HBVdb

Dataset for protein HBSP of genotype A

[Download (right click)] [Alignment] [Repertoires]

1333 sequence(s)

>gnl|hbvpro|AB014370_HBSP_P-A Product feature CHAIN AB014370_HBSP_P-A of FT:mat_peptide AB014370_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11D11HCC). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AB064314_HBSP_P-A Product feature CHAIN AB064314_HBSP_P-A of FT:mat_peptide AB064314_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGSLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB076678_HBSP_P-A Product feature CHAIN AB076678_HBSP_P-A of FT:mat_peptide AB076678_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPAGPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116076_HBSP_P-A Product feature CHAIN AB116076_HBSP_P-A of FT:mat_peptide AB116076_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA1911). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDAGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116078_HBSP_P-A Product feature CHAIN AB116078_HBSP_P-A of FT:mat_peptide AB116078_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA712). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116079_HBSP_P-A Product feature CHAIN AB116079_HBSP_P-A of FT:mat_peptide AB116079_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116080_HBSP_P-A Product feature CHAIN AB116080_HBSP_P-A of FT:mat_peptide AB116080_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116081_HBSP_P-A Product feature CHAIN AB116081_HBSP_P-A of FT:mat_peptide AB116081_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLANADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116082_HBSP_P-A Product feature CHAIN AB116082_HBSP_P-A of FT:mat_peptide AB116082_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116083_HBSP_P-A Product feature CHAIN AB116083_HBSP_P-A of FT:mat_peptide AB116083_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN36). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARVLLKATLCFPHVAVQNL
RMEIAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116084_HBSP_P-A Product feature CHAIN AB116084_HBSP_P-A of FT:mat_peptide AB116084_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN81). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDATEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116086_HBSP_P-A Product feature CHAIN AB116086_HBSP_P-A of FT:mat_peptide AB116086_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND18). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116087_HBSP_P-A Product feature CHAIN AB116087_HBSP_P-A of FT:mat_peptide AB116087_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDESEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116088_HBSP_P-A Product feature CHAIN AB116088_HBSP_P-A of FT:mat_peptide AB116088_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP30). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDNEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116089_HBSP_P-A Product feature CHAIN AB116089_HBSP_P-A of FT:mat_peptide AB116089_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP39). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLEATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116090_HBSP_P-A Product feature CHAIN AB116090_HBSP_P-A of FT:mat_peptide AB116090_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYPHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116091_HBSP_P-A Product feature CHAIN AB116091_HBSP_P-A of FT:mat_peptide AB116091_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPAREPAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116092_HBSP_P-A Product feature CHAIN AB116092_HBSP_P-A of FT:mat_peptide AB116092_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH20). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKGTLCFPHVAVQNL
RMEIAPVFPSHHLGVSQNSYGSGPQSVSLVSVY
>gnl|hbvpro|AB116093_HBSP_P-A Product feature CHAIN AB116093_HBSP_P-A of FT:mat_peptide AB116093_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB116094_HBSP_P-A Product feature CHAIN AB116094_HBSP_P-A of FT:mat_peptide AB116094_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPAREPAEPARLLLKATLRFPHVAVQNL
RVEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB126580_HBSP_P-A Product feature CHAIN AB126580_HBSP_P-A of FT:mat_peptide AB126580_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-RU204). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHARPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB194950_HBSP_P-A Product feature CHAIN AB194950_HBSP_P-A of FT:mat_peptide AB194950_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR983). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIALVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|AB194951_HBSP_P-A Product feature CHAIN AB194951_HBSP_P-A of FT:mat_peptide AB194951_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR82). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGGGPQSVSPGSVY
>gnl|hbvpro|AB194952_HBSP_P-A Product feature CHAIN AB194952_HBSP_P-A of FT:mat_peptide AB194952_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR711). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|AB205118_HBSP_P-A Product feature CHAIN AB205118_HBSP_P-A of FT:mat_peptide AB205118_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TJ1-1-2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKQLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB222707_HBSP_P-A Product feature CHAIN AB222707_HBSP_P-A of FT:mat_peptide AB222707_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate UZTBV102). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB241114_HBSP_P-A Product feature CHAIN AB241114_HBSP_P-A of FT:mat_peptide AB241114_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhHCC01). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB241115_HBSP_P-A Product feature CHAIN AB241115_HBSP_P-A of FT:mat_peptide AB241115_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhCH09). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246317_HBSP_P-A Product feature CHAIN AB246317_HBSP_P-A of FT:mat_peptide AB246317_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TA112). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPAGPAQLLLKATLCFPHVAVQNL
RTEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246335_HBSP_P-A Product feature CHAIN AB246335_HBSP_P-A of FT:mat_peptide AB246335_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246336_HBSP_P-A Product feature CHAIN AB246336_HBSP_P-A of FT:mat_peptide AB246336_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246337_HBSP_P-A Product feature CHAIN AB246337_HBSP_P-A of FT:mat_peptide AB246337_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB246338_HBSP_P-A Product feature CHAIN AB246338_HBSP_P-A of FT:mat_peptide AB246338_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB300366_HBSP_P-A Product feature CHAIN AB300366_HBSP_P-A of FT:mat_peptide AB300366_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB300367_HBSP_P-A Product feature CHAIN AB300367_HBSP_P-A of FT:mat_peptide AB300367_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB362931_HBSP_P-A Product feature CHAIN AB362931_HBSP_P-A of FT:mat_peptide AB362931_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453979_HBSP_P-A Product feature CHAIN AB453979_HBSP_P-A of FT:mat_peptide AB453979_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453980_HBSP_P-A Product feature CHAIN AB453980_HBSP_P-A of FT:mat_peptide AB453980_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453981_HBSP_P-A Product feature CHAIN AB453981_HBSP_P-A of FT:mat_peptide AB453981_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453982_HBSP_P-A Product feature CHAIN AB453982_HBSP_P-A of FT:mat_peptide AB453982_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453983_HBSP_P-A Product feature CHAIN AB453983_HBSP_P-A of FT:mat_peptide AB453983_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453984_HBSP_P-A Product feature CHAIN AB453984_HBSP_P-A of FT:mat_peptide AB453984_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH6). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453986_HBSP_P-A Product feature CHAIN AB453986_HBSP_P-A of FT:mat_peptide AB453986_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453987_HBSP_P-A Product feature CHAIN AB453987_HBSP_P-A of FT:mat_peptide AB453987_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB453989_HBSP_P-A Product feature CHAIN AB453989_HBSP_P-A of FT:mat_peptide AB453989_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB480036_HBSP_P-A Product feature CHAIN AB480036_HBSP_P-A of FT:mat_peptide AB480036_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB480038_HBSP_P-A Product feature CHAIN AB480038_HBSP_P-A of FT:mat_peptide AB480038_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB480039_HBSP_P-A Product feature CHAIN AB480039_HBSP_P-A of FT:mat_peptide AB480039_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB480040_HBSP_P-A Product feature CHAIN AB480040_HBSP_P-A of FT:mat_peptide AB480040_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB480041_HBSP_P-A Product feature CHAIN AB480041_HBSP_P-A of FT:mat_peptide AB480041_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB549213_HBSP_P-A Product feature CHAIN AB549213_HBSP_P-A of FT:mat_peptide AB549213_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697487_HBSP_P-A Product feature CHAIN AB697487_HBSP_P-A of FT:mat_peptide AB697487_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697488_HBSP_P-A Product feature CHAIN AB697488_HBSP_P-A of FT:mat_peptide AB697488_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697489_HBSP_P-A Product feature CHAIN AB697489_HBSP_P-A of FT:mat_peptide AB697489_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697491_HBSP_P-A Product feature CHAIN AB697491_HBSP_P-A of FT:mat_peptide AB697491_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No6). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697492_HBSP_P-A Product feature CHAIN AB697492_HBSP_P-A of FT:mat_peptide AB697492_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No7). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697493_HBSP_P-A Product feature CHAIN AB697493_HBSP_P-A of FT:mat_peptide AB697493_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|AB697495_HBSP_P-A Product feature CHAIN AB697495_HBSP_P-A of FT:mat_peptide AB697495_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697496_HBSP_P-A Product feature CHAIN AB697496_HBSP_P-A of FT:mat_peptide AB697496_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697497_HBSP_P-A Product feature CHAIN AB697497_HBSP_P-A of FT:mat_peptide AB697497_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697498_HBSP_P-A Product feature CHAIN AB697498_HBSP_P-A of FT:mat_peptide AB697498_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697499_HBSP_P-A Product feature CHAIN AB697499_HBSP_P-A of FT:mat_peptide AB697499_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697501_HBSP_P-A Product feature CHAIN AB697501_HBSP_P-A of FT:mat_peptide AB697501_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697503_HBSP_P-A Product feature CHAIN AB697503_HBSP_P-A of FT:mat_peptide AB697503_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697504_HBSP_P-A Product feature CHAIN AB697504_HBSP_P-A of FT:mat_peptide AB697504_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697505_HBSP_P-A Product feature CHAIN AB697505_HBSP_P-A of FT:mat_peptide AB697505_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697506_HBSP_P-A Product feature CHAIN AB697506_HBSP_P-A of FT:mat_peptide AB697506_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|AB697507_HBSP_P-A Product feature CHAIN AB697507_HBSP_P-A of FT:mat_peptide AB697507_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No29). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697508_HBSP_P-A Product feature CHAIN AB697508_HBSP_P-A of FT:mat_peptide AB697508_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697509_HBSP_P-A Product feature CHAIN AB697509_HBSP_P-A of FT:mat_peptide AB697509_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No32). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697511_HBSP_P-A Product feature CHAIN AB697511_HBSP_P-A of FT:mat_peptide AB697511_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No36). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCYPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB697512_HBSP_P-A Product feature CHAIN AB697512_HBSP_P-A of FT:mat_peptide AB697512_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No37). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB775198_HBSP_P-A Product feature CHAIN AB775198_HBSP_P-A of FT:mat_peptide AB775198_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0707). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB775199_HBSP_P-A Product feature CHAIN AB775199_HBSP_P-A of FT:mat_peptide AB775199_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0708). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB775200_HBSP_P-A Product feature CHAIN AB775200_HBSP_P-A of FT:mat_peptide AB775200_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0925). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB775201_HBSP_P-A Product feature CHAIN AB775201_HBSP_P-A of FT:mat_peptide AB775201_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0929). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB937791_HBSP_P-A Product feature CHAIN AB937791_HBSP_P-A of FT:mat_peptide AB937791_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB05-0890). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB937792_HBSP_P-A Product feature CHAIN AB937792_HBSP_P-A of FT:mat_peptide AB937792_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1205). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB937793_HBSP_P-A Product feature CHAIN AB937793_HBSP_P-A of FT:mat_peptide AB937793_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0302). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB937794_HBSP_P-A Product feature CHAIN AB937794_HBSP_P-A of FT:mat_peptide AB937794_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0666). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB937795_HBSP_P-A Product feature CHAIN AB937795_HBSP_P-A of FT:mat_peptide AB937795_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1191). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLXFPHVAVQNL
RMEIAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|AB937796_HBSP_P-A Product feature CHAIN AB937796_HBSP_P-A of FT:mat_peptide AB937796_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1196). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AB937798_HBSP_P-A Product feature CHAIN AB937798_HBSP_P-A of FT:mat_peptide AB937798_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0383). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLEATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF043560_HBSP_P-A Product feature CHAIN AF043560_HBSP_P-A of FT:mat_peptide AF043560_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF043580_HBSP_P-A Product feature CHAIN AF043580_HBSP_P-A of FT:mat_peptide AF043580_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF090838_HBSP_P-A Product feature CHAIN AF090838_HBSP_P-A of FT:mat_peptide AF090838_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNPNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF090839_HBSP_P-A Product feature CHAIN AF090839_HBSP_P-A of FT:mat_peptide AF090839_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF090840_HBSP_P-A Product feature CHAIN AF090840_HBSP_P-A of FT:mat_peptide AF090840_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF090841_HBSP_P-A Product feature CHAIN AF090841_HBSP_P-A of FT:mat_peptide AF090841_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF090842_HBSP_P-A Product feature CHAIN AF090842_HBSP_P-A of FT:mat_peptide AF090842_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF143298_HBSP_P-A Product feature CHAIN AF143298_HBSP_P-A of FT:mat_peptide AF143298_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQQFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCCPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF143302_HBSP_P-A Product feature CHAIN AF143302_HBSP_P-A of FT:mat_peptide AF143302_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHLRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNFGNLNDQQQPVRDRAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF297621_HBSP_P-A Product feature CHAIN AF297621_HBSP_P-A of FT:mat_peptide AF297621_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 78). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF297622_HBSP_P-A Product feature CHAIN AF297622_HBSP_P-A of FT:mat_peptide AF297622_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 79). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF297623_HBSP_P-A Product feature CHAIN AF297623_HBSP_P-A of FT:mat_peptide AF297623_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 83). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDAETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF297624_HBSP_P-A Product feature CHAIN AF297624_HBSP_P-A of FT:mat_peptide AF297624_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 80). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF297625_HBSP_P-A Product feature CHAIN AF297625_HBSP_P-A of FT:mat_peptide AF297625_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 84). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF536524_HBSP_P-A Product feature CHAIN AF536524_HBSP_P-A of FT:mat_peptide AF536524_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHARPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF537371_HBSP_P-A Product feature CHAIN AF537371_HBSP_P-A of FT:mat_peptide AF537371_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQRFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLDDQQQPVRNHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AF537372_HBSP_P-A Product feature CHAIN AF537372_HBSP_P-A of FT:mat_peptide AF537372_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGAEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQRQPVRDHAKPARLLLKATLRFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|AJ012207_HBSP_P-A Product feature CHAIN AJ012207_HBSP_P-A of FT:mat_peptide AJ012207_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AJ309369_HBSP_P-A Product feature CHAIN AJ309369_HBSP_P-A of FT:mat_peptide AJ309369_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AJ309370_HBSP_P-A Product feature CHAIN AJ309370_HBSP_P-A of FT:mat_peptide AJ309370_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEEPPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AJ309371_HBSP_P-A Product feature CHAIN AJ309371_HBSP_P-A of FT:mat_peptide AJ309371_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AJ344115_HBSP_P-A Product feature CHAIN AJ344115_HBSP_P-A of FT:mat_peptide AJ344115_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBsAg negative patient X27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARFLLAANLCFPHVAVQNL
RMEIAPVFPSHRLGLSQATYGSGPQSVSLGSVY
>gnl|hbvpro|AJ627226_HBSP_P-A Product feature CHAIN AJ627226_HBSP_P-A of FT:mat_peptide AJ627226_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 20952). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSIY
>gnl|hbvpro|AJ627227_HBSP_P-A Product feature CHAIN AJ627227_HBSP_P-A of FT:mat_peptide AJ627227_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 21077). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDXGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRXHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AJ627228_HBSP_P-A Product feature CHAIN AJ627228_HBSP_P-A of FT:mat_peptide AJ627228_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 34408). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQFFRKLLLLDDETEVGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AM180624_HBSP_P-A Product feature CHAIN AM180624_HBSP_P-A of FT:mat_peptide AM180624_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE168). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGXLNDPXPPVRDPAEPARLLHKATLCFPHVAVQNL
RTEIALVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|AM184125_HBSP_P-A Product feature CHAIN AM184125_HBSP_P-A of FT:mat_peptide AM184125_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate O64). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLHKATLCFPHVAVQNL
RTEIALVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|AM184126_HBSP_P-A Product feature CHAIN AM184126_HBSP_P-A of FT:mat_peptide AM184126_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLHKATLCFPHVAVQNL
RTEIALVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|AM282986_HBSP_P-A Product feature CHAIN AM282986_HBSP_P-A of FT:mat_peptide AM282986_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNEQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AM295795_HBSP_P-A Product feature CHAIN AM295795_HBSP_P-A of FT:mat_peptide AM295795_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AM295796_HBSP_P-A Product feature CHAIN AM295796_HBSP_P-A of FT:mat_peptide AM295796_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLANADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AM295797_HBSP_P-A Product feature CHAIN AM295797_HBSP_P-A of FT:mat_peptide AM295797_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AM410963_HBSP_P-A Product feature CHAIN AM410963_HBSP_P-A of FT:mat_peptide AM410963_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|AM494718_HBSP_P-A Product feature CHAIN AM494718_HBSP_P-A of FT:mat_peptide AM494718_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAR204). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAGPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGXGPQSVSLGSVY
>gnl|hbvpro|AY034878_HBSP_P-A Product feature CHAIN AY034878_HBSP_P-A of FT:mat_peptide AY034878_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVKL). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDNGTDAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|AY128092_HBSP_P-A Product feature CHAIN AY128092_HBSP_P-A of FT:mat_peptide AY128092_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY152726_HBSP_P-A Product feature CHAIN AY152726_HBSP_P-A of FT:mat_peptide AY152726_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8.22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQQVRDHAKPARLLLKATLRCPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY161138_HBSP_P-A Product feature CHAIN AY161138_HBSP_P-A of FT:mat_peptide AY161138_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY161139_HBSP_P-A Product feature CHAIN AY161139_HBSP_P-A of FT:mat_peptide AY161139_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY161142_HBSP_P-A Product feature CHAIN AY161142_HBSP_P-A of FT:mat_peptide AY161142_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEDSLRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY161143_HBSP_P-A Product feature CHAIN AY161143_HBSP_P-A of FT:mat_peptide AY161143_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY161144_HBSP_P-A Product feature CHAIN AY161144_HBSP_P-A of FT:mat_peptide AY161144_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233274_HBSP_P-A Product feature CHAIN AY233274_HBSP_P-A of FT:mat_peptide AY233274_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 0962). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAGDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233275_HBSP_P-A Product feature CHAIN AY233275_HBSP_P-A of FT:mat_peptide AY233275_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 163). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQRVRDLARPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233276_HBSP_P-A Product feature CHAIN AY233276_HBSP_P-A of FT:mat_peptide AY233276_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1839). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233278_HBSP_P-A Product feature CHAIN AY233278_HBSP_P-A of FT:mat_peptide AY233278_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233279_HBSP_P-A Product feature CHAIN AY233279_HBSP_P-A of FT:mat_peptide AY233279_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|AY233280_HBSP_P-A Product feature CHAIN AY233280_HBSP_P-A of FT:mat_peptide AY233280_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233281_HBSP_P-A Product feature CHAIN AY233281_HBSP_P-A of FT:mat_peptide AY233281_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 303). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQRVRDLARPARLLLKTTLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233282_HBSP_P-A Product feature CHAIN AY233282_HBSP_P-A of FT:mat_peptide AY233282_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 306). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233283_HBSP_P-A Product feature CHAIN AY233283_HBSP_P-A of FT:mat_peptide AY233283_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4038). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233284_HBSP_P-A Product feature CHAIN AY233284_HBSP_P-A of FT:mat_peptide AY233284_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5283). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQRVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233285_HBSP_P-A Product feature CHAIN AY233285_HBSP_P-A of FT:mat_peptide AY233285_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 795). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|AY233286_HBSP_P-A Product feature CHAIN AY233286_HBSP_P-A of FT:mat_peptide AY233286_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 818). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRGHAKPARLLLKATLCFPHVAVQHL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233287_HBSP_P-A Product feature CHAIN AY233287_HBSP_P-A of FT:mat_peptide AY233287_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8225). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGSQSVSLGSVY
>gnl|hbvpro|AY233288_HBSP_P-A Product feature CHAIN AY233288_HBSP_P-A of FT:mat_peptide AY233288_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 823). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAGPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233289_HBSP_P-A Product feature CHAIN AY233289_HBSP_P-A of FT:mat_peptide AY233289_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 833). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY233290_HBSP_P-A Product feature CHAIN AY233290_HBSP_P-A of FT:mat_peptide AY233290_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 85). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY373428_HBSP_P-A Product feature CHAIN AY373428_HBSP_P-A of FT:mat_peptide AY373428_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY373429_HBSP_P-A Product feature CHAIN AY373429_HBSP_P-A of FT:mat_peptide AY373429_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLVEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY373432_HBSP_P-A Product feature CHAIN AY373432_HBSP_P-A of FT:mat_peptide AY373432_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY707087_HBSP_P-A Product feature CHAIN AY707087_HBSP_P-A of FT:mat_peptide AY707087_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-N10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNEQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY738139_HBSP_P-A Product feature CHAIN AY738139_HBSP_P-A of FT:mat_peptide AY738139_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSWPQSVSLGSVY
>gnl|hbvpro|AY738140_HBSP_P-A Product feature CHAIN AY738140_HBSP_P-A of FT:mat_peptide AY738140_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSWPQSVSLGSVY
>gnl|hbvpro|AY738141_HBSP_P-A Product feature CHAIN AY738141_HBSP_P-A of FT:mat_peptide AY738141_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSWPQSVSLGSVY
>gnl|hbvpro|AY738142_HBSP_P-A Product feature CHAIN AY738142_HBSP_P-A of FT:mat_peptide AY738142_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSWPQSVSLGSVY
>gnl|hbvpro|AY738143_HBSP_P-A Product feature CHAIN AY738143_HBSP_P-A of FT:mat_peptide AY738143_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSWPQSVSLGSVY
>gnl|hbvpro|AY862867_HBSP_P-A Product feature CHAIN AY862867_HBSP_P-A of FT:mat_peptide AY862867_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY862868_HBSP_P-A Product feature CHAIN AY862868_HBSP_P-A of FT:mat_peptide AY862868_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY902775_HBSP_P-A Product feature CHAIN AY902775_HBSP_P-A of FT:mat_peptide AY902775_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MTB162). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY903452_HBSP_P-A Product feature CHAIN AY903452_HBSP_P-A of FT:mat_peptide AY903452_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934763_HBSP_P-A Product feature CHAIN AY934763_HBSP_P-A of FT:mat_peptide AY934763_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ik3346). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPVRGLAEAARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHHGLSENTYGSGPQSVSPGSVY
>gnl|hbvpro|AY934764_HBSP_P-A Product feature CHAIN AY934764_HBSP_P-A of FT:mat_peptide AY934764_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9210699). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHHGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|AY934765_HBSP_P-A Product feature CHAIN AY934765_HBSP_P-A of FT:mat_peptide AY934765_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24306). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQDTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934766_HBSP_P-A Product feature CHAIN AY934766_HBSP_P-A of FT:mat_peptide AY934766_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24233). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934767_HBSP_P-A Product feature CHAIN AY934767_HBSP_P-A of FT:mat_peptide AY934767_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27178). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934768_HBSP_P-A Product feature CHAIN AY934768_HBSP_P-A of FT:mat_peptide AY934768_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 25830). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVLDPAKPARLLLKATLWFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934769_HBSP_P-A Product feature CHAIN AY934769_HBSP_P-A of FT:mat_peptide AY934769_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 23719). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934770_HBSP_P-A Product feature CHAIN AY934770_HBSP_P-A of FT:mat_peptide AY934770_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 953642). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934771_HBSP_P-A Product feature CHAIN AY934771_HBSP_P-A of FT:mat_peptide AY934771_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27439). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934773_HBSP_P-A Product feature CHAIN AY934773_HBSP_P-A of FT:mat_peptide AY934773_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9414346). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAGPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|AY934774_HBSP_P-A Product feature CHAIN AY934774_HBSP_P-A of FT:mat_peptide AY934774_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9615549). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ020002_HBSP_P-A Product feature CHAIN DQ020002_HBSP_P-A of FT:mat_peptide DQ020002_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 380). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ020003_HBSP_P-A Product feature CHAIN DQ020003_HBSP_P-A of FT:mat_peptide DQ020003_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5780). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDVTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ298161_HBSP_P-A Product feature CHAIN DQ298161_HBSP_P-A of FT:mat_peptide DQ298161_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDPNDQQQPVRDHAKPARLLLKATLCFHHVAVQNL
RMEIAHVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ298162_HBSP_P-A Product feature CHAIN DQ298162_HBSP_P-A of FT:mat_peptide DQ298162_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADFNRRVTEDLDLGDPNDQQLPVRDHAKPARLLLKATLCFHHVAVQNL
RMEIAHVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ298163_HBSP_P-A Product feature CHAIN DQ298163_HBSP_P-A of FT:mat_peptide DQ298163_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDPNDQQQPVRDHAKPARLLLKATLCFPPVAVQNL
RMEIAHVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ298164_HBSP_P-A Product feature CHAIN DQ298164_HBSP_P-A of FT:mat_peptide DQ298164_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDPNDQQQPVRDHAKPARLLLKATLCFPPVAVRNL
RMEIAHVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ298165_HBSP_P-A Product feature CHAIN DQ298165_HBSP_P-A of FT:mat_peptide DQ298165_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPIEEELPRLADADPNRRVAEDLNLGDPNDQQQPVRDHAKPARLLLKATLCFPPVAVQNL
RMEIAHVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ315784_HBSP_P-A Product feature CHAIN DQ315784_HBSP_P-A of FT:mat_peptide DQ315784_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI03101). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|DQ315785_HBSP_P-A Product feature CHAIN DQ315785_HBSP_P-A of FT:mat_peptide DQ315785_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI0386). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDLAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ315786_HBSP_P-A Product feature CHAIN DQ315786_HBSP_P-A of FT:mat_peptide DQ315786_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI057). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ788725_HBSP_P-A Product feature CHAIN DQ788725_HBSP_P-A of FT:mat_peptide DQ788725_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate serum 07/92). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEELNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|DQ788728_HBSP_P-A Product feature CHAIN DQ788728_HBSP_P-A of FT:mat_peptide DQ788728_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate serum 05/96). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHLRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNFGNLNDQQQPVRDRAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF103278_HBSP_P-A Product feature CHAIN EF103278_HBSP_P-A of FT:mat_peptide EF103278_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ran60). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EF208113_HBSP_P-A Product feature CHAIN EF208113_HBSP_P-A of FT:mat_peptide EF208113_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient B, serum 05/93). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU054331_HBSP_C-A Product feature CHAIN EU054331_HBSP_C-A of FT:mat_peptide EU054331_HBSP_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLHKATLCFPHVAVQNL
RTEIALVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|EU086721_HBSP_P-A Product feature CHAIN EU086721_HBSP_P-A of FT:mat_peptide EU086721_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HRO/w4601-2002). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU185787_HBSP_P-A Product feature CHAIN EU185787_HBSP_P-A of FT:mat_peptide EU185787_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAEPARLLLKATLCFPHVAVQNL
RMEXAPVXXSHRPGLXQNTYGSGAQPVSLGSVY
>gnl|hbvpro|EU185789_HBSP_P-A Product feature CHAIN EU185789_HBSP_P-A of FT:mat_peptide EU185789_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAEPARLLLKATLCFPHVAVQNL
RMEXAPVXXSHRPGLXQNTYGSGAQPVSLGSVY
>gnl|hbvpro|EU304331_HBSP_P-A Product feature CHAIN EU304331_HBSP_P-A of FT:mat_peptide EU304331_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA84). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADZDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU366129_HBSP_P-A Product feature CHAIN EU366129_HBSP_P-A of FT:mat_peptide EU366129_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA92). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVESEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU410082_HBSP_P-A Product feature CHAIN EU410082_HBSP_P-A of FT:mat_peptide EU410082_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ph81). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU414132_HBSP_P-A Product feature CHAIN EU414132_HBSP_P-A of FT:mat_peptide EU414132_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDXGTEAGPLEEELPRLADADLNRRVAEDLNLGNXNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU414133_HBSP_P-A Product feature CHAIN EU414133_HBSP_P-A of FT:mat_peptide EU414133_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594383_HBSP_P-A Product feature CHAIN EU594383_HBSP_P-A of FT:mat_peptide EU594383_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594384_HBSP_P-A Product feature CHAIN EU594384_HBSP_P-A of FT:mat_peptide EU594384_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594385_HBSP_P-A Product feature CHAIN EU594385_HBSP_P-A of FT:mat_peptide EU594385_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594386_HBSP_P-A Product feature CHAIN EU594386_HBSP_P-A of FT:mat_peptide EU594386_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKHARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594387_HBSP_P-A Product feature CHAIN EU594387_HBSP_P-A of FT:mat_peptide EU594387_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594388_HBSP_P-A Product feature CHAIN EU594388_HBSP_P-A of FT:mat_peptide EU594388_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594389_HBSP_P-A Product feature CHAIN EU594389_HBSP_P-A of FT:mat_peptide EU594389_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594390_HBSP_P-A Product feature CHAIN EU594390_HBSP_P-A of FT:mat_peptide EU594390_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594391_HBSP_P-A Product feature CHAIN EU594391_HBSP_P-A of FT:mat_peptide EU594391_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594392_HBSP_P-A Product feature CHAIN EU594392_HBSP_P-A of FT:mat_peptide EU594392_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594393_HBSP_P-A Product feature CHAIN EU594393_HBSP_P-A of FT:mat_peptide EU594393_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594394_HBSP_P-A Product feature CHAIN EU594394_HBSP_P-A of FT:mat_peptide EU594394_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU594395_HBSP_P-A Product feature CHAIN EU594395_HBSP_P-A of FT:mat_peptide EU594395_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU747320_HBSP_P-A Product feature CHAIN EU747320_HBSP_P-A of FT:mat_peptide EU747320_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate V51). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|EU859898_HBSP_P-A Product feature CHAIN EU859898_HBSP_P-A of FT:mat_peptide EU859898_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P45). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLANADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859899_HBSP_P-A Product feature CHAIN EU859899_HBSP_P-A of FT:mat_peptide EU859899_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P44). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859900_HBSP_P-A Product feature CHAIN EU859900_HBSP_P-A of FT:mat_peptide EU859900_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P42). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859901_HBSP_P-A Product feature CHAIN EU859901_HBSP_P-A of FT:mat_peptide EU859901_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P37). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859902_HBSP_P-A Product feature CHAIN EU859902_HBSP_P-A of FT:mat_peptide EU859902_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P32). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859903_HBSP_P-A Product feature CHAIN EU859903_HBSP_P-A of FT:mat_peptide EU859903_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859904_HBSP_P-A Product feature CHAIN EU859904_HBSP_P-A of FT:mat_peptide EU859904_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P39). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859905_HBSP_P-A Product feature CHAIN EU859905_HBSP_P-A of FT:mat_peptide EU859905_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P38). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859906_HBSP_P-A Product feature CHAIN EU859906_HBSP_P-A of FT:mat_peptide EU859906_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859907_HBSP_P-A Product feature CHAIN EU859907_HBSP_P-A of FT:mat_peptide EU859907_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859908_HBSP_P-A Product feature CHAIN EU859908_HBSP_P-A of FT:mat_peptide EU859908_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859909_HBSP_P-A Product feature CHAIN EU859909_HBSP_P-A of FT:mat_peptide EU859909_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859910_HBSP_P-A Product feature CHAIN EU859910_HBSP_P-A of FT:mat_peptide EU859910_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859911_HBSP_P-A Product feature CHAIN EU859911_HBSP_P-A of FT:mat_peptide EU859911_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P26). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859912_HBSP_P-A Product feature CHAIN EU859912_HBSP_P-A of FT:mat_peptide EU859912_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLVDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859913_HBSP_P-A Product feature CHAIN EU859913_HBSP_P-A of FT:mat_peptide EU859913_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859914_HBSP_P-A Product feature CHAIN EU859914_HBSP_P-A of FT:mat_peptide EU859914_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859915_HBSP_P-A Product feature CHAIN EU859915_HBSP_P-A of FT:mat_peptide EU859915_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P07). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859916_HBSP_P-A Product feature CHAIN EU859916_HBSP_P-A of FT:mat_peptide EU859916_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P03). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859917_HBSP_P-A Product feature CHAIN EU859917_HBSP_P-A of FT:mat_peptide EU859917_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P13). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859918_HBSP_P-A Product feature CHAIN EU859918_HBSP_P-A of FT:mat_peptide EU859918_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P17). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859919_HBSP_P-A Product feature CHAIN EU859919_HBSP_P-A of FT:mat_peptide EU859919_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859920_HBSP_P-A Product feature CHAIN EU859920_HBSP_P-A of FT:mat_peptide EU859920_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859921_HBSP_P-A Product feature CHAIN EU859921_HBSP_P-A of FT:mat_peptide EU859921_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P08). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859922_HBSP_P-A Product feature CHAIN EU859922_HBSP_P-A of FT:mat_peptide EU859922_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P09). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859923_HBSP_P-A Product feature CHAIN EU859923_HBSP_P-A of FT:mat_peptide EU859923_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859924_HBSP_P-A Product feature CHAIN EU859924_HBSP_P-A of FT:mat_peptide EU859924_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859925_HBSP_P-A Product feature CHAIN EU859925_HBSP_P-A of FT:mat_peptide EU859925_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859926_HBSP_P-A Product feature CHAIN EU859926_HBSP_P-A of FT:mat_peptide EU859926_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P06). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859927_HBSP_P-A Product feature CHAIN EU859927_HBSP_P-A of FT:mat_peptide EU859927_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859928_HBSP_P-A Product feature CHAIN EU859928_HBSP_P-A of FT:mat_peptide EU859928_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P01). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859929_HBSP_P-A Product feature CHAIN EU859929_HBSP_P-A of FT:mat_peptide EU859929_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P43). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859930_HBSP_P-A Product feature CHAIN EU859930_HBSP_P-A of FT:mat_peptide EU859930_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C126). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859931_HBSP_P-A Product feature CHAIN EU859931_HBSP_P-A of FT:mat_peptide EU859931_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C96). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859932_HBSP_P-A Product feature CHAIN EU859932_HBSP_P-A of FT:mat_peptide EU859932_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C69). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859933_HBSP_P-A Product feature CHAIN EU859933_HBSP_P-A of FT:mat_peptide EU859933_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C67). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859934_HBSP_P-A Product feature CHAIN EU859934_HBSP_P-A of FT:mat_peptide EU859934_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C60). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMQIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|EU859935_HBSP_P-A Product feature CHAIN EU859935_HBSP_P-A of FT:mat_peptide EU859935_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859936_HBSP_P-A Product feature CHAIN EU859936_HBSP_P-A of FT:mat_peptide EU859936_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859937_HBSP_P-A Product feature CHAIN EU859937_HBSP_P-A of FT:mat_peptide EU859937_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859938_HBSP_P-A Product feature CHAIN EU859938_HBSP_P-A of FT:mat_peptide EU859938_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C133). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859939_HBSP_P-A Product feature CHAIN EU859939_HBSP_P-A of FT:mat_peptide EU859939_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C130). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859940_HBSP_P-A Product feature CHAIN EU859940_HBSP_P-A of FT:mat_peptide EU859940_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C122). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859941_HBSP_P-A Product feature CHAIN EU859941_HBSP_P-A of FT:mat_peptide EU859941_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C153). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859942_HBSP_P-A Product feature CHAIN EU859942_HBSP_P-A of FT:mat_peptide EU859942_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C110). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859943_HBSP_P-A Product feature CHAIN EU859943_HBSP_P-A of FT:mat_peptide EU859943_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C109). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859944_HBSP_P-A Product feature CHAIN EU859944_HBSP_P-A of FT:mat_peptide EU859944_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C105). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMETAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859945_HBSP_P-A Product feature CHAIN EU859945_HBSP_P-A of FT:mat_peptide EU859945_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C102). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859946_HBSP_P-A Product feature CHAIN EU859946_HBSP_P-A of FT:mat_peptide EU859946_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C155). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859947_HBSP_P-A Product feature CHAIN EU859947_HBSP_P-A of FT:mat_peptide EU859947_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C85). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859948_HBSP_P-A Product feature CHAIN EU859948_HBSP_P-A of FT:mat_peptide EU859948_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C151). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859949_HBSP_P-A Product feature CHAIN EU859949_HBSP_P-A of FT:mat_peptide EU859949_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C152). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859950_HBSP_P-A Product feature CHAIN EU859950_HBSP_P-A of FT:mat_peptide EU859950_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C64). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859951_HBSP_P-A Product feature CHAIN EU859951_HBSP_P-A of FT:mat_peptide EU859951_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C62). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|EU859952_HBSP_P-A Product feature CHAIN EU859952_HBSP_P-A of FT:mat_peptide EU859952_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C56). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAKDLNLGNLNEPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|EU859953_HBSP_P-A Product feature CHAIN EU859953_HBSP_P-A of FT:mat_peptide EU859953_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C55). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|EU859954_HBSP_P-A Product feature CHAIN EU859954_HBSP_P-A of FT:mat_peptide EU859954_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C42). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|EU859955_HBSP_P-A Product feature CHAIN EU859955_HBSP_P-A of FT:mat_peptide EU859955_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C39). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|EU859956_HBSP_P-A Product feature CHAIN EU859956_HBSP_P-A of FT:mat_peptide EU859956_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|FJ349222_HBSP_P-A Product feature CHAIN FJ349222_HBSP_P-A of FT:mat_peptide FJ349222_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H20). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ349224_HBSP_P-A Product feature CHAIN FJ349224_HBSP_P-A of FT:mat_peptide FJ349224_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H71). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ349296_HBSP_P-A Product feature CHAIN FJ349296_HBSP_P-A of FT:mat_peptide FJ349296_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FJ692554_HBSP_P-A Product feature CHAIN FJ692554_HBSP_P-A of FT:mat_peptide FJ692554_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24063). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAKAARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|FJ692557_HBSP_P-A Product feature CHAIN FJ692557_HBSP_P-A of FT:mat_peptide FJ692557_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48004). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692558_HBSP_P-A Product feature CHAIN FJ692558_HBSP_P-A of FT:mat_peptide FJ692558_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48008). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETVAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPPVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692559_HBSP_P-A Product feature CHAIN FJ692559_HBSP_P-A of FT:mat_peptide FJ692559_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48032). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQXFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGXLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692561_HBSP_P-A Product feature CHAIN FJ692561_HBSP_P-A of FT:mat_peptide FJ692561_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48040). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRXLLLLDVEPEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692562_HBSP_P-A Product feature CHAIN FJ692562_HBSP_P-A of FT:mat_peptide FJ692562_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48044). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692563_HBSP_P-A Product feature CHAIN FJ692563_HBSP_P-A of FT:mat_peptide FJ692563_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48049). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692564_HBSP_P-A Product feature CHAIN FJ692564_HBSP_P-A of FT:mat_peptide FJ692564_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48074). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692565_HBSP_P-A Product feature CHAIN FJ692565_HBSP_P-A of FT:mat_peptide FJ692565_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48077). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEXEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692566_HBSP_P-A Product feature CHAIN FJ692566_HBSP_P-A of FT:mat_peptide FJ692566_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48090). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692567_HBSP_P-A Product feature CHAIN FJ692567_HBSP_P-A of FT:mat_peptide FJ692567_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48113). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNXNDQQPPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692570_HBSP_P-A Product feature CHAIN FJ692570_HBSP_P-A of FT:mat_peptide FJ692570_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50010). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPAXLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692571_HBSP_P-A Product feature CHAIN FJ692571_HBSP_P-A of FT:mat_peptide FJ692571_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50011). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRHVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692572_HBSP_P-A Product feature CHAIN FJ692572_HBSP_P-A of FT:mat_peptide FJ692572_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50013). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLXFPHVAVQNL
RMEIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692574_HBSP_P-A Product feature CHAIN FJ692574_HBSP_P-A of FT:mat_peptide FJ692574_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50015). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692575_HBSP_P-A Product feature CHAIN FJ692575_HBSP_P-A of FT:mat_peptide FJ692575_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50020). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEXGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692576_HBSP_P-A Product feature CHAIN FJ692576_HBSP_P-A of FT:mat_peptide FJ692576_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50022). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLEDDPEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692577_HBSP_P-A Product feature CHAIN FJ692577_HBSP_P-A of FT:mat_peptide FJ692577_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50024). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692578_HBSP_P-A Product feature CHAIN FJ692578_HBSP_P-A of FT:mat_peptide FJ692578_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50083). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692579_HBSP_P-A Product feature CHAIN FJ692579_HBSP_P-A of FT:mat_peptide FJ692579_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50084). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692580_HBSP_P-A Product feature CHAIN FJ692580_HBSP_P-A of FT:mat_peptide FJ692580_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50085). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692581_HBSP_P-A Product feature CHAIN FJ692581_HBSP_P-A of FT:mat_peptide FJ692581_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50086). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692582_HBSP_P-A Product feature CHAIN FJ692582_HBSP_P-A of FT:mat_peptide FJ692582_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50088). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692583_HBSP_P-A Product feature CHAIN FJ692583_HBSP_P-A of FT:mat_peptide FJ692583_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50089). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692584_HBSP_P-A Product feature CHAIN FJ692584_HBSP_P-A of FT:mat_peptide FJ692584_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50090). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692585_HBSP_P-A Product feature CHAIN FJ692585_HBSP_P-A of FT:mat_peptide FJ692585_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50091). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692586_HBSP_P-A Product feature CHAIN FJ692586_HBSP_P-A of FT:mat_peptide FJ692586_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50099). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEXLNRRVAEDLNLGNLNDQQRPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692587_HBSP_P-A Product feature CHAIN FJ692587_HBSP_P-A of FT:mat_peptide FJ692587_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50115). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDATEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692588_HBSP_P-A Product feature CHAIN FJ692588_HBSP_P-A of FT:mat_peptide FJ692588_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50119). Complete genome. [Hepadnaviridae] (length=114 residues).
MPLSYQHFRKLLLLDDETGKAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQN
LRMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692590_HBSP_P-A Product feature CHAIN FJ692590_HBSP_P-A of FT:mat_peptide FJ692590_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50152). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692591_HBSP_P-A Product feature CHAIN FJ692591_HBSP_P-A of FT:mat_peptide FJ692591_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50167). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAHVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692592_HBSP_P-A Product feature CHAIN FJ692592_HBSP_P-A of FT:mat_peptide FJ692592_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50175). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692593_HBSP_P-A Product feature CHAIN FJ692593_HBSP_P-A of FT:mat_peptide FJ692593_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48054). Non-functional genomic sequence. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNLRT
EIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692595_HBSP_P-A Product feature CHAIN FJ692595_HBSP_P-A of FT:mat_peptide FJ692595_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48093). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDNDTEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIALVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692596_HBSP_P-A Product feature CHAIN FJ692596_HBSP_P-A of FT:mat_peptide FJ692596_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48103). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692597_HBSP_P-A Product feature CHAIN FJ692597_HBSP_P-A of FT:mat_peptide FJ692597_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48125). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDXXSEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692598_HBSP_P-A Product feature CHAIN FJ692598_HBSP_P-A of FT:mat_peptide FJ692598_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50018). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692599_HBSP_P-A Product feature CHAIN FJ692599_HBSP_P-A of FT:mat_peptide FJ692599_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50033). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYRHFLKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692600_HBSP_P-A Product feature CHAIN FJ692600_HBSP_P-A of FT:mat_peptide FJ692600_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50034). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDXTEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSXNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692601_HBSP_P-A Product feature CHAIN FJ692601_HBSP_P-A of FT:mat_peptide FJ692601_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50035). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692602_HBSP_P-A Product feature CHAIN FJ692602_HBSP_P-A of FT:mat_peptide FJ692602_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50041). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692603_HBSP_P-A Product feature CHAIN FJ692603_HBSP_P-A of FT:mat_peptide FJ692603_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50050). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEELNHRVAEDLNLGNLNDPQPPVRDPAEPALLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692604_HBSP_P-A Product feature CHAIN FJ692604_HBSP_P-A of FT:mat_peptide FJ692604_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50052). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692605_HBSP_P-A Product feature CHAIN FJ692605_HBSP_P-A of FT:mat_peptide FJ692605_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50059). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDVLPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692606_HBSP_P-A Product feature CHAIN FJ692606_HBSP_P-A of FT:mat_peptide FJ692606_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50061). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPXVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692607_HBSP_P-A Product feature CHAIN FJ692607_HBSP_P-A of FT:mat_peptide FJ692607_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50068). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692608_HBSP_P-A Product feature CHAIN FJ692608_HBSP_P-A of FT:mat_peptide FJ692608_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50075). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692609_HBSP_P-A Product feature CHAIN FJ692609_HBSP_P-A of FT:mat_peptide FJ692609_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50098). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDVLPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
WTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692610_HBSP_P-A Product feature CHAIN FJ692610_HBSP_P-A of FT:mat_peptide FJ692610_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50104). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEXEAGPLEDVLPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
WTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692611_HBSP_P-A Product feature CHAIN FJ692611_HBSP_P-A of FT:mat_peptide FJ692611_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50127). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692612_HBSP_P-A Product feature CHAIN FJ692612_HBSP_P-A of FT:mat_peptide FJ692612_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50132). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVPNL
RTEIAPVFPSHHPGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|FJ692613_HBSP_P-A Product feature CHAIN FJ692613_HBSP_P-A of FT:mat_peptide FJ692613_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50156). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDDEIEAGPLEDELPRLADEDLNHRVAEDLNLGNLTDPQPPVRDPAEPARLLLKATLYYPHVAVPNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ904411_HBSP_P-A Product feature CHAIN FJ904411_HBSP_P-A of FT:mat_peptide FJ904411_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A55). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FJ904434_HBSP_P-A Product feature CHAIN FJ904434_HBSP_P-A of FT:mat_peptide FJ904434_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B21). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMETAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FM199974_HBSP_P-A Product feature CHAIN FM199974_HBSP_P-A of FT:mat_peptide FM199974_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FM199975_HBSP_P-A Product feature CHAIN FM199975_HBSP_P-A of FT:mat_peptide FM199975_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSXQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FM199976_HBSP_P-A Product feature CHAIN FM199976_HBSP_P-A of FT:mat_peptide FM199976_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEXGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FM199977_HBSP_P-A Product feature CHAIN FM199977_HBSP_P-A of FT:mat_peptide FM199977_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FM199978_HBSP_P-A Product feature CHAIN FM199978_HBSP_P-A of FT:mat_peptide FM199978_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FM199979_HBSP_P-A Product feature CHAIN FM199979_HBSP_P-A of FT:mat_peptide FM199979_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FM199980_HBSP_P-A Product feature CHAIN FM199980_HBSP_P-A of FT:mat_peptide FM199980_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAXLCFPHVAVQNL
RLEIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|FM199981_HBSP_P-A Product feature CHAIN FM199981_HBSP_P-A of FT:mat_peptide FM199981_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRXVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|FN545825_HBSP_P-A Product feature CHAIN FN545825_HBSP_P-A of FT:mat_peptide FN545825_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEXLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545826_HBSP_P-A Product feature CHAIN FN545826_HBSP_P-A of FT:mat_peptide FN545826_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQRPVQDPAKPARLLLKATLCFPHVXVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545828_HBSP_P-A Product feature CHAIN FN545828_HBSP_P-A of FT:mat_peptide FN545828_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTQAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHHGLSQNTYGSGPQSVSXGSVY
>gnl|hbvpro|FN545829_HBSP_P-A Product feature CHAIN FN545829_HBSP_P-A of FT:mat_peptide FN545829_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTELGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCSPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545830_HBSP_P-A Product feature CHAIN FN545830_HBSP_P-A of FT:mat_peptide FN545830_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPRPPXRDPAEPARLLLKATLCFPPVVVQNL
RTEIAPVFPSPHHGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545831_HBSP_P-A Product feature CHAIN FN545831_HBSP_P-A of FT:mat_peptide FN545831_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLNDPQPPARDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545833_HBSP_P-A Product feature CHAIN FN545833_HBSP_P-A of FT:mat_peptide FN545833_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPPVVVQNL
RTEIAPVFPSHXPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545834_HBSP_P-A Product feature CHAIN FN545834_HBSP_P-A of FT:mat_peptide FN545834_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPPVVVQNL
RTEIAPVFPSHRPGLSQBXYGSGPQSVSPGSVY
>gnl|hbvpro|FN545835_HBSP_P-A Product feature CHAIN FN545835_HBSP_P-A of FT:mat_peptide FN545835_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHHGLSQNTYGGGPQSVSPGSVY
>gnl|hbvpro|FN545836_HBSP_P-A Product feature CHAIN FN545836_HBSP_P-A of FT:mat_peptide FN545836_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLNDPQLPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545837_HBSP_P-A Product feature CHAIN FN545837_HBSP_P-A of FT:mat_peptide FN545837_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARXPAKPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545838_HBSP_P-A Product feature CHAIN FN545838_HBSP_P-A of FT:mat_peptide FN545838_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDYGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545839_HBSP_P-A Product feature CHAIN FN545839_HBSP_P-A of FT:mat_peptide FN545839_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLXVGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|FN545840_HBSP_P-A Product feature CHAIN FN545840_HBSP_P-A of FT:mat_peptide FN545840_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|GQ161813_HBSP_P-A Product feature CHAIN GQ161813_HBSP_P-A of FT:mat_peptide GQ161813_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GU1021). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHHGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|GQ184323_HBSP_P-A Product feature CHAIN GQ184323_HBSP_P-A of FT:mat_peptide GQ184323_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1121). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|GQ184324_HBSP_P-A Product feature CHAIN GQ184324_HBSP_P-A of FT:mat_peptide GQ184324_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1122). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|GQ331046_HBSP_P-A Product feature CHAIN GQ331046_HBSP_P-A of FT:mat_peptide GQ331046_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-188). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADEDLNRRVAEDLNLGNPNEPQQPVRDPAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|GQ331047_HBSP_P-A Product feature CHAIN GQ331047_HBSP_P-A of FT:mat_peptide GQ331047_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-56). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAKDLNLGNPNEPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|GQ414522_HBSP_P-A Product feature CHAIN GQ414522_HBSP_P-A of FT:mat_peptide GQ414522_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477461_HBSP_P-A Product feature CHAIN GQ477461_HBSP_P-A of FT:mat_peptide GQ477461_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477462_HBSP_P-A Product feature CHAIN GQ477462_HBSP_P-A of FT:mat_peptide GQ477462_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLHLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477463_HBSP_P-A Product feature CHAIN GQ477463_HBSP_P-A of FT:mat_peptide GQ477463_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5). Complete genome. [Hepadnaviridae] (length=114 residues).
MPLSYQLFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVYW
>gnl|hbvpro|GQ477464_HBSP_P-A Product feature CHAIN GQ477464_HBSP_P-A of FT:mat_peptide GQ477464_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477465_HBSP_P-A Product feature CHAIN GQ477465_HBSP_P-A of FT:mat_peptide GQ477465_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLFVDDGSEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477466_HBSP_P-A Product feature CHAIN GQ477466_HBSP_P-A of FT:mat_peptide GQ477466_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P12). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477467_HBSP_P-A Product feature CHAIN GQ477467_HBSP_P-A of FT:mat_peptide GQ477467_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477468_HBSP_P-A Product feature CHAIN GQ477468_HBSP_P-A of FT:mat_peptide GQ477468_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477469_HBSP_P-A Product feature CHAIN GQ477469_HBSP_P-A of FT:mat_peptide GQ477469_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQSFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477470_HBSP_P-A Product feature CHAIN GQ477470_HBSP_P-A of FT:mat_peptide GQ477470_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477472_HBSP_P-A Product feature CHAIN GQ477472_HBSP_P-A of FT:mat_peptide GQ477472_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQYFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRHGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477473_HBSP_P-A Product feature CHAIN GQ477473_HBSP_P-A of FT:mat_peptide GQ477473_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477475_HBSP_P-A Product feature CHAIN GQ477475_HBSP_P-A of FT:mat_peptide GQ477475_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477476_HBSP_P-A Product feature CHAIN GQ477476_HBSP_P-A of FT:mat_peptide GQ477476_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|GQ477477_HBSP_P-A Product feature CHAIN GQ477477_HBSP_P-A of FT:mat_peptide GQ477477_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNEQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477478_HBSP_P-A Product feature CHAIN GQ477478_HBSP_P-A of FT:mat_peptide GQ477478_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P34). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKILLLDHGAEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARFLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477479_HBSP_P-A Product feature CHAIN GQ477479_HBSP_P-A of FT:mat_peptide GQ477479_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477480_HBSP_P-A Product feature CHAIN GQ477480_HBSP_P-A of FT:mat_peptide GQ477480_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIALVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477482_HBSP_P-A Product feature CHAIN GQ477482_HBSP_P-A of FT:mat_peptide GQ477482_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P46). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477484_HBSP_P-A Product feature CHAIN GQ477484_HBSP_P-A of FT:mat_peptide GQ477484_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P54). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDSTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIALVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477487_HBSP_P-A Product feature CHAIN GQ477487_HBSP_P-A of FT:mat_peptide GQ477487_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P60). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477488_HBSP_P-A Product feature CHAIN GQ477488_HBSP_P-A of FT:mat_peptide GQ477488_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P64). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRHGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477490_HBSP_P-A Product feature CHAIN GQ477490_HBSP_P-A of FT:mat_peptide GQ477490_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P74). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477491_HBSP_P-A Product feature CHAIN GQ477491_HBSP_P-A of FT:mat_peptide GQ477491_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P75). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477493_HBSP_P-A Product feature CHAIN GQ477493_HBSP_P-A of FT:mat_peptide GQ477493_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P79). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477494_HBSP_P-A Product feature CHAIN GQ477494_HBSP_P-A of FT:mat_peptide GQ477494_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P80). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRGHAKPARLLLKATLCFPPVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477495_HBSP_P-A Product feature CHAIN GQ477495_HBSP_P-A of FT:mat_peptide GQ477495_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P89). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKTALCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477496_HBSP_P-A Product feature CHAIN GQ477496_HBSP_P-A of FT:mat_peptide GQ477496_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P94). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTESGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477497_HBSP_P-A Product feature CHAIN GQ477497_HBSP_P-A of FT:mat_peptide GQ477497_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P98). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLTDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477498_HBSP_P-A Product feature CHAIN GQ477498_HBSP_P-A of FT:mat_peptide GQ477498_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P100). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPPVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477499_HBSP_P-A Product feature CHAIN GQ477499_HBSP_P-A of FT:mat_peptide GQ477499_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P105). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADANLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477500_HBSP_P-A Product feature CHAIN GQ477500_HBSP_P-A of FT:mat_peptide GQ477500_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P107). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVH
>gnl|hbvpro|GQ477501_HBSP_P-A Product feature CHAIN GQ477501_HBSP_P-A of FT:mat_peptide GQ477501_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P116). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQCFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHCPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477502_HBSP_P-A Product feature CHAIN GQ477502_HBSP_P-A of FT:mat_peptide GQ477502_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P123). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDHETEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMETAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477503_HBSP_P-A Product feature CHAIN GQ477503_HBSP_P-A of FT:mat_peptide GQ477503_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P130). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GQ477504_HBSP_P-A Product feature CHAIN GQ477504_HBSP_P-A of FT:mat_peptide GQ477504_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P131). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVQDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563545_HBSP_P-A Product feature CHAIN GU563545_HBSP_P-A of FT:mat_peptide GU563545_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563546_HBSP_P-A Product feature CHAIN GU563546_HBSP_P-A of FT:mat_peptide GU563546_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-66). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563547_HBSP_P-A Product feature CHAIN GU563547_HBSP_P-A of FT:mat_peptide GU563547_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563548_HBSP_P-A Product feature CHAIN GU563548_HBSP_P-A of FT:mat_peptide GU563548_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-108). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563550_HBSP_P-A Product feature CHAIN GU563550_HBSP_P-A of FT:mat_peptide GU563550_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-204). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|GU563551_HBSP_P-A Product feature CHAIN GU563551_HBSP_P-A of FT:mat_peptide GU563551_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-124). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563553_HBSP_P-A Product feature CHAIN GU563553_HBSP_P-A of FT:mat_peptide GU563553_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563554_HBSP_P-A Product feature CHAIN GU563554_HBSP_P-A of FT:mat_peptide GU563554_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563555_HBSP_P-A Product feature CHAIN GU563555_HBSP_P-A of FT:mat_peptide GU563555_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563557_HBSP_P-A Product feature CHAIN GU563557_HBSP_P-A of FT:mat_peptide GU563557_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-78). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563558_HBSP_P-A Product feature CHAIN GU563558_HBSP_P-A of FT:mat_peptide GU563558_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-90). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|GU563562_HBSP_P-A Product feature CHAIN GU563562_HBSP_P-A of FT:mat_peptide GU563562_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-189). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HE576988_HBSP_P-A Product feature CHAIN HE576988_HBSP_P-A of FT:mat_peptide HE576988_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5.9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAEPARLLLKATLCFPHVAVQNL
RKEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HE576989_HBSP_P-A Product feature CHAIN HE576989_HBSP_P-A of FT:mat_peptide HE576989_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P2.2.11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAEPARLLLKATLCFPHVAVQNL
RKEIAPVFPSHCPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM011485_HBSP_P-A Product feature CHAIN HM011485_HBSP_P-A of FT:mat_peptide HM011485_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETKAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM363612_HBSP_P-A Product feature CHAIN HM363612_HBSP_P-A of FT:mat_peptide HM363612_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM363613_HBSP_P-A Product feature CHAIN HM363613_HBSP_P-A of FT:mat_peptide HM363613_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate V103). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|HM535200_HBSP_P-A Product feature CHAIN HM535200_HBSP_P-A of FT:mat_peptide HM535200_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 947 Harare). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|HM535205_HBSP_P-A Product feature CHAIN HM535205_HBSP_P-A of FT:mat_peptide HM535205_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 72 Mutare). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPPVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|JF439720_HBSP_P-A Product feature CHAIN JF439720_HBSP_P-A of FT:mat_peptide JF439720_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL437). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439721_HBSP_P-A Product feature CHAIN JF439721_HBSP_P-A of FT:mat_peptide JF439721_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL444). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439722_HBSP_P-A Product feature CHAIN JF439722_HBSP_P-A of FT:mat_peptide JF439722_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL445). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439723_HBSP_P-A Product feature CHAIN JF439723_HBSP_P-A of FT:mat_peptide JF439723_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL448). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439724_HBSP_P-A Product feature CHAIN JF439724_HBSP_P-A of FT:mat_peptide JF439724_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL450). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439725_HBSP_P-A Product feature CHAIN JF439725_HBSP_P-A of FT:mat_peptide JF439725_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL451). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPSSVY
>gnl|hbvpro|JF439727_HBSP_P-A Product feature CHAIN JF439727_HBSP_P-A of FT:mat_peptide JF439727_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL453). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPSSVY
>gnl|hbvpro|JF439728_HBSP_P-A Product feature CHAIN JF439728_HBSP_P-A of FT:mat_peptide JF439728_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL454). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPSSVY
>gnl|hbvpro|JF439729_HBSP_P-A Product feature CHAIN JF439729_HBSP_P-A of FT:mat_peptide JF439729_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439730_HBSP_P-A Product feature CHAIN JF439730_HBSP_P-A of FT:mat_peptide JF439730_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL456). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439732_HBSP_P-A Product feature CHAIN JF439732_HBSP_P-A of FT:mat_peptide JF439732_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL459). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439733_HBSP_P-A Product feature CHAIN JF439733_HBSP_P-A of FT:mat_peptide JF439733_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL460). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439735_HBSP_P-A Product feature CHAIN JF439735_HBSP_P-A of FT:mat_peptide JF439735_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL462). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439736_HBSP_P-A Product feature CHAIN JF439736_HBSP_P-A of FT:mat_peptide JF439736_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL463). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439737_HBSP_P-A Product feature CHAIN JF439737_HBSP_P-A of FT:mat_peptide JF439737_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL465). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439738_HBSP_P-A Product feature CHAIN JF439738_HBSP_P-A of FT:mat_peptide JF439738_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL466). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439739_HBSP_P-A Product feature CHAIN JF439739_HBSP_P-A of FT:mat_peptide JF439739_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL467). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLEATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439740_HBSP_P-A Product feature CHAIN JF439740_HBSP_P-A of FT:mat_peptide JF439740_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL468). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPSSVY
>gnl|hbvpro|JF439741_HBSP_P-A Product feature CHAIN JF439741_HBSP_P-A of FT:mat_peptide JF439741_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL469). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPSSVY
>gnl|hbvpro|JF439742_HBSP_P-A Product feature CHAIN JF439742_HBSP_P-A of FT:mat_peptide JF439742_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL471). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439743_HBSP_P-A Product feature CHAIN JF439743_HBSP_P-A of FT:mat_peptide JF439743_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL472). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439745_HBSP_P-A Product feature CHAIN JF439745_HBSP_P-A of FT:mat_peptide JF439745_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL474). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439746_HBSP_P-A Product feature CHAIN JF439746_HBSP_P-A of FT:mat_peptide JF439746_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL485). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439747_HBSP_P-A Product feature CHAIN JF439747_HBSP_P-A of FT:mat_peptide JF439747_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL489). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYRHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439748_HBSP_P-A Product feature CHAIN JF439748_HBSP_P-A of FT:mat_peptide JF439748_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL490). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDPNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNSYGSGPQSVSPGSVY
>gnl|hbvpro|JF439750_HBSP_P-A Product feature CHAIN JF439750_HBSP_P-A of FT:mat_peptide JF439750_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL498). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPSSVY
>gnl|hbvpro|JF439751_HBSP_P-A Product feature CHAIN JF439751_HBSP_P-A of FT:mat_peptide JF439751_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL499). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439752_HBSP_P-A Product feature CHAIN JF439752_HBSP_P-A of FT:mat_peptide JF439752_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439753_HBSP_P-A Product feature CHAIN JF439753_HBSP_P-A of FT:mat_peptide JF439753_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439754_HBSP_P-A Product feature CHAIN JF439754_HBSP_P-A of FT:mat_peptide JF439754_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439755_HBSP_P-A Product feature CHAIN JF439755_HBSP_P-A of FT:mat_peptide JF439755_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A4). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439756_HBSP_P-A Product feature CHAIN JF439756_HBSP_P-A of FT:mat_peptide JF439756_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439757_HBSP_P-A Product feature CHAIN JF439757_HBSP_P-A of FT:mat_peptide JF439757_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439758_HBSP_P-A Product feature CHAIN JF439758_HBSP_P-A of FT:mat_peptide JF439758_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439759_HBSP_P-A Product feature CHAIN JF439759_HBSP_P-A of FT:mat_peptide JF439759_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439760_HBSP_P-A Product feature CHAIN JF439760_HBSP_P-A of FT:mat_peptide JF439760_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439761_HBSP_P-A Product feature CHAIN JF439761_HBSP_P-A of FT:mat_peptide JF439761_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439762_HBSP_P-A Product feature CHAIN JF439762_HBSP_P-A of FT:mat_peptide JF439762_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439763_HBSP_P-A Product feature CHAIN JF439763_HBSP_P-A of FT:mat_peptide JF439763_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439764_HBSP_P-A Product feature CHAIN JF439764_HBSP_P-A of FT:mat_peptide JF439764_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439765_HBSP_P-A Product feature CHAIN JF439765_HBSP_P-A of FT:mat_peptide JF439765_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439766_HBSP_P-A Product feature CHAIN JF439766_HBSP_P-A of FT:mat_peptide JF439766_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439767_HBSP_P-A Product feature CHAIN JF439767_HBSP_P-A of FT:mat_peptide JF439767_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439768_HBSP_P-A Product feature CHAIN JF439768_HBSP_P-A of FT:mat_peptide JF439768_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439769_HBSP_P-A Product feature CHAIN JF439769_HBSP_P-A of FT:mat_peptide JF439769_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439770_HBSP_P-A Product feature CHAIN JF439770_HBSP_P-A of FT:mat_peptide JF439770_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B12). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439771_HBSP_P-A Product feature CHAIN JF439771_HBSP_P-A of FT:mat_peptide JF439771_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C3). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439772_HBSP_P-A Product feature CHAIN JF439772_HBSP_P-A of FT:mat_peptide JF439772_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C5). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439773_HBSP_P-A Product feature CHAIN JF439773_HBSP_P-A of FT:mat_peptide JF439773_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C7). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439774_HBSP_P-A Product feature CHAIN JF439774_HBSP_P-A of FT:mat_peptide JF439774_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439775_HBSP_P-A Product feature CHAIN JF439775_HBSP_P-A of FT:mat_peptide JF439775_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C9). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439777_HBSP_P-A Product feature CHAIN JF439777_HBSP_P-A of FT:mat_peptide JF439777_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05D2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439778_HBSP_P-A Product feature CHAIN JF439778_HBSP_P-A of FT:mat_peptide JF439778_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05D3). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF439819_HBSP_P-A Product feature CHAIN JF439819_HBSP_P-A of FT:mat_peptide JF439819_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97A1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPERDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439820_HBSP_P-A Product feature CHAIN JF439820_HBSP_P-A of FT:mat_peptide JF439820_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97B1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRGHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439821_HBSP_P-A Product feature CHAIN JF439821_HBSP_P-A of FT:mat_peptide JF439821_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97B2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTDAGSLKEELPRLADADLNRRVAEDLXLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSIGSVY
>gnl|hbvpro|JF439822_HBSP_P-A Product feature CHAIN JF439822_HBSP_P-A of FT:mat_peptide JF439822_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97C1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNFGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439823_HBSP_P-A Product feature CHAIN JF439823_HBSP_P-A of FT:mat_peptide JF439823_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97C2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPERDHAKPARLLLKATLCFPHVAVQNL
RMEVAPVSPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439824_HBSP_P-A Product feature CHAIN JF439824_HBSP_P-A of FT:mat_peptide JF439824_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97D1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439825_HBSP_P-A Product feature CHAIN JF439825_HBSP_P-A of FT:mat_peptide JF439825_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97D2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439826_HBSP_P-A Product feature CHAIN JF439826_HBSP_P-A of FT:mat_peptide JF439826_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97E1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439827_HBSP_P-A Product feature CHAIN JF439827_HBSP_P-A of FT:mat_peptide JF439827_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97E2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPERDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439828_HBSP_P-A Product feature CHAIN JF439828_HBSP_P-A of FT:mat_peptide JF439828_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97F1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439829_HBSP_P-A Product feature CHAIN JF439829_HBSP_P-A of FT:mat_peptide JF439829_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97F2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439830_HBSP_P-A Product feature CHAIN JF439830_HBSP_P-A of FT:mat_peptide JF439830_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97G2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439831_HBSP_P-A Product feature CHAIN JF439831_HBSP_P-A of FT:mat_peptide JF439831_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97H1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439832_HBSP_P-A Product feature CHAIN JF439832_HBSP_P-A of FT:mat_peptide JF439832_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97H2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDRQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439833_HBSP_P-A Product feature CHAIN JF439833_HBSP_P-A of FT:mat_peptide JF439833_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99H4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439834_HBSP_P-A Product feature CHAIN JF439834_HBSP_P-A of FT:mat_peptide JF439834_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99A4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439835_HBSP_P-A Product feature CHAIN JF439835_HBSP_P-A of FT:mat_peptide JF439835_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99B3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439836_HBSP_P-A Product feature CHAIN JF439836_HBSP_P-A of FT:mat_peptide JF439836_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99B4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDNAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439837_HBSP_P-A Product feature CHAIN JF439837_HBSP_P-A of FT:mat_peptide JF439837_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99C3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439838_HBSP_P-A Product feature CHAIN JF439838_HBSP_P-A of FT:mat_peptide JF439838_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99C4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPAFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439839_HBSP_P-A Product feature CHAIN JF439839_HBSP_P-A of FT:mat_peptide JF439839_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99D3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439840_HBSP_P-A Product feature CHAIN JF439840_HBSP_P-A of FT:mat_peptide JF439840_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99D4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDNAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439841_HBSP_P-A Product feature CHAIN JF439841_HBSP_P-A of FT:mat_peptide JF439841_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99E4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439842_HBSP_P-A Product feature CHAIN JF439842_HBSP_P-A of FT:mat_peptide JF439842_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99F3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSISHGSVY
>gnl|hbvpro|JF439843_HBSP_P-A Product feature CHAIN JF439843_HBSP_P-A of FT:mat_peptide JF439843_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99F4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLPLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439844_HBSP_P-A Product feature CHAIN JF439844_HBSP_P-A of FT:mat_peptide JF439844_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99H3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439845_HBSP_P-A Product feature CHAIN JF439845_HBSP_P-A of FT:mat_peptide JF439845_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00H6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439846_HBSP_P-A Product feature CHAIN JF439846_HBSP_P-A of FT:mat_peptide JF439846_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00A5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLYFPHVAVQNL
RMEIAPVFPSHRPGLSQSTYGSGPQSASHGSVY
>gnl|hbvpro|JF439847_HBSP_P-A Product feature CHAIN JF439847_HBSP_P-A of FT:mat_peptide JF439847_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00A6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439848_HBSP_P-A Product feature CHAIN JF439848_HBSP_P-A of FT:mat_peptide JF439848_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00B5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439849_HBSP_P-A Product feature CHAIN JF439849_HBSP_P-A of FT:mat_peptide JF439849_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00B6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439850_HBSP_P-A Product feature CHAIN JF439850_HBSP_P-A of FT:mat_peptide JF439850_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00C5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDNAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439851_HBSP_P-A Product feature CHAIN JF439851_HBSP_P-A of FT:mat_peptide JF439851_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00C6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439852_HBSP_P-A Product feature CHAIN JF439852_HBSP_P-A of FT:mat_peptide JF439852_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00D5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439853_HBSP_P-A Product feature CHAIN JF439853_HBSP_P-A of FT:mat_peptide JF439853_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00D6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439854_HBSP_P-A Product feature CHAIN JF439854_HBSP_P-A of FT:mat_peptide JF439854_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00E5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSRRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439855_HBSP_P-A Product feature CHAIN JF439855_HBSP_P-A of FT:mat_peptide JF439855_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00E6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDNAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439856_HBSP_P-A Product feature CHAIN JF439856_HBSP_P-A of FT:mat_peptide JF439856_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00F5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSRRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439857_HBSP_P-A Product feature CHAIN JF439857_HBSP_P-A of FT:mat_peptide JF439857_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00F6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439858_HBSP_P-A Product feature CHAIN JF439858_HBSP_P-A of FT:mat_peptide JF439858_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00G5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPAFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439859_HBSP_P-A Product feature CHAIN JF439859_HBSP_P-A of FT:mat_peptide JF439859_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00G6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439860_HBSP_P-A Product feature CHAIN JF439860_HBSP_P-A of FT:mat_peptide JF439860_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00H5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPAFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439861_HBSP_P-A Product feature CHAIN JF439861_HBSP_P-A of FT:mat_peptide JF439861_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05H8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439862_HBSP_P-A Product feature CHAIN JF439862_HBSP_P-A of FT:mat_peptide JF439862_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05B7). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439864_HBSP_P-A Product feature CHAIN JF439864_HBSP_P-A of FT:mat_peptide JF439864_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05D7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHSRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439865_HBSP_P-A Product feature CHAIN JF439865_HBSP_P-A of FT:mat_peptide JF439865_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05D8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHIAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439866_HBSP_P-A Product feature CHAIN JF439866_HBSP_P-A of FT:mat_peptide JF439866_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05F7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439867_HBSP_P-A Product feature CHAIN JF439867_HBSP_P-A of FT:mat_peptide JF439867_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05G8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439868_HBSP_P-A Product feature CHAIN JF439868_HBSP_P-A of FT:mat_peptide JF439868_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05H7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSIY
>gnl|hbvpro|JF439886_HBSP_P-A Product feature CHAIN JF439886_HBSP_P-A of FT:mat_peptide JF439886_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F1). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLRCPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439887_HBSP_P-A Product feature CHAIN JF439887_HBSP_P-A of FT:mat_peptide JF439887_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F2_rev_comp). Partial genome (Contains: HBx, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439888_HBSP_P-A Product feature CHAIN JF439888_HBSP_P-A of FT:mat_peptide JF439888_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F3). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439889_HBSP_P-A Product feature CHAIN JF439889_HBSP_P-A of FT:mat_peptide JF439889_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F4). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHLRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439890_HBSP_P-A Product feature CHAIN JF439890_HBSP_P-A of FT:mat_peptide JF439890_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F5). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLRCPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439891_HBSP_P-A Product feature CHAIN JF439891_HBSP_P-A of FT:mat_peptide JF439891_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F6). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439892_HBSP_P-A Product feature CHAIN JF439892_HBSP_P-A of FT:mat_peptide JF439892_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F8). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439893_HBSP_P-A Product feature CHAIN JF439893_HBSP_P-A of FT:mat_peptide JF439893_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F9). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439894_HBSP_P-A Product feature CHAIN JF439894_HBSP_P-A of FT:mat_peptide JF439894_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F11). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439895_HBSP_P-A Product feature CHAIN JF439895_HBSP_P-A of FT:mat_peptide JF439895_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BIL2001F12). Partial genome (Contains: HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JF439896_HBSP_P-A Product feature CHAIN JF439896_HBSP_P-A of FT:mat_peptide JF439896_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439897_HBSP_P-A Product feature CHAIN JF439897_HBSP_P-A of FT:mat_peptide JF439897_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439898_HBSP_P-A Product feature CHAIN JF439898_HBSP_P-A of FT:mat_peptide JF439898_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439899_HBSP_P-A Product feature CHAIN JF439899_HBSP_P-A of FT:mat_peptide JF439899_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439900_HBSP_P-A Product feature CHAIN JF439900_HBSP_P-A of FT:mat_peptide JF439900_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439901_HBSP_P-A Product feature CHAIN JF439901_HBSP_P-A of FT:mat_peptide JF439901_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439902_HBSP_P-A Product feature CHAIN JF439902_HBSP_P-A of FT:mat_peptide JF439902_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439903_HBSP_P-A Product feature CHAIN JF439903_HBSP_P-A of FT:mat_peptide JF439903_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439904_HBSP_P-A Product feature CHAIN JF439904_HBSP_P-A of FT:mat_peptide JF439904_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439905_HBSP_P-A Product feature CHAIN JF439905_HBSP_P-A of FT:mat_peptide JF439905_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439906_HBSP_P-A Product feature CHAIN JF439906_HBSP_P-A of FT:mat_peptide JF439906_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439907_HBSP_P-A Product feature CHAIN JF439907_HBSP_P-A of FT:mat_peptide JF439907_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439908_HBSP_P-A Product feature CHAIN JF439908_HBSP_P-A of FT:mat_peptide JF439908_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439909_HBSP_P-A Product feature CHAIN JF439909_HBSP_P-A of FT:mat_peptide JF439909_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439910_HBSP_P-A Product feature CHAIN JF439910_HBSP_P-A of FT:mat_peptide JF439910_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439911_HBSP_P-A Product feature CHAIN JF439911_HBSP_P-A of FT:mat_peptide JF439911_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439912_HBSP_P-A Product feature CHAIN JF439912_HBSP_P-A of FT:mat_peptide JF439912_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439913_HBSP_P-A Product feature CHAIN JF439913_HBSP_P-A of FT:mat_peptide JF439913_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439914_HBSP_P-A Product feature CHAIN JF439914_HBSP_P-A of FT:mat_peptide JF439914_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSYRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439915_HBSP_P-A Product feature CHAIN JF439915_HBSP_P-A of FT:mat_peptide JF439915_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A5). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439916_HBSP_P-A Product feature CHAIN JF439916_HBSP_P-A of FT:mat_peptide JF439916_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439917_HBSP_P-A Product feature CHAIN JF439917_HBSP_P-A of FT:mat_peptide JF439917_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLPKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439918_HBSP_P-A Product feature CHAIN JF439918_HBSP_P-A of FT:mat_peptide JF439918_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439919_HBSP_P-A Product feature CHAIN JF439919_HBSP_P-A of FT:mat_peptide JF439919_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A9). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRGHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439920_HBSP_P-A Product feature CHAIN JF439920_HBSP_P-A of FT:mat_peptide JF439920_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439921_HBSP_P-A Product feature CHAIN JF439921_HBSP_P-A of FT:mat_peptide JF439921_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A11). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439922_HBSP_P-A Product feature CHAIN JF439922_HBSP_P-A of FT:mat_peptide JF439922_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439923_HBSP_P-A Product feature CHAIN JF439923_HBSP_P-A of FT:mat_peptide JF439923_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439924_HBSP_P-A Product feature CHAIN JF439924_HBSP_P-A of FT:mat_peptide JF439924_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439925_HBSP_P-A Product feature CHAIN JF439925_HBSP_P-A of FT:mat_peptide JF439925_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MLLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439926_HBSP_P-A Product feature CHAIN JF439926_HBSP_P-A of FT:mat_peptide JF439926_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B4). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MSLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLDSVY
>gnl|hbvpro|JF439927_HBSP_P-A Product feature CHAIN JF439927_HBSP_P-A of FT:mat_peptide JF439927_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JF439928_HBSP_P-A Product feature CHAIN JF439928_HBSP_P-A of FT:mat_peptide JF439928_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439929_HBSP_P-A Product feature CHAIN JF439929_HBSP_P-A of FT:mat_peptide JF439929_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTGAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439930_HBSP_P-A Product feature CHAIN JF439930_HBSP_P-A of FT:mat_peptide JF439930_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B9). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439931_HBSP_P-A Product feature CHAIN JF439931_HBSP_P-A of FT:mat_peptide JF439931_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTRAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439932_HBSP_P-A Product feature CHAIN JF439932_HBSP_P-A of FT:mat_peptide JF439932_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B11). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTESGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439933_HBSP_P-A Product feature CHAIN JF439933_HBSP_P-A of FT:mat_peptide JF439933_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439934_HBSP_P-A Product feature CHAIN JF439934_HBSP_P-A of FT:mat_peptide JF439934_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTGAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439935_HBSP_P-A Product feature CHAIN JF439935_HBSP_P-A of FT:mat_peptide JF439935_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTRAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439936_HBSP_P-A Product feature CHAIN JF439936_HBSP_P-A of FT:mat_peptide JF439936_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTGAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439937_HBSP_P-A Product feature CHAIN JF439937_HBSP_P-A of FT:mat_peptide JF439937_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSRRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439938_HBSP_P-A Product feature CHAIN JF439938_HBSP_P-A of FT:mat_peptide JF439938_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C5). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPIFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439939_HBSP_P-A Product feature CHAIN JF439939_HBSP_P-A of FT:mat_peptide JF439939_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439940_HBSP_P-A Product feature CHAIN JF439940_HBSP_P-A of FT:mat_peptide JF439940_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTGAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439941_HBSP_P-A Product feature CHAIN JF439941_HBSP_P-A of FT:mat_peptide JF439941_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439942_HBSP_P-A Product feature CHAIN JF439942_HBSP_P-A of FT:mat_peptide JF439942_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHRPGLSQSTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439943_HBSP_P-A Product feature CHAIN JF439943_HBSP_P-A of FT:mat_peptide JF439943_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439944_HBSP_P-A Product feature CHAIN JF439944_HBSP_P-A of FT:mat_peptide JF439944_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439945_HBSP_P-A Product feature CHAIN JF439945_HBSP_P-A of FT:mat_peptide JF439945_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439946_HBSP_P-A Product feature CHAIN JF439946_HBSP_P-A of FT:mat_peptide JF439946_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439947_HBSP_P-A Product feature CHAIN JF439947_HBSP_P-A of FT:mat_peptide JF439947_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439948_HBSP_P-A Product feature CHAIN JF439948_HBSP_P-A of FT:mat_peptide JF439948_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439949_HBSP_P-A Product feature CHAIN JF439949_HBSP_P-A of FT:mat_peptide JF439949_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439950_HBSP_P-A Product feature CHAIN JF439950_HBSP_P-A of FT:mat_peptide JF439950_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439951_HBSP_P-A Product feature CHAIN JF439951_HBSP_P-A of FT:mat_peptide JF439951_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAAQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439952_HBSP_P-A Product feature CHAIN JF439952_HBSP_P-A of FT:mat_peptide JF439952_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439953_HBSP_P-A Product feature CHAIN JF439953_HBSP_P-A of FT:mat_peptide JF439953_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439954_HBSP_P-A Product feature CHAIN JF439954_HBSP_P-A of FT:mat_peptide JF439954_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRILLLLDDETEAGPLEEELPRLADADLNRRVAEDLDLGNLNDRQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439955_HBSP_P-A Product feature CHAIN JF439955_HBSP_P-A of FT:mat_peptide JF439955_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439956_HBSP_P-A Product feature CHAIN JF439956_HBSP_P-A of FT:mat_peptide JF439956_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439957_HBSP_P-A Product feature CHAIN JF439957_HBSP_P-A of FT:mat_peptide JF439957_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439958_HBSP_P-A Product feature CHAIN JF439958_HBSP_P-A of FT:mat_peptide JF439958_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439959_HBSP_P-A Product feature CHAIN JF439959_HBSP_P-A of FT:mat_peptide JF439959_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439960_HBSP_P-A Product feature CHAIN JF439960_HBSP_P-A of FT:mat_peptide JF439960_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439961_HBSP_P-A Product feature CHAIN JF439961_HBSP_P-A of FT:mat_peptide JF439961_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439962_HBSP_P-A Product feature CHAIN JF439962_HBSP_P-A of FT:mat_peptide JF439962_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439963_HBSP_P-A Product feature CHAIN JF439963_HBSP_P-A of FT:mat_peptide JF439963_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c5). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLYDETEAGPLEEELPRLADADLNRRVAEDLNLGNFNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439964_HBSP_P-A Product feature CHAIN JF439964_HBSP_P-A of FT:mat_peptide JF439964_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLDRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439965_HBSP_P-A Product feature CHAIN JF439965_HBSP_P-A of FT:mat_peptide JF439965_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHVKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439966_HBSP_P-A Product feature CHAIN JF439966_HBSP_P-A of FT:mat_peptide JF439966_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c8). Partial genome (Contains: HBe, HBc, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADPNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439967_HBSP_P-A Product feature CHAIN JF439967_HBSP_P-A of FT:mat_peptide JF439967_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEARPLQQELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439968_HBSP_P-A Product feature CHAIN JF439968_HBSP_P-A of FT:mat_peptide JF439968_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439969_HBSP_P-A Product feature CHAIN JF439969_HBSP_P-A of FT:mat_peptide JF439969_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLHDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439970_HBSP_P-A Product feature CHAIN JF439970_HBSP_P-A of FT:mat_peptide JF439970_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLGDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439971_HBSP_P-A Product feature CHAIN JF439971_HBSP_P-A of FT:mat_peptide JF439971_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEGLPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439972_HBSP_P-A Product feature CHAIN JF439972_HBSP_P-A of FT:mat_peptide JF439972_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439973_HBSP_P-A Product feature CHAIN JF439973_HBSP_P-A of FT:mat_peptide JF439973_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439974_HBSP_P-A Product feature CHAIN JF439974_HBSP_P-A of FT:mat_peptide JF439974_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439975_HBSP_P-A Product feature CHAIN JF439975_HBSP_P-A of FT:mat_peptide JF439975_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELSRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439976_HBSP_P-A Product feature CHAIN JF439976_HBSP_P-A of FT:mat_peptide JF439976_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELSRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439977_HBSP_P-A Product feature CHAIN JF439977_HBSP_P-A of FT:mat_peptide JF439977_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439978_HBSP_P-A Product feature CHAIN JF439978_HBSP_P-A of FT:mat_peptide JF439978_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d10). Partial genome (Contains: LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439979_HBSP_P-A Product feature CHAIN JF439979_HBSP_P-A of FT:mat_peptide JF439979_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RVEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439980_HBSP_P-A Product feature CHAIN JF439980_HBSP_P-A of FT:mat_peptide JF439980_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439981_HBSP_P-A Product feature CHAIN JF439981_HBSP_P-A of FT:mat_peptide JF439981_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JF439982_HBSP_P-A Product feature CHAIN JF439982_HBSP_P-A of FT:mat_peptide JF439982_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNPNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|JF439983_HBSP_P-A Product feature CHAIN JF439983_HBSP_P-A of FT:mat_peptide JF439983_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439984_HBSP_P-A Product feature CHAIN JF439984_HBSP_P-A of FT:mat_peptide JF439984_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|JF439985_HBSP_P-A Product feature CHAIN JF439985_HBSP_P-A of FT:mat_peptide JF439985_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|JF439986_HBSP_P-A Product feature CHAIN JF439986_HBSP_P-A of FT:mat_peptide JF439986_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439987_HBSP_P-A Product feature CHAIN JF439987_HBSP_P-A of FT:mat_peptide JF439987_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQDL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439988_HBSP_P-A Product feature CHAIN JF439988_HBSP_P-A of FT:mat_peptide JF439988_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|JF439989_HBSP_P-A Product feature CHAIN JF439989_HBSP_P-A of FT:mat_peptide JF439989_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439990_HBSP_P-A Product feature CHAIN JF439990_HBSP_P-A of FT:mat_peptide JF439990_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|JF439991_HBSP_P-A Product feature CHAIN JF439991_HBSP_P-A of FT:mat_peptide JF439991_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439992_HBSP_P-A Product feature CHAIN JF439992_HBSP_P-A of FT:mat_peptide JF439992_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF439993_HBSP_P-A Product feature CHAIN JF439993_HBSP_P-A of FT:mat_peptide JF439993_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JF440016_HBSP_P-A Product feature CHAIN JF440016_HBSP_P-A of FT:mat_peptide JF440016_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B11). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JF440018_HBSP_P-A Product feature CHAIN JF440018_HBSP_P-A of FT:mat_peptide JF440018_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C1). Partial genome (Contains: HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|JF440020_HBSP_P-A Product feature CHAIN JF440020_HBSP_P-A of FT:mat_peptide JF440020_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C4). Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGTGPQSVSHGSVY
>gnl|hbvpro|JN182318_HBSP_P-A Product feature CHAIN JN182318_HBSP_P-A of FT:mat_peptide JN182318_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182319_HBSP_P-A Product feature CHAIN JN182319_HBSP_P-A of FT:mat_peptide JN182319_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182320_HBSP_P-A Product feature CHAIN JN182320_HBSP_P-A of FT:mat_peptide JN182320_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182321_HBSP_P-A Product feature CHAIN JN182321_HBSP_P-A of FT:mat_peptide JN182321_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182322_HBSP_P-A Product feature CHAIN JN182322_HBSP_P-A of FT:mat_peptide JN182322_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182323_HBSP_P-A Product feature CHAIN JN182323_HBSP_P-A of FT:mat_peptide JN182323_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182324_HBSP_P-A Product feature CHAIN JN182324_HBSP_P-A of FT:mat_peptide JN182324_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182325_HBSP_P-A Product feature CHAIN JN182325_HBSP_P-A of FT:mat_peptide JN182325_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182326_HBSP_P-A Product feature CHAIN JN182326_HBSP_P-A of FT:mat_peptide JN182326_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182327_HBSP_P-A Product feature CHAIN JN182327_HBSP_P-A of FT:mat_peptide JN182327_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182328_HBSP_P-A Product feature CHAIN JN182328_HBSP_P-A of FT:mat_peptide JN182328_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182329_HBSP_P-A Product feature CHAIN JN182329_HBSP_P-A of FT:mat_peptide JN182329_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182330_HBSP_P-A Product feature CHAIN JN182330_HBSP_P-A of FT:mat_peptide JN182330_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182332_HBSP_P-A Product feature CHAIN JN182332_HBSP_P-A of FT:mat_peptide JN182332_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182333_HBSP_P-A Product feature CHAIN JN182333_HBSP_P-A of FT:mat_peptide JN182333_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JN182334_HBSP_P-A Product feature CHAIN JN182334_HBSP_P-A of FT:mat_peptide JN182334_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAVDLNLGNLNDPQPPARDPARPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ023660_HBSP_P-A Product feature CHAIN JQ023660_HBSP_P-A of FT:mat_peptide JQ023660_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1160). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
RPLSYQHFRKLLLLDDETEASPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ023661_HBSP_P-A Product feature CHAIN JQ023661_HBSP_P-A of FT:mat_peptide JQ023661_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1158). Complete genome. [Hepadnaviridae] (length=113 residues).
RPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAKDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ023662_HBSP_P-A Product feature CHAIN JQ023662_HBSP_P-A of FT:mat_peptide JQ023662_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1164). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
RPLSYQHFRKLLLFDDETEAGPLKEELPRLADENLNRRVAKDLNLGNLNDPQQPVRDPCKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ023663_HBSP_P-A Product feature CHAIN JQ023663_HBSP_P-A of FT:mat_peptide JQ023663_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1159). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
RPLSYQHFRKLLLFDDETEAGPLKEELPRLANENLNRRVAKNLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ687529_HBSP_P-A Product feature CHAIN JQ687529_HBSP_P-A of FT:mat_peptide JQ687529_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 176). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707299_HBSP_P-A Product feature CHAIN JQ707299_HBSP_P-A of FT:mat_peptide JQ707299_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707300_HBSP_P-A Product feature CHAIN JQ707300_HBSP_P-A of FT:mat_peptide JQ707300_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRIAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707301_HBSP_P-A Product feature CHAIN JQ707301_HBSP_P-A of FT:mat_peptide JQ707301_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C12). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707302_HBSP_P-A Product feature CHAIN JQ707302_HBSP_P-A of FT:mat_peptide JQ707302_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C13). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707303_HBSP_P-A Product feature CHAIN JQ707303_HBSP_P-A of FT:mat_peptide JQ707303_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707304_HBSP_P-A Product feature CHAIN JQ707304_HBSP_P-A of FT:mat_peptide JQ707304_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707305_HBSP_P-A Product feature CHAIN JQ707305_HBSP_P-A of FT:mat_peptide JQ707305_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C16). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSLSLGSVY
>gnl|hbvpro|JQ707306_HBSP_P-A Product feature CHAIN JQ707306_HBSP_P-A of FT:mat_peptide JQ707306_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C17). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707307_HBSP_P-A Product feature CHAIN JQ707307_HBSP_P-A of FT:mat_peptide JQ707307_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C18). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707308_HBSP_P-A Product feature CHAIN JQ707308_HBSP_P-A of FT:mat_peptide JQ707308_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707309_HBSP_P-A Product feature CHAIN JQ707309_HBSP_P-A of FT:mat_peptide JQ707309_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707310_HBSP_P-A Product feature CHAIN JQ707310_HBSP_P-A of FT:mat_peptide JQ707310_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C20). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707311_HBSP_P-A Product feature CHAIN JQ707311_HBSP_P-A of FT:mat_peptide JQ707311_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707312_HBSP_P-A Product feature CHAIN JQ707312_HBSP_P-A of FT:mat_peptide JQ707312_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707313_HBSP_P-A Product feature CHAIN JQ707313_HBSP_P-A of FT:mat_peptide JQ707313_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707314_HBSP_P-A Product feature CHAIN JQ707314_HBSP_P-A of FT:mat_peptide JQ707314_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C24). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707315_HBSP_P-A Product feature CHAIN JQ707315_HBSP_P-A of FT:mat_peptide JQ707315_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707316_HBSP_P-A Product feature CHAIN JQ707316_HBSP_P-A of FT:mat_peptide JQ707316_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C26). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707317_HBSP_P-A Product feature CHAIN JQ707317_HBSP_P-A of FT:mat_peptide JQ707317_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707318_HBSP_P-A Product feature CHAIN JQ707318_HBSP_P-A of FT:mat_peptide JQ707318_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707319_HBSP_P-A Product feature CHAIN JQ707319_HBSP_P-A of FT:mat_peptide JQ707319_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707320_HBSP_P-A Product feature CHAIN JQ707320_HBSP_P-A of FT:mat_peptide JQ707320_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C30). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707321_HBSP_P-A Product feature CHAIN JQ707321_HBSP_P-A of FT:mat_peptide JQ707321_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707322_HBSP_P-A Product feature CHAIN JQ707322_HBSP_P-A of FT:mat_peptide JQ707322_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C32). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707323_HBSP_P-A Product feature CHAIN JQ707323_HBSP_P-A of FT:mat_peptide JQ707323_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C33). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707324_HBSP_P-A Product feature CHAIN JQ707324_HBSP_P-A of FT:mat_peptide JQ707324_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C34). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHCLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707325_HBSP_P-A Product feature CHAIN JQ707325_HBSP_P-A of FT:mat_peptide JQ707325_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C35). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLMLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707326_HBSP_P-A Product feature CHAIN JQ707326_HBSP_P-A of FT:mat_peptide JQ707326_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C36). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHCLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707327_HBSP_P-A Product feature CHAIN JQ707327_HBSP_P-A of FT:mat_peptide JQ707327_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C37). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707328_HBSP_P-A Product feature CHAIN JQ707328_HBSP_P-A of FT:mat_peptide JQ707328_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C38). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707329_HBSP_P-A Product feature CHAIN JQ707329_HBSP_P-A of FT:mat_peptide JQ707329_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C39). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQNFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707330_HBSP_P-A Product feature CHAIN JQ707330_HBSP_P-A of FT:mat_peptide JQ707330_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707331_HBSP_P-A Product feature CHAIN JQ707331_HBSP_P-A of FT:mat_peptide JQ707331_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707332_HBSP_P-A Product feature CHAIN JQ707332_HBSP_P-A of FT:mat_peptide JQ707332_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707333_HBSP_P-A Product feature CHAIN JQ707333_HBSP_P-A of FT:mat_peptide JQ707333_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C42). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707334_HBSP_P-A Product feature CHAIN JQ707334_HBSP_P-A of FT:mat_peptide JQ707334_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C43). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707336_HBSP_P-A Product feature CHAIN JQ707336_HBSP_P-A of FT:mat_peptide JQ707336_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C45). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707337_HBSP_P-A Product feature CHAIN JQ707337_HBSP_P-A of FT:mat_peptide JQ707337_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C46). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707338_HBSP_P-A Product feature CHAIN JQ707338_HBSP_P-A of FT:mat_peptide JQ707338_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C47). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707339_HBSP_P-A Product feature CHAIN JQ707339_HBSP_P-A of FT:mat_peptide JQ707339_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C48). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707341_HBSP_P-A Product feature CHAIN JQ707341_HBSP_P-A of FT:mat_peptide JQ707341_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C6). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707342_HBSP_P-A Product feature CHAIN JQ707342_HBSP_P-A of FT:mat_peptide JQ707342_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C7). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARVLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707343_HBSP_P-A Product feature CHAIN JQ707343_HBSP_P-A of FT:mat_peptide JQ707343_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707344_HBSP_P-A Product feature CHAIN JQ707344_HBSP_P-A of FT:mat_peptide JQ707344_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHCLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707345_HBSP_P-A Product feature CHAIN JQ707345_HBSP_P-A of FT:mat_peptide JQ707345_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C1). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707346_HBSP_P-A Product feature CHAIN JQ707346_HBSP_P-A of FT:mat_peptide JQ707346_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C12). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707347_HBSP_P-A Product feature CHAIN JQ707347_HBSP_P-A of FT:mat_peptide JQ707347_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C13). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707348_HBSP_P-A Product feature CHAIN JQ707348_HBSP_P-A of FT:mat_peptide JQ707348_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707349_HBSP_P-A Product feature CHAIN JQ707349_HBSP_P-A of FT:mat_peptide JQ707349_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707350_HBSP_P-A Product feature CHAIN JQ707350_HBSP_P-A of FT:mat_peptide JQ707350_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707351_HBSP_P-A Product feature CHAIN JQ707351_HBSP_P-A of FT:mat_peptide JQ707351_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707352_HBSP_P-A Product feature CHAIN JQ707352_HBSP_P-A of FT:mat_peptide JQ707352_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C20). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707353_HBSP_P-A Product feature CHAIN JQ707353_HBSP_P-A of FT:mat_peptide JQ707353_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707354_HBSP_P-A Product feature CHAIN JQ707354_HBSP_P-A of FT:mat_peptide JQ707354_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C22-2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707355_HBSP_P-A Product feature CHAIN JQ707355_HBSP_P-A of FT:mat_peptide JQ707355_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707356_HBSP_P-A Product feature CHAIN JQ707356_HBSP_P-A of FT:mat_peptide JQ707356_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707357_HBSP_P-A Product feature CHAIN JQ707357_HBSP_P-A of FT:mat_peptide JQ707357_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C29-2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707358_HBSP_P-A Product feature CHAIN JQ707358_HBSP_P-A of FT:mat_peptide JQ707358_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C33). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707359_HBSP_P-A Product feature CHAIN JQ707359_HBSP_P-A of FT:mat_peptide JQ707359_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707360_HBSP_P-A Product feature CHAIN JQ707360_HBSP_P-A of FT:mat_peptide JQ707360_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C36). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707361_HBSP_P-A Product feature CHAIN JQ707361_HBSP_P-A of FT:mat_peptide JQ707361_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C37). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707362_HBSP_P-A Product feature CHAIN JQ707362_HBSP_P-A of FT:mat_peptide JQ707362_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C39). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707363_HBSP_P-A Product feature CHAIN JQ707363_HBSP_P-A of FT:mat_peptide JQ707363_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707364_HBSP_P-A Product feature CHAIN JQ707364_HBSP_P-A of FT:mat_peptide JQ707364_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707365_HBSP_P-A Product feature CHAIN JQ707365_HBSP_P-A of FT:mat_peptide JQ707365_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C43). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707366_HBSP_P-A Product feature CHAIN JQ707366_HBSP_P-A of FT:mat_peptide JQ707366_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C44). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707367_HBSP_P-A Product feature CHAIN JQ707367_HBSP_P-A of FT:mat_peptide JQ707367_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C46). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707368_HBSP_P-A Product feature CHAIN JQ707368_HBSP_P-A of FT:mat_peptide JQ707368_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C47). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGSLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707369_HBSP_P-A Product feature CHAIN JQ707369_HBSP_P-A of FT:mat_peptide JQ707369_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C48). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707370_HBSP_P-A Product feature CHAIN JQ707370_HBSP_P-A of FT:mat_peptide JQ707370_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707371_HBSP_P-A Product feature CHAIN JQ707371_HBSP_P-A of FT:mat_peptide JQ707371_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707372_HBSP_P-A Product feature CHAIN JQ707372_HBSP_P-A of FT:mat_peptide JQ707372_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707373_HBSP_P-A Product feature CHAIN JQ707373_HBSP_P-A of FT:mat_peptide JQ707373_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707374_HBSP_P-A Product feature CHAIN JQ707374_HBSP_P-A of FT:mat_peptide JQ707374_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707375_HBSP_P-A Product feature CHAIN JQ707375_HBSP_P-A of FT:mat_peptide JQ707375_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C17-2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707376_HBSP_P-A Product feature CHAIN JQ707376_HBSP_P-A of FT:mat_peptide JQ707376_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707377_HBSP_P-A Product feature CHAIN JQ707377_HBSP_P-A of FT:mat_peptide JQ707377_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707378_HBSP_P-A Product feature CHAIN JQ707378_HBSP_P-A of FT:mat_peptide JQ707378_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707379_HBSP_P-A Product feature CHAIN JQ707379_HBSP_P-A of FT:mat_peptide JQ707379_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C24-9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707380_HBSP_P-A Product feature CHAIN JQ707380_HBSP_P-A of FT:mat_peptide JQ707380_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707381_HBSP_P-A Product feature CHAIN JQ707381_HBSP_P-A of FT:mat_peptide JQ707381_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707382_HBSP_P-A Product feature CHAIN JQ707382_HBSP_P-A of FT:mat_peptide JQ707382_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707383_HBSP_P-A Product feature CHAIN JQ707383_HBSP_P-A of FT:mat_peptide JQ707383_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707384_HBSP_P-A Product feature CHAIN JQ707384_HBSP_P-A of FT:mat_peptide JQ707384_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C32). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707385_HBSP_P-A Product feature CHAIN JQ707385_HBSP_P-A of FT:mat_peptide JQ707385_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C33). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707386_HBSP_P-A Product feature CHAIN JQ707386_HBSP_P-A of FT:mat_peptide JQ707386_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C34). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707387_HBSP_P-A Product feature CHAIN JQ707387_HBSP_P-A of FT:mat_peptide JQ707387_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C36). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707388_HBSP_P-A Product feature CHAIN JQ707388_HBSP_P-A of FT:mat_peptide JQ707388_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C37). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707389_HBSP_P-A Product feature CHAIN JQ707389_HBSP_P-A of FT:mat_peptide JQ707389_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C38). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707390_HBSP_P-A Product feature CHAIN JQ707390_HBSP_P-A of FT:mat_peptide JQ707390_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C39). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707391_HBSP_P-A Product feature CHAIN JQ707391_HBSP_P-A of FT:mat_peptide JQ707391_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707392_HBSP_P-A Product feature CHAIN JQ707392_HBSP_P-A of FT:mat_peptide JQ707392_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707393_HBSP_P-A Product feature CHAIN JQ707393_HBSP_P-A of FT:mat_peptide JQ707393_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C42). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707394_HBSP_P-A Product feature CHAIN JQ707394_HBSP_P-A of FT:mat_peptide JQ707394_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C44). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707395_HBSP_P-A Product feature CHAIN JQ707395_HBSP_P-A of FT:mat_peptide JQ707395_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C46). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTAAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHPPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707396_HBSP_P-A Product feature CHAIN JQ707396_HBSP_P-A of FT:mat_peptide JQ707396_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C47). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707397_HBSP_P-A Product feature CHAIN JQ707397_HBSP_P-A of FT:mat_peptide JQ707397_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C48). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707398_HBSP_P-A Product feature CHAIN JQ707398_HBSP_P-A of FT:mat_peptide JQ707398_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKHARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707399_HBSP_P-A Product feature CHAIN JQ707399_HBSP_P-A of FT:mat_peptide JQ707399_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C6). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707400_HBSP_P-A Product feature CHAIN JQ707400_HBSP_P-A of FT:mat_peptide JQ707400_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707401_HBSP_P-A Product feature CHAIN JQ707401_HBSP_P-A of FT:mat_peptide JQ707401_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C10). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPIFPSHRLGLSQNTYGSEPQSVSHGSVY
>gnl|hbvpro|JQ707402_HBSP_P-A Product feature CHAIN JQ707402_HBSP_P-A of FT:mat_peptide JQ707402_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C11-3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707403_HBSP_P-A Product feature CHAIN JQ707403_HBSP_P-A of FT:mat_peptide JQ707403_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707404_HBSP_P-A Product feature CHAIN JQ707404_HBSP_P-A of FT:mat_peptide JQ707404_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C17). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707405_HBSP_P-A Product feature CHAIN JQ707405_HBSP_P-A of FT:mat_peptide JQ707405_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C18). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707406_HBSP_P-A Product feature CHAIN JQ707406_HBSP_P-A of FT:mat_peptide JQ707406_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707407_HBSP_P-A Product feature CHAIN JQ707407_HBSP_P-A of FT:mat_peptide JQ707407_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C20-9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707408_HBSP_P-A Product feature CHAIN JQ707408_HBSP_P-A of FT:mat_peptide JQ707408_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707409_HBSP_P-A Product feature CHAIN JQ707409_HBSP_P-A of FT:mat_peptide JQ707409_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C26-5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707410_HBSP_P-A Product feature CHAIN JQ707410_HBSP_P-A of FT:mat_peptide JQ707410_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707411_HBSP_P-A Product feature CHAIN JQ707411_HBSP_P-A of FT:mat_peptide JQ707411_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707412_HBSP_P-A Product feature CHAIN JQ707412_HBSP_P-A of FT:mat_peptide JQ707412_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C32). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707413_HBSP_P-A Product feature CHAIN JQ707413_HBSP_P-A of FT:mat_peptide JQ707413_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C34). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707414_HBSP_P-A Product feature CHAIN JQ707414_HBSP_P-A of FT:mat_peptide JQ707414_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707415_HBSP_P-A Product feature CHAIN JQ707415_HBSP_P-A of FT:mat_peptide JQ707415_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707416_HBSP_P-A Product feature CHAIN JQ707416_HBSP_P-A of FT:mat_peptide JQ707416_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707417_HBSP_P-A Product feature CHAIN JQ707417_HBSP_P-A of FT:mat_peptide JQ707417_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C44). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707418_HBSP_P-A Product feature CHAIN JQ707418_HBSP_P-A of FT:mat_peptide JQ707418_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C47). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707419_HBSP_P-A Product feature CHAIN JQ707419_HBSP_P-A of FT:mat_peptide JQ707419_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C48). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTGAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707420_HBSP_P-A Product feature CHAIN JQ707420_HBSP_P-A of FT:mat_peptide JQ707420_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C6). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707531_HBSP_P-A Product feature CHAIN JQ707531_HBSP_P-A of FT:mat_peptide JQ707531_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707532_HBSP_P-A Product feature CHAIN JQ707532_HBSP_P-A of FT:mat_peptide JQ707532_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQKQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707533_HBSP_P-A Product feature CHAIN JQ707533_HBSP_P-A of FT:mat_peptide JQ707533_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707534_HBSP_P-A Product feature CHAIN JQ707534_HBSP_P-A of FT:mat_peptide JQ707534_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C12). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707535_HBSP_P-A Product feature CHAIN JQ707535_HBSP_P-A of FT:mat_peptide JQ707535_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C13). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707536_HBSP_P-A Product feature CHAIN JQ707536_HBSP_P-A of FT:mat_peptide JQ707536_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQKQPVRDHAKPARLLLKATLRFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707537_HBSP_P-A Product feature CHAIN JQ707537_HBSP_P-A of FT:mat_peptide JQ707537_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLRFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707538_HBSP_P-A Product feature CHAIN JQ707538_HBSP_P-A of FT:mat_peptide JQ707538_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707539_HBSP_P-A Product feature CHAIN JQ707539_HBSP_P-A of FT:mat_peptide JQ707539_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C17). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707540_HBSP_P-A Product feature CHAIN JQ707540_HBSP_P-A of FT:mat_peptide JQ707540_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C18). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707541_HBSP_P-A Product feature CHAIN JQ707541_HBSP_P-A of FT:mat_peptide JQ707541_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707542_HBSP_P-A Product feature CHAIN JQ707542_HBSP_P-A of FT:mat_peptide JQ707542_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707543_HBSP_P-A Product feature CHAIN JQ707543_HBSP_P-A of FT:mat_peptide JQ707543_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707544_HBSP_P-A Product feature CHAIN JQ707544_HBSP_P-A of FT:mat_peptide JQ707544_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707545_HBSP_P-A Product feature CHAIN JQ707545_HBSP_P-A of FT:mat_peptide JQ707545_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C24). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707546_HBSP_P-A Product feature CHAIN JQ707546_HBSP_P-A of FT:mat_peptide JQ707546_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C26). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707547_HBSP_P-A Product feature CHAIN JQ707547_HBSP_P-A of FT:mat_peptide JQ707547_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707548_HBSP_P-A Product feature CHAIN JQ707548_HBSP_P-A of FT:mat_peptide JQ707548_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707549_HBSP_P-A Product feature CHAIN JQ707549_HBSP_P-A of FT:mat_peptide JQ707549_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C29). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLRFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707550_HBSP_P-A Product feature CHAIN JQ707550_HBSP_P-A of FT:mat_peptide JQ707550_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGIEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707551_HBSP_P-A Product feature CHAIN JQ707551_HBSP_P-A of FT:mat_peptide JQ707551_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C30). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707552_HBSP_P-A Product feature CHAIN JQ707552_HBSP_P-A of FT:mat_peptide JQ707552_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707553_HBSP_P-A Product feature CHAIN JQ707553_HBSP_P-A of FT:mat_peptide JQ707553_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C32). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707554_HBSP_P-A Product feature CHAIN JQ707554_HBSP_P-A of FT:mat_peptide JQ707554_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C33). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLRFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707555_HBSP_P-A Product feature CHAIN JQ707555_HBSP_P-A of FT:mat_peptide JQ707555_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C34). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707556_HBSP_P-A Product feature CHAIN JQ707556_HBSP_P-A of FT:mat_peptide JQ707556_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707557_HBSP_P-A Product feature CHAIN JQ707557_HBSP_P-A of FT:mat_peptide JQ707557_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C36). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707558_HBSP_P-A Product feature CHAIN JQ707558_HBSP_P-A of FT:mat_peptide JQ707558_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C38). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707559_HBSP_P-A Product feature CHAIN JQ707559_HBSP_P-A of FT:mat_peptide JQ707559_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707560_HBSP_P-A Product feature CHAIN JQ707560_HBSP_P-A of FT:mat_peptide JQ707560_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707561_HBSP_P-A Product feature CHAIN JQ707561_HBSP_P-A of FT:mat_peptide JQ707561_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707562_HBSP_P-A Product feature CHAIN JQ707562_HBSP_P-A of FT:mat_peptide JQ707562_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C42). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707563_HBSP_P-A Product feature CHAIN JQ707563_HBSP_P-A of FT:mat_peptide JQ707563_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C43). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707564_HBSP_P-A Product feature CHAIN JQ707564_HBSP_P-A of FT:mat_peptide JQ707564_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C44). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707565_HBSP_P-A Product feature CHAIN JQ707565_HBSP_P-A of FT:mat_peptide JQ707565_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C45). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707566_HBSP_P-A Product feature CHAIN JQ707566_HBSP_P-A of FT:mat_peptide JQ707566_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C46). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707567_HBSP_P-A Product feature CHAIN JQ707567_HBSP_P-A of FT:mat_peptide JQ707567_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C47). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707568_HBSP_P-A Product feature CHAIN JQ707568_HBSP_P-A of FT:mat_peptide JQ707568_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C48). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707569_HBSP_P-A Product feature CHAIN JQ707569_HBSP_P-A of FT:mat_peptide JQ707569_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707570_HBSP_P-A Product feature CHAIN JQ707570_HBSP_P-A of FT:mat_peptide JQ707570_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C6). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707571_HBSP_P-A Product feature CHAIN JQ707571_HBSP_P-A of FT:mat_peptide JQ707571_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C7). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSLGSVY
>gnl|hbvpro|JQ707572_HBSP_P-A Product feature CHAIN JQ707572_HBSP_P-A of FT:mat_peptide JQ707572_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707573_HBSP_P-A Product feature CHAIN JQ707573_HBSP_P-A of FT:mat_peptide JQ707573_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707574_HBSP_P-A Product feature CHAIN JQ707574_HBSP_P-A of FT:mat_peptide JQ707574_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C10). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707575_HBSP_P-A Product feature CHAIN JQ707575_HBSP_P-A of FT:mat_peptide JQ707575_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C13). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVYPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707576_HBSP_P-A Product feature CHAIN JQ707576_HBSP_P-A of FT:mat_peptide JQ707576_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JQ707577_HBSP_P-A Product feature CHAIN JQ707577_HBSP_P-A of FT:mat_peptide JQ707577_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707578_HBSP_P-A Product feature CHAIN JQ707578_HBSP_P-A of FT:mat_peptide JQ707578_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVYPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707579_HBSP_P-A Product feature CHAIN JQ707579_HBSP_P-A of FT:mat_peptide JQ707579_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C17). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707580_HBSP_P-A Product feature CHAIN JQ707580_HBSP_P-A of FT:mat_peptide JQ707580_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C18). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707581_HBSP_P-A Product feature CHAIN JQ707581_HBSP_P-A of FT:mat_peptide JQ707581_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVYPSHHPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707582_HBSP_P-A Product feature CHAIN JQ707582_HBSP_P-A of FT:mat_peptide JQ707582_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C2). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707583_HBSP_P-A Product feature CHAIN JQ707583_HBSP_P-A of FT:mat_peptide JQ707583_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVYPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707584_HBSP_P-A Product feature CHAIN JQ707584_HBSP_P-A of FT:mat_peptide JQ707584_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C22). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707585_HBSP_P-A Product feature CHAIN JQ707585_HBSP_P-A of FT:mat_peptide JQ707585_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JQ707586_HBSP_P-A Product feature CHAIN JQ707586_HBSP_P-A of FT:mat_peptide JQ707586_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C24). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JQ707587_HBSP_P-A Product feature CHAIN JQ707587_HBSP_P-A of FT:mat_peptide JQ707587_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707588_HBSP_P-A Product feature CHAIN JQ707588_HBSP_P-A of FT:mat_peptide JQ707588_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C26). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707589_HBSP_P-A Product feature CHAIN JQ707589_HBSP_P-A of FT:mat_peptide JQ707589_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JQ707590_HBSP_P-A Product feature CHAIN JQ707590_HBSP_P-A of FT:mat_peptide JQ707590_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JQ707591_HBSP_P-A Product feature CHAIN JQ707591_HBSP_P-A of FT:mat_peptide JQ707591_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C29). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707592_HBSP_P-A Product feature CHAIN JQ707592_HBSP_P-A of FT:mat_peptide JQ707592_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JQ707593_HBSP_P-A Product feature CHAIN JQ707593_HBSP_P-A of FT:mat_peptide JQ707593_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C33). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707594_HBSP_P-A Product feature CHAIN JQ707594_HBSP_P-A of FT:mat_peptide JQ707594_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C34). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707595_HBSP_P-A Product feature CHAIN JQ707595_HBSP_P-A of FT:mat_peptide JQ707595_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707596_HBSP_P-A Product feature CHAIN JQ707596_HBSP_P-A of FT:mat_peptide JQ707596_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C36). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707597_HBSP_P-A Product feature CHAIN JQ707597_HBSP_P-A of FT:mat_peptide JQ707597_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C37). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JQ707598_HBSP_P-A Product feature CHAIN JQ707598_HBSP_P-A of FT:mat_peptide JQ707598_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C38). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707599_HBSP_P-A Product feature CHAIN JQ707599_HBSP_P-A of FT:mat_peptide JQ707599_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGAGPQSVSHGSVY
>gnl|hbvpro|JQ707600_HBSP_P-A Product feature CHAIN JQ707600_HBSP_P-A of FT:mat_peptide JQ707600_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C40). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707601_HBSP_P-A Product feature CHAIN JQ707601_HBSP_P-A of FT:mat_peptide JQ707601_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707602_HBSP_P-A Product feature CHAIN JQ707602_HBSP_P-A of FT:mat_peptide JQ707602_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C42). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707603_HBSP_P-A Product feature CHAIN JQ707603_HBSP_P-A of FT:mat_peptide JQ707603_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C43). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVYPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707604_HBSP_P-A Product feature CHAIN JQ707604_HBSP_P-A of FT:mat_peptide JQ707604_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C44). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVYPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707605_HBSP_P-A Product feature CHAIN JQ707605_HBSP_P-A of FT:mat_peptide JQ707605_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C45). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707606_HBSP_P-A Product feature CHAIN JQ707606_HBSP_P-A of FT:mat_peptide JQ707606_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C48). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVYPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707607_HBSP_P-A Product feature CHAIN JQ707607_HBSP_P-A of FT:mat_peptide JQ707607_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707608_HBSP_P-A Product feature CHAIN JQ707608_HBSP_P-A of FT:mat_peptide JQ707608_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGGGPQSVSHGSVY
>gnl|hbvpro|JQ707609_HBSP_P-A Product feature CHAIN JQ707609_HBSP_P-A of FT:mat_peptide JQ707609_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707610_HBSP_P-A Product feature CHAIN JQ707610_HBSP_P-A of FT:mat_peptide JQ707610_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707611_HBSP_P-A Product feature CHAIN JQ707611_HBSP_P-A of FT:mat_peptide JQ707611_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707612_HBSP_P-A Product feature CHAIN JQ707612_HBSP_P-A of FT:mat_peptide JQ707612_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C13). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707613_HBSP_P-A Product feature CHAIN JQ707613_HBSP_P-A of FT:mat_peptide JQ707613_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707614_HBSP_P-A Product feature CHAIN JQ707614_HBSP_P-A of FT:mat_peptide JQ707614_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C17). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707615_HBSP_P-A Product feature CHAIN JQ707615_HBSP_P-A of FT:mat_peptide JQ707615_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C18). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707616_HBSP_P-A Product feature CHAIN JQ707616_HBSP_P-A of FT:mat_peptide JQ707616_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707617_HBSP_P-A Product feature CHAIN JQ707617_HBSP_P-A of FT:mat_peptide JQ707617_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707618_HBSP_P-A Product feature CHAIN JQ707618_HBSP_P-A of FT:mat_peptide JQ707618_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707619_HBSP_P-A Product feature CHAIN JQ707619_HBSP_P-A of FT:mat_peptide JQ707619_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707620_HBSP_P-A Product feature CHAIN JQ707620_HBSP_P-A of FT:mat_peptide JQ707620_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C24). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707621_HBSP_P-A Product feature CHAIN JQ707621_HBSP_P-A of FT:mat_peptide JQ707621_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C26). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707622_HBSP_P-A Product feature CHAIN JQ707622_HBSP_P-A of FT:mat_peptide JQ707622_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707623_HBSP_P-A Product feature CHAIN JQ707623_HBSP_P-A of FT:mat_peptide JQ707623_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707624_HBSP_P-A Product feature CHAIN JQ707624_HBSP_P-A of FT:mat_peptide JQ707624_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707625_HBSP_P-A Product feature CHAIN JQ707625_HBSP_P-A of FT:mat_peptide JQ707625_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C30). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707626_HBSP_P-A Product feature CHAIN JQ707626_HBSP_P-A of FT:mat_peptide JQ707626_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707627_HBSP_P-A Product feature CHAIN JQ707627_HBSP_P-A of FT:mat_peptide JQ707627_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C32). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707628_HBSP_P-A Product feature CHAIN JQ707628_HBSP_P-A of FT:mat_peptide JQ707628_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C33). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707629_HBSP_P-A Product feature CHAIN JQ707629_HBSP_P-A of FT:mat_peptide JQ707629_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C34). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707630_HBSP_P-A Product feature CHAIN JQ707630_HBSP_P-A of FT:mat_peptide JQ707630_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707631_HBSP_P-A Product feature CHAIN JQ707631_HBSP_P-A of FT:mat_peptide JQ707631_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C36-6). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707632_HBSP_P-A Product feature CHAIN JQ707632_HBSP_P-A of FT:mat_peptide JQ707632_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707633_HBSP_P-A Product feature CHAIN JQ707633_HBSP_P-A of FT:mat_peptide JQ707633_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707634_HBSP_P-A Product feature CHAIN JQ707634_HBSP_P-A of FT:mat_peptide JQ707634_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C42). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707635_HBSP_P-A Product feature CHAIN JQ707635_HBSP_P-A of FT:mat_peptide JQ707635_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C45). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRHADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEMAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707636_HBSP_P-A Product feature CHAIN JQ707636_HBSP_P-A of FT:mat_peptide JQ707636_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C46). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707637_HBSP_P-A Product feature CHAIN JQ707637_HBSP_P-A of FT:mat_peptide JQ707637_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C5-5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JQ707638_HBSP_P-A Product feature CHAIN JQ707638_HBSP_P-A of FT:mat_peptide JQ707638_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C12). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707639_HBSP_P-A Product feature CHAIN JQ707639_HBSP_P-A of FT:mat_peptide JQ707639_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C13-9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707640_HBSP_P-A Product feature CHAIN JQ707640_HBSP_P-A of FT:mat_peptide JQ707640_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707641_HBSP_P-A Product feature CHAIN JQ707641_HBSP_P-A of FT:mat_peptide JQ707641_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C17). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707642_HBSP_P-A Product feature CHAIN JQ707642_HBSP_P-A of FT:mat_peptide JQ707642_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707643_HBSP_P-A Product feature CHAIN JQ707643_HBSP_P-A of FT:mat_peptide JQ707643_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C20-7). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707644_HBSP_P-A Product feature CHAIN JQ707644_HBSP_P-A of FT:mat_peptide JQ707644_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707645_HBSP_P-A Product feature CHAIN JQ707645_HBSP_P-A of FT:mat_peptide JQ707645_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C24). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707646_HBSP_P-A Product feature CHAIN JQ707646_HBSP_P-A of FT:mat_peptide JQ707646_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C26). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707647_HBSP_P-A Product feature CHAIN JQ707647_HBSP_P-A of FT:mat_peptide JQ707647_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707648_HBSP_P-A Product feature CHAIN JQ707648_HBSP_P-A of FT:mat_peptide JQ707648_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707649_HBSP_P-A Product feature CHAIN JQ707649_HBSP_P-A of FT:mat_peptide JQ707649_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707650_HBSP_P-A Product feature CHAIN JQ707650_HBSP_P-A of FT:mat_peptide JQ707650_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C30). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707651_HBSP_P-A Product feature CHAIN JQ707651_HBSP_P-A of FT:mat_peptide JQ707651_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C33). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707652_HBSP_P-A Product feature CHAIN JQ707652_HBSP_P-A of FT:mat_peptide JQ707652_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C34). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707653_HBSP_P-A Product feature CHAIN JQ707653_HBSP_P-A of FT:mat_peptide JQ707653_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C38). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707654_HBSP_P-A Product feature CHAIN JQ707654_HBSP_P-A of FT:mat_peptide JQ707654_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C40). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707655_HBSP_P-A Product feature CHAIN JQ707655_HBSP_P-A of FT:mat_peptide JQ707655_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707656_HBSP_P-A Product feature CHAIN JQ707656_HBSP_P-A of FT:mat_peptide JQ707656_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C43). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707658_HBSP_P-A Product feature CHAIN JQ707658_HBSP_P-A of FT:mat_peptide JQ707658_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_13). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707659_HBSP_P-A Product feature CHAIN JQ707659_HBSP_P-A of FT:mat_peptide JQ707659_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707661_HBSP_P-A Product feature CHAIN JQ707661_HBSP_P-A of FT:mat_peptide JQ707661_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_18). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707662_HBSP_P-A Product feature CHAIN JQ707662_HBSP_P-A of FT:mat_peptide JQ707662_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707663_HBSP_P-A Product feature CHAIN JQ707663_HBSP_P-A of FT:mat_peptide JQ707663_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707664_HBSP_P-A Product feature CHAIN JQ707664_HBSP_P-A of FT:mat_peptide JQ707664_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_20). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707665_HBSP_P-A Product feature CHAIN JQ707665_HBSP_P-A of FT:mat_peptide JQ707665_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707667_HBSP_P-A Product feature CHAIN JQ707667_HBSP_P-A of FT:mat_peptide JQ707667_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707669_HBSP_P-A Product feature CHAIN JQ707669_HBSP_P-A of FT:mat_peptide JQ707669_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707670_HBSP_P-A Product feature CHAIN JQ707670_HBSP_P-A of FT:mat_peptide JQ707670_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_29). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707672_HBSP_P-A Product feature CHAIN JQ707672_HBSP_P-A of FT:mat_peptide JQ707672_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_32). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707674_HBSP_P-A Product feature CHAIN JQ707674_HBSP_P-A of FT:mat_peptide JQ707674_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_38). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGNGPQSVSHGSVY
>gnl|hbvpro|JQ707675_HBSP_P-A Product feature CHAIN JQ707675_HBSP_P-A of FT:mat_peptide JQ707675_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_41). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707676_HBSP_P-A Product feature CHAIN JQ707676_HBSP_P-A of FT:mat_peptide JQ707676_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_42). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JQ707681_HBSP_P-A Product feature CHAIN JQ707681_HBSP_P-A of FT:mat_peptide JQ707681_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_9-12). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|JX096952_HBSP_P-A Product feature CHAIN JX096952_HBSP_P-A of FT:mat_peptide JX096952_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11-10165). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGNGPQSVSLGSVY
>gnl|hbvpro|JX096953_HBSP_P-A Product feature CHAIN JX096953_HBSP_P-A of FT:mat_peptide JX096953_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 12-8957). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX154579_HBSP_P-A Product feature CHAIN JX154579_HBSP_P-A of FT:mat_peptide JX154579_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS36). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX154580_HBSP_P-A Product feature CHAIN JX154580_HBSP_P-A of FT:mat_peptide JX154580_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS46). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX154581_HBSP_P-A Product feature CHAIN JX154581_HBSP_P-A of FT:mat_peptide JX154581_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS51). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX154582_HBSP_P-A Product feature CHAIN JX154582_HBSP_P-A of FT:mat_peptide JX154582_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS64). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX310721_HBSP_P-A Product feature CHAIN JX310721_HBSP_P-A of FT:mat_peptide JX310721_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX310722_HBSP_P-A Product feature CHAIN JX310722_HBSP_P-A of FT:mat_peptide JX310722_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX310723_HBSP_P-A Product feature CHAIN JX310723_HBSP_P-A of FT:mat_peptide JX310723_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX310724_HBSP_P-A Product feature CHAIN JX310724_HBSP_P-A of FT:mat_peptide JX310724_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|JX310725_HBSP_P-A Product feature CHAIN JX310725_HBSP_P-A of FT:mat_peptide JX310725_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC875251_HBSP_P-A Product feature CHAIN KC875251_HBSP_P-A of FT:mat_peptide KC875251_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV1). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC875252_HBSP_P-A Product feature CHAIN KC875252_HBSP_P-A of FT:mat_peptide KC875252_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV3). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC875253_HBSP_P-A Product feature CHAIN KC875253_HBSP_P-A of FT:mat_peptide KC875253_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV23). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC875254_HBSP_P-A Product feature CHAIN KC875254_HBSP_P-A of FT:mat_peptide KC875254_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV12). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC875255_HBSP_P-A Product feature CHAIN KC875255_HBSP_P-A of FT:mat_peptide KC875255_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV24). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC875256_HBSP_P-A Product feature CHAIN KC875256_HBSP_P-A of FT:mat_peptide KC875256_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV27). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC875259_HBSP_P-A Product feature CHAIN KC875259_HBSP_P-A of FT:mat_peptide KC875259_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV73). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLVLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KC875260_HBSP_P-A Product feature CHAIN KC875260_HBSP_P-A of FT:mat_peptide KC875260_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV5). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRRLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214657_HBSP_P-A Product feature CHAIN KF214657_HBSP_P-A of FT:mat_peptide KF214657_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214658_HBSP_P-A Product feature CHAIN KF214658_HBSP_P-A of FT:mat_peptide KF214658_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2009-6). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214659_HBSP_P-A Product feature CHAIN KF214659_HBSP_P-A of FT:mat_peptide KF214659_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2009-2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKETLCFPPVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214660_HBSP_P-A Product feature CHAIN KF214660_HBSP_P-A of FT:mat_peptide KF214660_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214661_HBSP_P-A Product feature CHAIN KF214661_HBSP_P-A of FT:mat_peptide KF214661_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214662_HBSP_P-A Product feature CHAIN KF214662_HBSP_P-A of FT:mat_peptide KF214662_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKAPLCFPPVAVQNL
RMETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214663_HBSP_P-A Product feature CHAIN KF214663_HBSP_P-A of FT:mat_peptide KF214663_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2007-11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214665_HBSP_P-A Product feature CHAIN KF214665_HBSP_P-A of FT:mat_peptide KF214665_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF214666_HBSP_P-A Product feature CHAIN KF214666_HBSP_P-A of FT:mat_peptide KF214666_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2010-7). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNLRT
EIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779210_HBSP_P-A Product feature CHAIN KF779210_HBSP_P-A of FT:mat_peptide KF779210_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5547). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRSLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779211_HBSP_P-A Product feature CHAIN KF779211_HBSP_P-A of FT:mat_peptide KF779211_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5691). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779213_HBSP_P-A Product feature CHAIN KF779213_HBSP_P-A of FT:mat_peptide KF779213_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5744). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLIDDGTEAGPLEEELPRLADADLNRRVAEDLHLRNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779215_HBSP_P-A Product feature CHAIN KF779215_HBSP_P-A of FT:mat_peptide KF779215_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5763). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLIDDGTEAGPLEEELPRLADADLNRRVAEDLHLRNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779221_HBSP_P-A Product feature CHAIN KF779221_HBSP_P-A of FT:mat_peptide KF779221_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5934). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADSDRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779227_HBSP_P-A Product feature CHAIN KF779227_HBSP_P-A of FT:mat_peptide KF779227_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6061). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779231_HBSP_P-A Product feature CHAIN KF779231_HBSP_P-A of FT:mat_peptide KF779231_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6084). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779232_HBSP_P-A Product feature CHAIN KF779232_HBSP_P-A of FT:mat_peptide KF779232_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6088). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPPVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779234_HBSP_P-A Product feature CHAIN KF779234_HBSP_P-A of FT:mat_peptide KF779234_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6104). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779238_HBSP_P-A Product feature CHAIN KF779238_HBSP_P-A of FT:mat_peptide KF779238_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6119). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779239_HBSP_P-A Product feature CHAIN KF779239_HBSP_P-A of FT:mat_peptide KF779239_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6120). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLAYADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779240_HBSP_P-A Product feature CHAIN KF779240_HBSP_P-A of FT:mat_peptide KF779240_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6123). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779243_HBSP_P-A Product feature CHAIN KF779243_HBSP_P-A of FT:mat_peptide KF779243_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6142). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779244_HBSP_P-A Product feature CHAIN KF779244_HBSP_P-A of FT:mat_peptide KF779244_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6152). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779245_HBSP_P-A Product feature CHAIN KF779245_HBSP_P-A of FT:mat_peptide KF779245_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6156). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779246_HBSP_P-A Product feature CHAIN KF779246_HBSP_P-A of FT:mat_peptide KF779246_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6163). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779247_HBSP_P-A Product feature CHAIN KF779247_HBSP_P-A of FT:mat_peptide KF779247_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6164). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779248_HBSP_P-A Product feature CHAIN KF779248_HBSP_P-A of FT:mat_peptide KF779248_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6168). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779249_HBSP_P-A Product feature CHAIN KF779249_HBSP_P-A of FT:mat_peptide KF779249_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6173). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779251_HBSP_P-A Product feature CHAIN KF779251_HBSP_P-A of FT:mat_peptