_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964192_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964191_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLX--
KU964190_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964189_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964188_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964187_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964186_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964185_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964176_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964076_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964075_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964074_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964073_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964072_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964071_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964070_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964069_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964068_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964067_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964066_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964065_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964064_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964063_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964062_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964061_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964060_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964059_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964058_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964057_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964056_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964055_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964054_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964053_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964052_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964051_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964050_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964049_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964048_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964047_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964045_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964044_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964043_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964042_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964041_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964040_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964039_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964038_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964037_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964036_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964035_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964034_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964033_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964032_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964031_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964030_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964029_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964028_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964027_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964026_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964025_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964024_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964022_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964021_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964020_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963992_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963914_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963913_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963912_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963911_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963910_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963909_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963908_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963907_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963906_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963905_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963904_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963903_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963902_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963901_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963900_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963899_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963898_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963897_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963896_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963895_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963894_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963893_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963892_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963890_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963889_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963888_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963887_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963886_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU679936_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDXYKEFGASVELLS--
KU051427_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU051426_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU051425_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU051424_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU051423_HBe_P-C          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT987426_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT987425_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT987424_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT987423_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT366463_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT364752_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT364751_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT364721_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT364720_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT364719_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT364718_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT307718_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT284758_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT284756_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT284755_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT284754_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KT284753_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR014098_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KR013969_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KR013942_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013909_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013908_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013877_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013875_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013873_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013871_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013858_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013851_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLS--
KR013850_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASLELLS--
KR013834_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013833_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013832_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013830_HBe_P-C          -MQLFHLCLIN-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013829_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013828_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013815_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013813_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013812_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013811_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013810_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013809_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013799_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013798_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013797_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013794_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013793_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013792_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013791_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013790_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013789_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013788_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
KR013787_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013786_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013785_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013784_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013783_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013782_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013781_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVESLS--
KR013779_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013776_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR013774_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP784761_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148574_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148573_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148571_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148562_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148561_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148560_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148555_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148551_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148549_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148546_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148545_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148538_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148535_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148531_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148529_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148524_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148521_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148520_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGVSVELLS--
KP148517_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148512_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148493_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148492_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148488_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148482_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148481_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148480_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148475_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148473_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCFGWLWGMDIDPYKEFGASVELLS--
KP148471_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148470_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148469_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148468_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148466_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148463_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP027477_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KM875425_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KM875424_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KM229703_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KM213037_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803818_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803811_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803799_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803793_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803792_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803759_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ790199_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598772_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598753_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598752_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598749_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598740_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598719_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS--
KJ598718_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS--
KJ598717_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS--
KJ598716_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598715_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS--
KJ598714_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS--
KJ598713_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS--
KJ598712_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS--
KJ598711_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS--
KJ598710_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598709_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS--
KJ598708_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS--
KJ598707_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS--
KJ598706_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS--
KJ598705_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDSYKEFGASVELLS--
KJ598701_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598698_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598697_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598696_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598695_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598694_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598690_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598689_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598688_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598686_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASAELLS--
KJ598679_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASAELLS--
KJ598659_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598641_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598640_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598639_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598636_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ598635_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410513_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410501_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410496_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410495_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173446_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173445_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KJ173444_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173443_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173442_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173441_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173440_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173439_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173438_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173437_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173436_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173435_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173434_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173433_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173430_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173429_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173428_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173427_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173426_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173396_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173395_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173392_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173391_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173336_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173335_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173333_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173332_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173331_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173328_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173327_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173324_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173321_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173317_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173315_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173314_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173313_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173312_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173311_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173310_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173309_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173308_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173307_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173306_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173305_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173304_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173303_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173302_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173301_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173296_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173295_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173294_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173293_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173292_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173291_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173289_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173288_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173287_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173284_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173283_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173282_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173281_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF495606_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF485389_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF214673_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF214671_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875272_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875271_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875270_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875269_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875268_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875267_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875263_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGAPVELLS--
KC875262_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875261_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774360_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774359_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774358_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774356_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774351_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774348_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774347_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774343_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774342_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774339_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774337_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774336_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774335_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774333_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774327_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774325_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774320_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774318_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774315_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774314_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774313_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774310_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774309_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774308_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774304_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774303_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774302_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774299_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774298_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774295_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774293_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774292_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774290_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774289_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774287_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774285_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774283_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774281_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774280_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774277_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774276_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774274_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774272_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774271_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774270_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774268_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774267_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774261_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774260_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774255_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774254_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774252_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774250_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774244_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774242_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774241_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774239_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774238_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774237_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774236_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774235_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774233_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774216_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774215_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774214_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774213_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774206_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774196_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774187_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774185_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774184_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774182_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774181_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774180_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX661488_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX560519_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX504546_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX504545_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX504544_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX504537_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429917_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429916_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429915_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429913_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429912_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429909_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429907_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429906_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429905_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429904_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429903_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801519_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801513_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801511_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801505_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801504_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801502_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801497_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801496_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801490_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801489_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801488_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801487_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801486_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801482_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801475_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801473_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801470_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ688404_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ688403_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040163_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ040133_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ027320_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
JQ027319_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ027317_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASMELLS--
JN827425_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN827424_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN827423_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN827422_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN827421_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN827420_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN827418_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN827417_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN827416_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN827415_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN827414_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN104440_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN104435_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN104433_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF899336_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828920_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828919_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828918_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828917_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828916_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828915_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828913_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF828912_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
JF828911_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
JF828908_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
JF828907_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
JF828906_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
HQ700575_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLXDMDIDPYKEFGASVELLS--
HQ700574_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700573_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700572_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700569_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700568_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700567_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700566_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700565_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700564_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700563_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700562_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700561_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700558_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700556_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700555_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700516_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700504_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700502_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700496_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700495_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700456_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750141_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750140_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750139_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750138_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750137_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750136_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750132_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM750131_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM011489_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HM011465_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU721029_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU563561_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU434374_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924649_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924633_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924614_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924604_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ855548_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ855544_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ855534_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ855528_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ855525_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ855523_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475355_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475354_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475347_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475346_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475345_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475344_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475339_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475338_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475334_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475333_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475331_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475330_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475329_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475328_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475327_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475325_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475321_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475320_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
GQ475319_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475317_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475316_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475315_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475314_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475313_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475312_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475311_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475310_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475309_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
GQ475308_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475307_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475306_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ475305_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377642_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377640_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377637_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377624_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377619_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377618_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377617_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377616_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377615_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377601_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377600_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377598_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377585_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377584_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377580_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377579_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377578_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377576_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377574_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377572_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377571_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377570_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377562_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377555_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377554_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377553_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377551_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377545_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377541_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377540_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377538_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377536_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377535_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377533_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377531_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377528_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377527_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377524_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377523_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377517_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377515_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377514_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358158_HBe_C-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358157_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358154_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ259588_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
GQ227696_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
GQ227695_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGTDIDHYKEFGASVELLS--
GQ227694_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
GQ227693_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
FJ899777_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ899775_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ899763_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787479_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787471_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLP--
FJ787453_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787447_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787441_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ787439_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ751765_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ751764_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715409_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715407_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715405_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715403_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715400_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715398_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715397_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715395_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715383_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715382_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715381_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715380_HBe_P-C          -MQLFHLCLIL-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715379_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715378_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715377_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715374_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715371_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715370_HBe_P-C          -MQLFHLCLII-SCSCPNVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715367_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715365_HBe_P-C          -MQLFHLCLII-SCSCPNVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715359_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
FJ715358_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715355_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715353_HBe_P-C          -MQLFHLCLII-SCSCPNVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715352_HBe_P-C          -MQLFHLCLII-SCSCPNVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715350_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ715342_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562325_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
FJ562323_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562320_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562307_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ562298_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
FJ562297_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562293_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDHYKEFGASVELLS--
FJ562288_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562283_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562279_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ562274_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562269_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562258_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562252_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
FJ562245_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562244_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562218_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ518813_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386678_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386673_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASAELLS--
FJ386667_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386664_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386659_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDXYKEFGASXELLS--
FJ386657_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
FJ386652_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386651_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
FJ386641_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASXELLS--
FJ386639_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386631_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDSYKEFGASVELLS--
FJ386628_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386619_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386616_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
FJ386612_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386607_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386591_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386588_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386587_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386577_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386575_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ349225_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ032361_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ032355_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ032350_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ032346_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ032345_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
FJ032341_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ032340_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ032339_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ032332_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ032331_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023658_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023657_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023656_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023654_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023653_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023650_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023649_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023647_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023646_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023644_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023643_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023642_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023641_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023625_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023591_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023590_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023589_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023587_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023571_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023568_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023567_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023566_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939642_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
EU939640_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
EU939619_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939615_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
EU939611_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939609_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939604_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939600_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
EU939597_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939593_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU939584_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939582_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
EU939574_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU939572_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU939557_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939549_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU919168_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU916238_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU916237_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU916225_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU916224_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU916217_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU916215_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU881996_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU872010_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU871982_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU796072_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU796070_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
EU670263_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU589345_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU579442_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU570068_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU570067_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU562218_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU562217_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU562215_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU560440_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU554542_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
EU554539_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU554538_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU554537_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU554535_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU522069_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLT--
EU522068_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU410081_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU410080_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306729_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306721_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306720_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306714_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306713_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306694_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306691_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306690_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306689_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306688_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306685_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306673_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU305540_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EF536066_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
EF536065_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
EF384201_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EF137802_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ993693_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ993690_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ922650_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ683578_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
DQ478901_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ377165_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLP--
DQ377164_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ377163_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ377161_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ377160_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ315783_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ315782_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDAYKEFGASVELLS--
DQ315781_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089796_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
DQ089793_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089769_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089767_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGAXVELLS--
DQ089765_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089763_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ089762_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
DQ089758_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
D50519_HBe_P-C            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
D23680_HBe_P-C            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
D12980_HBe_P-C            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY641560_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY596107_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY269099_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY220700_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY220699_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY206389_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY206384_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY206382_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AY167099_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY167090_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY066028_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
AY057947_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011107_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011106_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011101_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011100_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011099_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011098_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011097_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AJ748098_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF458664_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF411411_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
AF411408_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
AF384366_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF384365_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF384364_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF286594_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF241410_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF223960_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF223958_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF223957_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF223954_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF068756_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB697500_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB697494_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB697490_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB675677_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670307_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670305_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670304_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670294_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670292_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670287_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670283_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670282_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670267_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670261_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670254_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670252_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670247_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB670238_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB642100_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB640730_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB485808_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB471853_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB471852_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB471850_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB471848_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB426467_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367417_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367413_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367411_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367409_HBe_P-C          -MQLFHLCLII-SCSCPTVLASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367403_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367402_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
AB367399_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367398_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367397_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367396_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB367394_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB362932_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB300365_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB300363_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB300362_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB300359_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB299858_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB288026_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB250109_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB247916_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB246345_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB241111_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB241110_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB222715_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB222714_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB205123_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB198083_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB198082_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB198081_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB198080_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB198079_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB198078_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB198077_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB198076_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195949_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB117758_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLCGMDIDPYKEFGASAELLS--
AB113879_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB111120_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB111119_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB074756_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB050018_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB033556_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB033552_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB033551_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB033550_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB031262_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB026815_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB026814_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB026813_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB026812_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB026811_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB014395_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB014394_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB014391_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
AB014368_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB014362_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
AB014360_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
X97851_HBe_P-B            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK075117_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK052965_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK052962_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH663473_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH061283_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG826153_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571371_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571369_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571365_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571364_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571361_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
MG571356_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571355_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571348_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571347_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571346_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571344_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571342_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571341_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571340_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571328_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MG571327_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
MG571322_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674515_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674513_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674512_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674510_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674509_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674506_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
MF674500_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674497_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674495_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674490_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674488_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674485_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674483_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674482_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674477_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674469_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
MF674460_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674456_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674455_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674453_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674452_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674451_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674449_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674438_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674432_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674431_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674427_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674426_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674423_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
MF674416_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674413_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674410_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674405_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674404_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674401_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674397_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674395_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674394_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674393_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674389_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674387_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674384_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MF674383_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC349873_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LC349872_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881786_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KY881779_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881778_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881761_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881760_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881759_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881757_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881756_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881753_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881752_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881747_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881746_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881745_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881741_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881740_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881735_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881734_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881733_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881732_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881731_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881730_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881729_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881728_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881727_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881726_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881725_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881724_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881723_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881722_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY881721_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689546_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689538_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689520_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KY689517_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689480_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689472_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689443_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689433_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY689414_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLXXMDIDPYKEFGASVELLS--
KY689408_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGASVELLS--
KY629636_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470962_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470956_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470954_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KY470953_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX765856_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX276824_HBe_P-B          -RQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX276817_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLXXMDIDPYKEFGASVELLS--
KU964164_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU964107_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KU964105_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KU964104_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KU964102_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KU964100_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KU964098_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KU964096_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASAELLS--
KU963989_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963988_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963987_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963986_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963985_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963984_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963983_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963982_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963981_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963980_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963979_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963978_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963977_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963976_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963975_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963974_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963973_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963972_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963971_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963970_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963969_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963968_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963967_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963966_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963965_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963964_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963963_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963962_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963961_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963960_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963959_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963958_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963957_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963956_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963955_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963954_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963953_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963952_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963950_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963949_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963948_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963947_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963946_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963945_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963855_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963854_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963853_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963852_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963851_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963850_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963849_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963848_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963847_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963846_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963845_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963844_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963843_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963842_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963841_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963840_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963839_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963838_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963837_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963836_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963835_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963834_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963833_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963832_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963831_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963830_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963829_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963828_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963827_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963826_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963825_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963823_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963822_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963821_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963820_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963819_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963818_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963817_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963816_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963815_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963814_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963813_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963812_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963811_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963810_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963809_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963808_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963807_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963806_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963805_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963804_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963803_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963802_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963801_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963800_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU963799_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU679959_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKQCLGWLWGMDIDPYKEFGASVELLS--
KU668133_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668124_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668115_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668069_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668058_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668046_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668037_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668027_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU667590_HBe_P-B          -MQLFHLCLII-SCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU667515_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU577004_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576873_HBe_P-B          -MQLFHLCLII-SCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576872_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576871_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576870_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576869_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576868_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576867_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576866_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576793_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576788_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576785_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576784_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576783_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576782_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576781_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576780_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576328_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576327_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576326_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576321_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576320_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGAPVELLS--
KU576319_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576310_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576189_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576054_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU576053_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KU576045_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576042_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYREFGASVELLS--
KU576041_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576039_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576038_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU576026_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYEEFGASVELLS--
KU576024_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU575977_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU234318_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR232337_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KR152339_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP659235_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP148583_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148581_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148580_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148579_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148461_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148457_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148456_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148455_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148452_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDTDPYKEFGASVELLS--
KP148451_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148439_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148430_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148427_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148425_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148423_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148419_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148413_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148409_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148406_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148405_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148403_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148402_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148401_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148400_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148398_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148397_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148395_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148390_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148389_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148387_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148386_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148385_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148384_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148383_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148382_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLP--
KP148380_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148379_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148378_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148377_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148376_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148375_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148374_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148372_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148370_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148369_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148368_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148365_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148364_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148363_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148362_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148361_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148360_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148359_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148357_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148356_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148349_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148346_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148344_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148342_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148340_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148333_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148331_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148330_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148328_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148327_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148326_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148325_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148324_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148322_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148320_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148319_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148318_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP148317_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KM359440_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803817_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ803784_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KJ803763_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410517_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410516_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ410507_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173425_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173424_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173423_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173422_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173421_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173420_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173417_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173416_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173415_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173414_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173412_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173411_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173410_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173409_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173408_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173407_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173406_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173405_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173404_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173403_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173402_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173401_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173400_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173399_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173398_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173397_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173390_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173389_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173388_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173387_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173386_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASMELLS--
KJ173381_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173376_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173375_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173374_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173370_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173369_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173367_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173366_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173365_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173364_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173363_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173361_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173360_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173359_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173357_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173355_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173354_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173353_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173352_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173351_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173347_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173345_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173343_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173342_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173341_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173340_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173339_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KJ173298_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KJ173297_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF165328_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF164967_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
KC836874_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC836872_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC836865_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC836864_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC836863_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC836861_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC836857_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC836853_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC836843_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC836841_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC836830_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774418_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774416_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774411_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774409_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774406_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC774404_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774403_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774401_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC774399_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774398_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774394_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774393_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774390_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC774388_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774387_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774384_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC774382_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774381_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774378_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC774376_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774375_HBe_P-B          -MQLFHLCLII-SCSCPTVQAPKLCLGWLWGMDIDPYKEFGASVELLS--
KC774372_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC774370_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC774369_HBe_P-B          -MQLFHLCLII-SCSCPTVQAPKLCLGWLWGMDIDPYKEFGASVELLS--
KC774366_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
KC774363_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX978431_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX869999_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX869998_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX507215_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX504538_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDTDPYKEFGASVELLS--
JX429908_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429902_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX429897_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801514_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801512_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801507_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801479_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ801471_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707767_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ707765_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ707764_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ707763_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ707759_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ707758_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ707755_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ707750_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ707749_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ707747_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ707743_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ707742_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ707739_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ707738_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ707737_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ707734_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDHYKEFGASVELLS--
JQ688405_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ429081_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASGELLS--
JQ040170_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN827419_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JN406371_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF899335_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF775484_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF775483_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF775482_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF775480_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JF412801_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700549_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
HQ700548_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815780_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815771_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815770_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815769_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815768_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815767_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815766_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815765_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815762_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815760_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815759_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815756_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815755_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815754_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815753_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815751_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815750_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815749_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815746_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815745_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815744_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815743_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815742_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815741_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815740_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815739_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815738_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815737_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815736_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815735_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815734_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815733_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815732_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815731_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815730_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815729_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815728_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815727_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815726_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815725_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815724_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815723_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815721_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815720_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815719_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815718_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815717_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815716_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815715_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815713_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815712_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815711_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815709_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815708_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815705_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815704_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815703_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815702_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815701_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815700_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815698_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815697_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815695_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815693_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815692_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815691_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815689_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815687_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815686_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815685_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815684_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815683_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815681_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815680_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815679_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815675_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815674_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815673_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815672_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815670_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815669_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815667_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815666_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815665_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815664_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815663_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815662_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815661_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815660_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815658_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815657_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815656_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815654_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815653_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815652_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815651_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815650_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815649_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815648_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815647_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815646_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815645_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815644_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815643_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815642_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815640_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLP--
GU815639_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815638_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815637_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815636_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815635_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815634_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815633_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815632_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815631_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815628_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815626_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815625_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815624_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815623_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815622_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815621_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815620_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815619_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815618_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815617_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815616_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815614_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815613_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815611_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815608_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815607_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815606_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815604_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815603_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815602_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815601_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815600_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815599_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815598_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815597_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815596_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815595_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815593_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815590_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815588_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815587_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYEEFGASVELLS--
GU815586_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815585_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815584_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
GU815581_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815579_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815576_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815575_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815573_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815571_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815570_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815569_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815568_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815567_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815566_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815565_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815564_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815563_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815562_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815561_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815560_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815559_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815557_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815556_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815555_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815554_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815553_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815552_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815551_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815550_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815549_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815548_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU451682_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU434373_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU434372_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU357842_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924654_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924653_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924651_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924640_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924634_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924631_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924627_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924621_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924610_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDRYKEFGASVELLS--
GQ924608_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ924603_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ855532_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ855526_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ855522_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377643_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377641_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377639_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377638_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
GQ377629_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377612_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377588_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377587_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377569_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377568_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377566_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377561_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377558_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377542_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ377537_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358152_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358151_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358150_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358149_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358143_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358142_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358141_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358138_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GQ358136_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ899779_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--
FJ787444_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ667207_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562322_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ562253_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ562224_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
FJ518812_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386688_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASTELLS--
FJ386676_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386668_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386666_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386660_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386655_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386654_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386642_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386610_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386584_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386583_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ386582_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ349236_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ032354_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023638_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023636_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023635_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023634_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023630_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023629_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023620_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023618_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023614_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023612_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023611_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023609_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023608_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023607_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023606_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023605_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023575_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ023569_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU939669_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDTYKEFGASVELLS--
EU796071_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU796068_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU796067_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU570071_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU570070_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU439022_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU439020_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVEVLS--
EU439018_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU350409_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU331001_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU331000_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU330999_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU330998_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU330994_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU330992_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU330990_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU330989_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306710_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306708_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306706_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306705_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306704_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306702_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306701_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306700_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306698_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306697_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306696_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU306695_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU305548_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU305547_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EU139543_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EF494380_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EF473975_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EF473972_HBe_P-B          -MQLFHLCLII-SCSCPSVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EF134946_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
EF134945_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
DQ995801_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ993709_HBe_P-B          -MQLFHLCLII-SRSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ993706_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ993703_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ993701_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ993700_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ993694_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ975271_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ448628_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ448627_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ448623_HBe_P-B          -MQLFHLCLII-SCSCPTVQACKLCLGWLWGMDIDPYKEFGASVELLS--
DQ448622_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ448621_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ448620_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ448619_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
DQ361535_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS--
DQ144599_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
D00331_HBe_C-B            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
D00330_HBe_P-B            -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY766463_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY596102_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY518556_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY293309_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY269135_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY269131_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY269115_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY269097_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY220698_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY217359_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY167089_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY033073_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AY033072_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011096_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011095_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011092_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011091_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011090_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011089_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011088_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011085_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AP011084_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AM888201_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGPSVELLS--
AF480345_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASGELLS--
AF480339_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF335754_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF335741_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF282918_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF233237_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF233235_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF121249_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF121246_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF121245_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF121244_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AF121243_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB713527_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB675676_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB471855_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB471854_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB355454_HBe_P-B          -MQLFHLCLII-SCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB334303_HBe_P-B          -MQLFHLCLII-SCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB334302_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB334301_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB334300_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB334299_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB300364_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB287329_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB287328_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB246340_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASAELLS--
AB246339_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB219430_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB219428_HBe_C-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB205119_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195935_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195934_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB195933_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB073834_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB073829_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB073828_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB073827_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB073826_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
AB033555_HBe_P-B          -MQLFHLCLII-SCSCPIVQASKLCLGWLWGMDIDPYKEFGASVELLS--
M38454_HBe_P-RF-CB        -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK512464_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK512462_HBe_P-A          -KQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
MH580643_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580642_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580639_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH580627_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857079_HBe_P-A          -MPLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KP718100_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP168435_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606737_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATAELLS--
KJ843182_HBe_P-A          -MQLFHLCLII-SCTCPTLQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875257_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707623_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707356_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU563550_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWVWGMDIDPYKEFGATGELLS--
AF537371_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697497_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697496_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697495_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697493_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697492_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697491_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697489_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697488_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU185750_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU679954_HBe_P-RF-CB      -MQLFHLCLII-SCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLS--
LT992444_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MG571335_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
HM011486_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASVELLS--
DQ089784_HBe_P-C          -MQLFHLCLII-SCSCXTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
LT992442_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LC279273_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LC279272_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LC279271_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LC279270_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LC279269_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LC279268_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KY689534_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLXXMDIDPYKEFGASVELLS--
KP659247_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP659237_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB287315_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB287314_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB246343_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB246342_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB246341_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB205121_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB073848_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB010289_HBe_P-B          -MQLFHLCLVI-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LT992448_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LT992441_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854709_HBe_P-A          ---LFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN182329_HBe_P-A          ---LFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN182322_HBe_P-A          ---LFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233277_HBe_P-RF-AC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK512470_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
MH464814_HBe_P-A          -LQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX648547_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATXELLS--
KU605533_HBe_P-A          -MQIFHLCIII-SYSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP718089_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922431_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KF922429_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KC875256_HBe_P-A          -TQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC836858_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JQ707335_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM535205_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HE576989_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HE576988_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU563562_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU563558_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU563557_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU563555_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU563554_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU563553_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU563548_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU563546_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU563545_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477503_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477496_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477467_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477461_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ414522_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ184324_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATLELLS--
GQ184323_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FM199980_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FM199979_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FM199978_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FM199976_HBe_P-A          -MQLFHLCLII-SCTCXTVQASKLCLGWLXGMDIDPYKEFGATVELLS--
FJ349224_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ349222_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859956_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859955_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859954_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859953_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859951_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859950_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859949_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859948_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859947_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859946_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859945_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859943_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859942_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859941_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859940_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859939_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859937_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859936_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859935_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859934_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859933_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859932_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859931_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859930_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859929_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859928_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859927_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859926_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859925_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859924_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859923_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859922_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859921_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859920_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859919_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVEFLS--
EU859918_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859917_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859916_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859915_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859914_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859913_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859912_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859911_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859910_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859909_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859908_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859907_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859906_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859905_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859904_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859903_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859902_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859901_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859900_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859899_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU859898_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594395_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594394_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594393_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594392_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594391_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594390_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594389_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594388_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594387_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594386_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594385_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594384_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594383_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU185789_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU185774_HBe_P-A          -MQLFHLCLII-SRACPTVZASKLCLGWLWGMDIDPYKEFGATVELLS--
EU185746_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU086721_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EF208113_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ315786_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
DQ020002_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY934773_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY934772_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY934766_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY902775_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY862868_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY862867_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCPGWLWGMDIDPYKEFGATVELLS--
AY738143_HBe_P-A          -XQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY738142_HBe_P-A          -XQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY738139_HBe_P-A          -XQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY707087_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY603441_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY603436_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY603435_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY603431_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY603430_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY603429_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233289_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233288_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233285_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233284_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233283_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233282_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233281_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233280_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233279_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233275_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY233274_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY161139_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY161138_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY128092_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM410963_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM295797_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM295796_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM295795_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AM282986_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AJ309370_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AJ309369_HBe_P-A          -MQLFHLCQII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AJ012207_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF537372_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF297624_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF297623_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF297622_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF090841_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF090840_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWDMDIDPYKEFGATVELLS--
AF090839_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF043580_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB937798_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB937794_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB937793_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB937792_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB775201_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB775200_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB775199_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB775198_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697512_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697511_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697509_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697508_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697507_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697506_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697505_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697504_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697503_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697501_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697499_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF873544_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWXMDIDXYKEFGASXQLLS--
MF925404_HBe_P-RF-AC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF488705_HBe_P-RF-AD      -MQLFHLRLII-FCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN664933_HBe_P-RF-DA      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ331048_HBe_P-RF-AE      -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF297620_HBe_P-RF-DA      -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF297619_HBe_P-RF-DA      -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB330368_HBe_P-RF-DA      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
Z72478_HBe_P-A            -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
Z35717_HBe_P-A            -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X70185_HBe_P-A            -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X51970_HBe_P-A            -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X07911_HBe_P-A            -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
X02763_HBe_C-A            -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
V00866_HBe_P-A            -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK512476_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK512475_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
MK512474_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK512473_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK512469_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK512468_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK512465_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MK512459_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH932713_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464830_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464828_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464818_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464815_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464813_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464810_HBe_P-A          -XQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MH464808_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKKFGAXVELLS--
MF772350_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF772346_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATTELLS--
LT992440_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LC458431_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LC458430_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LC311243_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LC311242_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LC311241_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
LC074724_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
L13994_HBe_P-A            -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KY886219_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KY382410_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KY003230_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX827298_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX648549_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX648548_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KX357646_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU605539_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU605538_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU605537_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU605534_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU605532_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU605522_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU605521_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU605520_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU605519_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU605518_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU605517_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU605516_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749850_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749849_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749847_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749846_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749844_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749843_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749842_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749840_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749838_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749837_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749836_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749835_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749834_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749831_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749830_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749829_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749826_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT749825_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT347088_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT347087_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KT151614_HBe_P-A          -MQLFHLCLII-SCTCPTXQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857063_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP857058_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP718099_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP718098_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP718097_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP718096_HBe_P-A          -MQLFHLCIII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP718095_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP718094_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP718093_HBe_P-A          -MQLLHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP718091_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP718088_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP718087_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP274928_HBe_P-A          -MQLFHLCLMM-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP274927_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP274925_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP168434_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP168424_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KP168423_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606749_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606746_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606700_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606694_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606691_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606687_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606685_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606684_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606683_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606680_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606678_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606677_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606676_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606674_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606672_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606669_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606666_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606665_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606663_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606661_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606660_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606652_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM606648_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM519454_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KM519453_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854710_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ854708_HBe_P-A          -MQLFHLCLIX-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ843218_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ843217_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ843216_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ843215_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ843214_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ843192_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ843188_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ843186_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ843184_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ843173_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ843166_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ010778_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ010777_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KJ010776_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922407_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KF922406_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC875259_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYQEFGATVELLS--
KC875253_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDVDPYKEFGATVELLS--
KC875251_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC836854_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC836849_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC836834_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC836832_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KC836831_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX096952_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707681_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707676_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707675_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707674_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707672_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707670_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707669_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707667_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707665_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707664_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707663_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707662_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707661_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707659_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707658_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707656_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707655_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707654_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707653_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707652_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707651_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707650_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707649_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707648_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707647_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707646_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707645_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707644_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707643_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707642_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707641_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707640_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707639_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707638_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707637_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707636_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707635_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707634_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707633_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707632_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707631_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707630_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707629_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707628_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707627_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707626_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707625_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707624_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707622_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707621_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707620_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707619_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707618_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707617_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707616_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707615_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707614_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707613_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707612_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707611_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707610_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707609_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707608_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707607_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707606_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707604_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707603_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707601_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707599_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707598_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707597_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707594_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707593_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLA--
JQ707592_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707591_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707590_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707589_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707588_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707587_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707586_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707585_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707584_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707583_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707581_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707580_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707579_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707578_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLL--
JQ707575_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707574_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATAELLS--
JQ707573_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707572_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707571_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707570_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707569_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707568_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707567_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707566_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707564_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707563_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707562_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707561_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707560_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707559_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707558_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707557_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707556_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707554_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707553_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707552_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707551_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707550_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707549_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707548_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707547_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707546_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707545_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707544_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707543_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707542_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707541_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707540_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707539_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707538_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707537_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707536_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707535_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707534_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707533_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707532_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707531_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707420_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707419_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707418_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707417_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707416_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707415_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707413_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707412_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707411_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707410_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707409_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707408_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707407_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707406_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707405_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707404_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707403_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707402_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707401_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707400_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707399_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707398_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707397_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707396_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707395_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707394_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707393_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707392_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707391_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707390_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707389_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707386_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707385_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707384_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707383_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707382_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707381_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707380_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707379_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707378_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707377_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707376_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707375_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707374_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707373_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707372_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707371_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707370_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707369_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707367_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707366_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707365_HBe_P-A          -MQLFHLCLII-SCSSPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707364_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707363_HBe_P-A          -MQLFHLCLII-SCSCPTVPASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707362_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707361_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707360_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707359_HBe_P-A          -MQLFHLCLII-SCSCPTVQAFKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707358_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707357_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707355_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707354_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707353_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707352_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707351_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707350_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707349_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707348_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707347_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707344_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707343_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707342_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707341_HBe_P-A          -MQLFHLCLII-SCSCPTVQAFKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707340_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707339_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707338_HBe_P-A          -MQLFHLCLII-SCSFPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707337_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707334_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707333_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707332_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707331_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707330_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707327_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707326_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707325_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707324_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707323_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707322_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707321_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707320_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707319_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707318_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707317_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707316_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707314_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707313_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707311_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707310_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707309_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707308_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707307_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707306_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707305_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707304_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707303_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707302_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707301_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ707299_HBe_P-A          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JQ687529_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN182333_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN182331_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN182330_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN182328_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCPGWLWGMDIDPYKEFGATVELLS--
JN182325_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN182324_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN182321_HBe_P-A          -MQLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU679943_HBe_P-RF-BC      -MQLFHLCLII-SCSCPTVQASKLCLGWLWXMDIDXYKEFGASVELLS--
KX276853_HBe_P-C          -MQLFHLCLII-SCSCSTVQASKLCLGWLWSMDIDPYKEFGASXXLLS--
AB176643_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLS--
KY689477_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLS--
KY689426_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWXMDIDPYKEFGASVELLS--
KP718092_HBe_P-A          -MQLFHLCLII-XCTCPTVQAXKLCLGWLWGMDIDPYKEFGATVELLS--
EU185787_HBe_P-A          -MQLFHLCLII-SXXCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB697487_HBe_P-A          -MQLFHLCLII-SCXCPTVQASKLCLGWLWGMDIDPYKEFGAXVELLS--
AB697498_HBe_P-A          -MQLFHLCLII-SCXCPTVQASKLCLGWLWXMDIDPYKEFGAXVELLS--
KP718090_HBe_P-A          -MQLFHLCLII-XCTCPXVXAXKLCLGWLWGMDIDPYKEFGATVELLS--
JN182319_HBe_P-A          -MQLFXXXXXX-XXXCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN182327_HBe_P-A          -MQLXXXXXXX-XXXCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JN182334_HBe_P-A          -MQLXXXXXXX-XCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440004_HBe_P-RF-DE      -MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440005_HBe_P-RF-DE      -MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440006_HBe_P-RF-DE      -MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440008_HBe_P-RF-DE      -MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440009_HBe_P-RF-DE      -MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440010_HBe_P-RF-DE      -MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440013_HBe_P-RF-DE      -MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440014_HBe_P-RF-DE      -MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JF440015_HBe_P-RF-DE      -MQLFEEHELS-GRANPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB246348_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB270543_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB583680_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AB674407_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AF280817_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY161157_HBe_P-D          -MQLLHLCLII-SCSCPTVQASKLCLGWLWGMDTDPYKEFGATVELLS--
AY350614_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY371901_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY371902_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY371905_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY371914_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY371921_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY371922_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY721606_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY721610_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY721612_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY945307_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EF103275_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EF103277_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EF103280_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU414136_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594396_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU594397_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726854_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726862_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726869_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726874_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726878_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726887_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726888_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726895_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726898_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726900_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726902_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726907_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726909_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726914_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726918_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726919_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726923_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726924_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726930_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726931_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726940_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726962_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726964_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726967_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726971_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726972_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU726976_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU787437_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU787440_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU787441_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU787442_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU787445_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU787446_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
EU787447_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ349217_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ349228_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ349229_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ386590_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
FJ904443_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ183480_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ377589_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GQ477459_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
GU357846_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM750153_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM750154_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HM750156_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ641710_HBe_P-D          -MQLFHXCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700440_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700441_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700442_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700443_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700445_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700446_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
HQ700447_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
JX429911_HBe_P-B          -MQLFHLCLII-SCSCPTVQASKLCLGWLWDMDIDPYKEFGASVELLS-F
KP148472_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWFWGMDIDPYKEFGASVELLS-L
KP148477_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWFWGMDIDPYKEFGASVELLS-L
KM875426_HBe_P-B          MQLFLHLCLSI-SCSCPTVQASKLCLGWLWGMDIDTYKEFGASVELLS--
JX036339_HBe_P-C          ----FHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KM392084_HBe_P-B          --QIFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
GU815694_HBe_P-B          ----FHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX036335_HBe_P-C          ----FHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX036336_HBe_P-C          ----FHLCLII-SCSCPTVQASKLRLGWLWGMDIDPYKEFGASVELLS--
JX036337_HBe_P-C          ----FHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
JX036338_HBe_P-C          ----FHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX774504_HBe_P-C          ----FHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KX774503_HBe_P-C          ----FHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MH481862_HBe_P-RF-DE      -IQLFHLCLIIYVASCPTVQASKLCLGWLWGMDSDPYKEFGATMELLS--
KU605535_HBe_P-A          --QLFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
KU605536_HBe_P-A          --QIFHLCLII-SCTCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY230112_HBe_P-D          ----FHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
AY230114_HBe_P-D          ----FHFCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLS--
MF536836_HBe_P-A          -MQLFHLCLFI-SCTCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK052963_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK052966_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK052971_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK052969_HBe_P-RF-DE      -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
MK052974_HBe_P-D          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
FJ904425_HBe_P-RF-DE      -IQLFHLCLII-SCSCPTVQASKLCLGWLXGMDIDPYKEFGATVQLLS--
AB670260_HBe_P-C          -MQLFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLS--
KU668280_HBe_P-C          -MQPFHLCLII-SCSCPTVQASKLCLGWLWGMDIDPYKELGASVELLS--
                                                                            

FJ356715_HBe_P-H          FLPNDFFPSVRDLLDTASALHREALESPDHCTPNHTALRQAISCWGELM-
FJ356716_HBe_C-H          FLPSDFFPSVRDLLDTASALHRDALESPDHCTPNHTALRQAISCWGELM-
AB059659_HBe_P-H          FLPSDFYPSVRDLLDTASALHRDALESPEHCSPHHTALRQAVSCWREVT-
AB116550_HBe_P-F          FLPLDFFPNVRDLLDTASALYRDALESSEHCTPHHTALRQAILCWGELM-
KP995113_HBe_P-F          FLPPDFFPSVRDLIDTASALYRDALESPEHCTPNHTAIRQVLLCWNELM-
KP995114_HBe_P-F          FLPTDFFPSVRDLLDTASALHRDALESPEHCSPHHTAIRQAVSCWGELI-
KP995097_HBe_P-F          FLPADFFPSARDLFDTASALYRDALESPEHCTPHHTALRQAILCWGELT-
KJ638660_HBe_P-F          FLPXDFFPSXRDLIDTASALYRDALESPEHCTPNHTALRQAIVCWGEVM-
KC494399_HBe_P-F          FLPSDFYPSVRDLIDTASALYRDALESPEHCSPHHTALRQAVGCWGEVS-
JN792916_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
FJ589065_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ899150_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB365446_HBe_P-F          FLPSDFFPNVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELM-
X75663_HBe_P-F            FLASDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
EU185743_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ586803_HBe_P-RF-AF      FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTAFRQAILCWGELM-
X75658_HBe_C-F            FLPSDFFPSIRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KT896494_HBe_P-F          FLPSDFFPSARDLLDTASALYRDALESPEHCTPHHTALRQAILCWVELM-
KP995115_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWDELM-
HM590474_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
FJ657519_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
FJ589067_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ899149_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
EU185744_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB036905_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB036906_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB036907_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB036909_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB036910_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB036911_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB036912_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB036913_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB036914_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB036915_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB036916_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB036917_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB036919_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB036920_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB116549_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB116551_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB116552_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AF223962_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AF223963_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AF223964_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AF223965_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AY090458_HBe_C-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AY090461_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AY179735_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AY311369_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AY311370_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ776247_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ823086_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ823088_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ823089_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ823090_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ823091_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ823092_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ823093_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ823094_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ823095_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ899142_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ899143_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ899144_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ899145_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ899146_HBe_P-F          FLPSDFFPSVRDLFDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ899147_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
EF576812_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
EU366116_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
EU366118_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
EU670261_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
FJ657522_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
FJ657528_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
FJ657529_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
FJ709457_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
FJ709458_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
FJ709459_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
FJ709460_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
FJ709462_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
FJ709463_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
FJ709464_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
FJ709465_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
FJ709494_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HE981181_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HE981182_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM585186_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM585187_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM585188_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM585189_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM585190_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM585191_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM585192_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM585193_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM585195_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM585196_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM585197_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM585198_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM585199_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM585200_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM590471_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM590472_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM590473_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB036908_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AY090459_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP995105_HBe_P-F          FLPSDFFPSARDLLDTASALYRQALESPEHCTPHHTALRQAILCWGELM-
KJ586805_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTAFRQAILCWGELM-
JN792919_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM622135_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ899148_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP995109_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAIVCWGEVM-
KP995106_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP995104_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP995101_HBe_P-F          FLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTAIRQIILCWGELM-
KJ843225_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KC494401_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
DQ823087_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB059660_HBe_P-H          FLPTDFFPSVRDLLDTASALYRDALESPEHCTPHHTAIRQVILCWGELM-
JQ272888_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTAIRQAILCWGELM-
JN792920_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
EU366133_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM585194_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843163_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JX896133_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JX896129_HBe_P-H          FLPSDFFPSIRDLLDTASALYRDALESPEHCSPNHTAIRQAILCWGELM-
AB205010_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPSHTALRQAILCWGELM-
AB064315_HBe_P-H          FLPSDFFPSVRDLLDTATALYRDALESPEHCTPNHTALRQAILCWGELM-
MH051987_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KY476332_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KY476331_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843210_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843198_HBe_P-F          FLPSDFFPSVRDLLDTASPLYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843167_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILGWGELM-
KC494404_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KC494396_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELM-
JN792918_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTHHHTALRQAILCWGELM-
JX915624_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JX896126_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JX896125_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP995120_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP718106_HBe_P-F          FLPSDFFPSXRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KC494405_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JX079936_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JX896132_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNXTALRQAILCWGELM-
KX757665_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP995111_HBe_P-F          FLPIDFFPSVRDLLDTATALYRDALESPEHCTPHHTALRQTVLCWGELM-
JX079937_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JN792921_HBe_P-F          FLPXDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAXLCWGELM-
HE981180_HBe_P-RF-GF      FLPSDFFPSVRDLLDTASALYRDALESPEHCTPSHTALRQAILCWGELM-
HE981179_HBe_P-RF-FG      FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KX264501_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KC836867_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JX896134_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JX896131_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JX896130_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JX896128_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JX896127_HBe_P-H          FLPSDFFPSVRDLXDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JX896124_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM117851_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM117850_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM066946_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPSHTALRQAILCWGELM-
EU498228_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
EF157291_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AY090460_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AY090457_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AY090454_HBe_C-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB818694_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB375164_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB375163_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB375162_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB375161_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB375160_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB375159_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB353764_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB275308_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB266536_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB179747_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
AB059661_HBe_P-H          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
X69798_HBe_P-F            FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
MK058437_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
MH051986_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KY476322_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KY458062_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KY458061_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KY382417_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KY382416_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KY382415_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KY382411_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KX264499_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KX264498_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KX264497_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KX264496_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP995126_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP995125_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP995124_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP995123_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP995119_HBe_P-F          FLPTDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELM-
KP995118_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP995117_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP995116_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP995110_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP995098_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP718113_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP718112_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP718111_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP718109_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP718104_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KP718103_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KM998715_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KM233681_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843226_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843224_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843223_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843222_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843221_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843220_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843219_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843213_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843212_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843211_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843209_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843208_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843207_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843206_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843205_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843204_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843203_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843201_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843200_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843197_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843196_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843195_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWSEVM-
KJ843194_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843193_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843191_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALXSPEHCTPNHTALRQAILCWGELM-
KJ843190_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843189_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843185_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843181_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843180_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843179_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843178_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843177_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843176_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843175_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843174_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843171_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843170_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843169_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843168_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843164_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ638659_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWTEVM-
KJ586808_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALKSPEHCTPNHTALRQAILCWGELM-
KJ586807_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ586806_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KF199901_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KC494403_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KC494402_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KC494400_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KC494398_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KC494397_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KC494395_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KC494394_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JX899376_HBe_P-F          FLPPDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JN811656_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JN811655_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JN792922_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JN792914_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JN688703_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JN688699_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ843199_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
JN688691_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HQ420166_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HQ420165_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
HM627320_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQXILCWGELM-
HQ378247_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELM-
KJ638657_HBe_P-F          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPXHTALRQAILCWGELM-
MF488699_HBe_P-RF-DE      FLPSDFFPSVRDLLDTASALYRDALESPEHCSSHHTALRQSVLCWRELM-
AB116092_HBe_P-A          FLPSDFFPSVRDLLDTVAALFRDALESPEHCSAHHTALRQVILCWGELM-
AY161143_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCCGELM-
AY161144_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCCGELM-
AY161142_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCCGELM-
AJ627226_HBe_P-A          FLPPDFFPSARDLLDTASALFRDALESPEHCSAHHTALRQAILCWGELM-
AB116088_HBe_P-A          FLPSDFFPSVRDLLDTASALFREALESPEHCSSHHTALRQAIVCWGELM-
AB116086_HBe_P-A          FLPSDFFPSVQDLLDTASALYREALESPVHCSPHHTALRQAILCWGELR-
KJ854701_HBe_P-A          FLPSDFFPTARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDIL-
EU304331_HBe_P-A          FLPXDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELM-
EU366129_HBe_P-A          FLPSDFFPSVRDLLDTAAALFREALESPEHCSPHHTAIRQAILCWGELM-
FN545834_HBe_P-A          FLPSDFFPSARDLLETASALYREALESPEHCSPHHTALRQAILCWVELM-
AB453986_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELT-
MK512456_HBe_P-A          FLPSDFFPSARDLLETASALFREALESPEHCSPHHTALRQAILCWGELM-
GQ477476_HBe_P-A          FLPTDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELS-
FJ692607_HBe_P-A          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB453989_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELM-
EU185776_HBe_P-A          FLPSDFFPSVRDLLXTASALYREALESPEHCSPHHTALRQAILCWGELM-
EU185777_HBe_P-A          FLPSDFFPSXRDLLXTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB116076_HBe_P-A          FLPSDFFPSVRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELM-
FJ868002_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHGSPHHTALRQAILCWGELM-
FJ692558_HBe_P-A          FLPYDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
FJ692596_HBe_P-A          FLPXDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798266_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KX357649_HBe_P-A          FLPRDFYPSVRDLIDTASALFREALESPEHCSPHHTALRQAVLCWGELM-
KP857065_HBe_P-A          FLPSDFYPSVRDLLDTASALYREALESPEHCSAHHTAIRQAILCWGELM-
JQ023661_HBe_P-A          FLPSDFFPSVRDLLDTASALYREDLESPEHCSPHHTALRQAILCWGELM-
JQ023660_HBe_P-A          FLPSDFFPSVRDLLDTASALYREDLESPEHCSPHHTALRQAILCWGELM-
EF103278_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELM-
AB126580_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB116089_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQASLCWVELM-
AB014370_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-
AB064314_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB076678_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB116077_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB116078_HBe_P-A          FLPSDFFPSVRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELM-
AB116079_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB116080_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB116081_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB205118_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-
AB246337_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB246338_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB300366_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB300367_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB362931_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWVELM-
AB453979_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB453980_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB453981_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB453984_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB480036_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-
AB480038_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB480039_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB480040_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-
AB480041_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB549213_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
FN545833_HBe_P-A          FLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELM-
AB116082_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-
AB116085_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-
AB116090_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB116091_HBe_P-A          FLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELM-
AB116093_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB116094_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB241114_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB241115_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB246335_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB246336_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB453987_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB453988_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-
AB116084_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798267_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KR905426_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KT366467_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
FJ692600_HBe_P-A          FLPTDYYPSVRDLLDTASALYRXALESPEHCSPHHTALRQAXLCWGELM-
FJ692603_HBe_P-A          FLPSDFYPSVRDLLDTATALYRXXLESPEHCSPHHTALRQAILCWGELM-
KP857062_HBe_P-A          FLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELM-
M57663_HBe_P-A            FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLM-
KP168428_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAVLCWGELM-
KF214660_HBe_P-A          FLPSDFFPSVRDLQDTASALYREALESPEHCSHHHTALRQAILCWGELM-
GQ477498_HBe_P-A          FLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAVLCWGELM-
GQ161813_HBe_P-A          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELM-
FN545839_HBe_P-A          FLPXDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELM-
MF925372_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KT366466_HBe_P-A          FLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELM-
KR905427_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALEAPEHCSPHHTALRQAILCWVELM-
KR905425_HBe_P-A          FLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELM-
KJ854690_HBe_P-A          FLPSDFFPSVRDLLDTSSALYREALESPEHCSPHHTALRQAILCWGELM-
KF798265_HBe_P-A          FLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELM-
GQ331046_HBe_P-A          FLPADFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELM-
KX357644_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-
KT366471_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP168429_HBe_P-A          FLXSDFFPSVRDLLDTXSALYREALESPEHCSPHHTALRQAILWWXELM-
KJ854703_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798308_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB194949_HBe_P-RF-AE      FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELM-
MF925407_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MF925385_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MF925373_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MF772351_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
M74501_HBe_P-A            FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
LK995385_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-
LC051141_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KX686607_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KX357647_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KX357645_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KX357643_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KX357642_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KU736919_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KU736918_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KT366470_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KT366469_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KT366468_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KT151618_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KT151617_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-
KT151616_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KT151615_HBe_P-A          FLPXDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KT151613_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KT151612_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELM-
KT151611_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KR905431_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KR905430_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KR905429_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELM-
KP718086_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP718085_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP168433_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP168432_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP168430_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KM606673_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KM519452_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KM243029_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KJ854707_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KJ854706_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KJ854705_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KJ854704_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KJ854702_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KJ854700_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KJ854699_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KJ854697_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KJ854696_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KJ854694_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KJ854692_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KJ854691_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KJ854689_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KJ854688_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KJ854687_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESHEHCSPHHTALRQAILCWGELM-
KJ854686_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KJ843183_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF922428_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF922427_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF922426_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF922425_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF922424_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798314_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798311_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798310_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798309_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798302_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798292_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798291_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798290_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798289_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798286_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798285_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798279_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798278_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798271_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELM-
KF214665_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF214663_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF214662_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF214661_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRRAVLCWGELM-
KF214659_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF214657_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KC875260_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELM-
KC875258_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KC875255_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KC836846_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
FN545840_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWVELM-
FN545836_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
FJ692612_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
FJ692605_HBe_P-A          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
FN545832_HBe_P-A          FLPADFFPSVRDLLDTASALFRXALESPEHCTPHHTALRQAILCWGEXM-
GQ161797_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTAIRQAIICWGELM-
AB205188_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
KX357628_HBe_P-RF-DE      FLPADFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGDVL-
FN594767_HBe_P-RF-DE      FLPHDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAIVCWGNIM-
HM363576_HBe_P-E          FLPSDFFPSVRDLLDTGSSLCGDALESPEHCSPHHTELRQAILCWGELM-
FN594758_HBe_P-E          FLPSDFFPSVKDLLDTASALYRDALESPEHCSXHHTALRQAILCWGDLM-
EU239217_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
AF350117_HBe_P-E          FLPSDFFPSVRDLLDTASALFRDALESPEHGSPHHTALRQAILCWGDLM-
FJ904409_HBe_P-RF-DE      FLPHDFFPSVRDLLDTATALFRDALESPEHCSPHHTALRQAILCWGDVM-
MH580626_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESSEHCSPHHTALRQAILCWGDLM-
HM363575_HBe_P-E          FLPSDFFPSVRDLLDTGSSLYGDALQSPEHCSPHHTALRQAILCWGELM-
AM494703_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDVM-
AM494691_HBe_P-E          FLPNDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
GQ161796_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
MF772357_HBe_P-E          FLPADFFPSVRDLLDTASALFRDALESPEHFSPHHTALRQAILCWGDLM-
KU736911_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
KF192838_HBe_P-RF-DE      FLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLM-
KF192830_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
KF192831_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
KF192832_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
KF192834_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
KF192835_HBe_P-RF-DE      FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
KF192833_HBe_P-RF-DE      FLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLM-
KF192837_HBe_P-RF-DE      FLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLM-
KF192839_HBe_P-RF-DE      FLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLM-
KF192841_HBe_P-RF-DE      FLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLM-
MF618346_HBe_P-RF-DE      FLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLM-
MF618347_HBe_P-RF-DE      FLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLM-
KU736892_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDVM-
GQ161778_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
GQ161810_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
HM363584_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
HQ700551_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
AF350202_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
EU239223_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDIM-
KU736912_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDIM-
AF350219_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
AF350220_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
AF350101_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
AF350111_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
AF350191_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
KM606738_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
KF192840_HBe_P-RF-DE      FLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLM-
HM363604_HBe_P-E          FLPSDFFPSIRDLLDTASALFRDALESPDHCSPHHTALRQAILCWGELM-
GQ161826_HBe_P-E          FLPSDFFPSVKDLLYTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
GQ161792_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
GQ161782_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
GQ161814_HBe_P-E          FLPSDFFHSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
AB201290_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQVILCWGDLM-
AF419539_HBe_P-D          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
MH725192_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSSHHTALRQAILCWGDLM-
LT623842_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHXSPHHTALRQAILCWGDLM-
AM494711_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
GQ477457_HBe_P-D          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
MH685719_HBe_P-RF-DE      FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
KX357630_HBe_P-RF-DE      FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
KU736916_HBe_P-RF-DE      FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
KM524337_HBe_P-RF-DE      FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
KM524336_HBe_P-RF-DE      FLPSDFFPSVRDLLDTASAVYRDALESPEHCSPHHTALRQAILCWGDLM-
DQ315777_HBe_P-RF-DE      FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
MH580633_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
KU736909_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
LT623848_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
LT623849_HBe_P-E          FLPXDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
GQ161815_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGXLM-
AF350159_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
AF350182_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
AF350203_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
AB274973_HBe_P-E          FLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
AY739675_HBe_P-E          FLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
GQ161758_HBe_P-E          FLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
GQ161766_HBe_P-E          FLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
GQ161774_HBe_P-E          FLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
GQ161756_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTAFRQAILCWGDLM-
GQ161795_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
AY935700_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDVM-
GQ161790_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
GQ161808_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
GQ161833_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
HM363583_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
AB201288_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELM-
HM363591_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELM-
MF772360_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELM-
KF849725_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQACLCWGDVM-
HM363593_HBe_P-E          FLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELM-
FN594770_HBe_P-RF-DE      FLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTAFRQAILCWGELM-
HM363567_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELM-
FN545823_HBe_P-E          FLPSDFFPSVXDLLDTASALFRDALESPEHCSPHHTALRQAILCWGXLX-
GQ161760_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
FJ904435_HBe_P-D          FLPFDFFPSVRDFLDSALALYRDSLEFPEPCSPPHXALRPTLFCWGDLM-
DQ178011_HBe_P-D          FLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
DQ178012_HBe_P-D          FLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
DQ178016_HBe_P-D          FLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
DQ178020_HBe_P-D          FLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
DQ178015_HBe_P-D          FLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
DQ178018_HBe_P-D          FLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
DQ178019_HBe_P-D          FLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ700474_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MG491137_HBe_P-D          FLPSDFFTSVRDLLDTASALCREALESPEHCSPHHTALRQAILCWGELM-
MH725011_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725008_HBe_P-D          FLPSDFFPSIRDLLDTASTLYREALESPEHCSPHHTALRQAILCWGELM-
LK995390_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KM524348_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AY161141_HBe_P-RF-AD      FLPSDFFPSARDLLDTASALYREGLESPEHCSPHHTALRQAILCWGELM-
AY161140_HBe_P-RF-AD      FLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725030_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
X85302_HBe_P-D            FLPSDFFPSVRDLLDTASALYREAFECSEHCSPHHTALRQAILCWGELM-
MG491169_HBe_P-D          FLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MG491138_HBe_P-D          FLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALGQAILCWGELM-
MH725209_HBe_P-D          FLPSDFFPSVRHLLDTASALYRDALESPEHCSPHHTALRQAILCWGELM-
MH725191_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725175_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725164_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725161_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725142_HBe_P-D          FLPSDFFPSVRDLLDTASALYWEALESPEHCSPHHTALRQAILCWGELM-
MH725127_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725106_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725095_HBe_P-D          FLHFDFFPSVRHLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725082_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725072_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725070_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725040_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725037_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725035_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725032_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725029_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725025_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725016_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725013_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724997_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724961_HBe_P-D          FLPSDLFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724956_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KX196227_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KX196214_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP671692_HBe_P-D          FLPSDFFPSVRDLLDTASALYRETLKSPEHCSPHHTALRQAILCWGELM-
KP671690_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF018194_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KC875309_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALSQAILCWGELM-
KC875295_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KC875278_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KC875276_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KC774445_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN558562_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN132131_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN132128_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN040790_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JF754618_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ700473_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725208_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725174_HBe_P-D          FLPSDFFPSVRDLLDTASPLYREALESPEHCSPHHTALRQAILCWGELM-
MH724968_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESREHCSPHHTALRQAILCWGELM-
MH724967_HBe_P-D          FLPSDLFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF061170_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN040808_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
GQ377627_HBe_P-RF-CD      FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725173_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725160_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724973_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MG491192_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MG491190_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MG491168_HBe_P-D          FLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MG491165_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MG491161_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MG491157_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MG491136_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MG491127_HBe_P-D          FLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724976_HBe_P-D          FLPSDFFPSIRDLLHTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF584161_HBe_P-D          FLPSDFFPSVXBLLBTASALYREALXSPEHCSPHHTALRQAILCWGELM-
KF584163_HBe_P-D          FLPSDFFPSVXBLLBTASALYREALXSPEHCSPHHTALRQAILCWGELM-
KF584165_HBe_P-D          FLPSDFFPSVXBLLBTASALYREALXSPEHCSPHHTALRQAILCWGELM-
KF584166_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AY161146_HBe_P-RF-AD      FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AY161145_HBe_P-RF-AD      FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
X85297_HBe_P-D            FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
X85294_HBe_P-D            FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
X85259_HBe_P-D            FLPSDFFPSVRDLLDTASALYREALESPEHCSPQHTALRQAILCWGELM-
X02496_HBe_P-D            FLPSDFFPSVRDLLDNASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725211_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725210_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725207_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725206_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725205_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725203_HBe_P-D          FLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725201_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725195_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725193_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725190_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725188_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725187_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725185_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725184_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725183_HBe_P-D          FLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725182_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725181_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725180_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725179_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725178_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725176_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725170_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725169_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPYHTALRQAILCWGELM-
MH725166_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725165_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725163_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725162_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725158_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725157_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725156_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725155_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725154_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725149_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725148_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725146_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725145_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725143_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725138_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725137_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725136_HBe_P-D          FLPSDFFPSVRDLLDTASALYWEALESPEHCSPHHTALRQAILCWGELM-
MH725134_HBe_P-D          FLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725133_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725132_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725131_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725129_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725128_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725122_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725121_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725119_HBe_P-D          FLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725117_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725116_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725115_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725105_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725104_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725103_HBe_P-D          FLPSDSFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725101_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725100_HBe_P-D          FLPSDFFPSVRDLLDTASALYREPLESPEHCSPHHTALRQAILCWGELM-
MH725099_HBe_P-D          FLPSDFFPSVRDLLDTASALYREPLESPEHCSPHHTALRQAILCWGELM-
MH725098_HBe_P-D          FLPSDFFPSVRDLLDTASALYREPLESPEHCSPHHTALRQAILCWGELM-
MH725093_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725092_HBe_P-D          FLPFDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725091_HBe_P-D          FLPFDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725090_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725085_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725083_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725078_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725076_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725074_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725073_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725071_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725069_HBe_P-D          FLPSDFFPSVRHLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725062_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725060_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725059_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725058_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725057_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725056_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725055_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725053_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725052_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725051_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725049_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725048_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725047_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725046_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725044_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725041_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725039_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725034_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725028_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725027_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725026_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725023_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725022_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725019_HBe_P-D          FLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725017_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725015_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725012_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725009_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725007_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725005_HBe_P-D          FLPSDFFSSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725003_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725002_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH725001_HBe_P-D          FSPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724998_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724991_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724989_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724987_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724986_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724984_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724983_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724982_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724981_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724979_HBe_P-D          FLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724975_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724964_HBe_P-D          FLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724963_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724958_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724955_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
MH724954_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
LC365689_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KY382414_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KX827300_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KX196215_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KX196211_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KX196208_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KT366508_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KT366502_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KT366500_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KT366499_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KT366498_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP857106_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP857105_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP857104_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP671699_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP671697_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP671696_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP671694_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP671693_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP671691_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP671689_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP671688_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP671687_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP671686_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP671685_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP671684_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KP322599_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KM524339_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798283_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF798260_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF584164_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF584162_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF471656_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF471652_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF471651_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF471647_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF018191_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF018184_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KF018180_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KC875308_HBe_P-D          FLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELM-
KC875294_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KC875293_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KC875288_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KC875285_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KC875282_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KC875280_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KC875277_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KC774462_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
KC774444_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN642131_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN558561_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN257199_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN257196_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN257194_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN257193_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN257185_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN257182_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN257171_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN257155_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN257151_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN132132_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELM-
JN132130_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN132127_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN040826_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN040807_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN040806_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN040805_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN040794_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN040793_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN040792_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN040791_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN040786_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN040759_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JN040758_HBe_P-D          FLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTALRQAILCWGELM-
JF754628_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JF754624_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JF754591_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ833471_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ833470_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ833467_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ833465_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ700488_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ700487_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ700484_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ700482_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ700480_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ700479_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ700471_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ700469_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ700466_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ700464_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ700455_HBe_P-D          FLPSDFFPSVRXLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
HQ700459_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AF350161_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALKQAILCWGELM-
AM494791_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHWSPHHSAIRQAILCWGELM-
JQ687530_HBe_P-D          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLM-
DQ399006_HBe_P-D          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELM-
KF471650_HBe_P-D          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELM-
KP857115_HBe_P-D          FLPTDYFPSVRDLLDTARALYRDALESPEHCSPHHTALRQAILCWGELM-
MH725014_HBe_P-D          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELM-
JQ707704_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707682_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707683_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707684_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707685_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707686_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707687_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707688_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707689_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707690_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707691_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707692_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707693_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707694_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707696_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707697_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707698_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707699_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707700_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707701_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707702_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707703_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707705_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707706_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JQ707695_HBe_P-D          FLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELV-
AB555497_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
JN792903_HBe_P-D          FLPSDFFPSVRDLLDTASALYRDALKSPEHCSPHHTALRQAILCWGELM-
AF350142_HBe_P-E          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELM-
KC774179_HBe_P-C          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELM-
KC774297_HBe_P-C          FLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELM-
JQ707498_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLT-
JQ707509_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLT-
JQ707484_HBe_P-D          FLPSDFFPSVRDLLDTASALYRKALESPEHCSPHHTALRQAILCWGDLM-
EU594408_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
JX096955_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELM-
AB090268_HBe_P-D          FLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
AY603433_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHIALRQAILWWGDLM-
KM606745_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
GQ922001_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
JQ707476_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
JQ707478_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
JQ707479_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
JQ707481_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
JQ707482_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
JQ707485_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
JQ707487_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
JQ707488_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
JQ707489_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
JQ707490_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
MH932714_HBe_P-D          FLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLM-
JQ707508_HBe_P-D          FLPSDFFPSVRDL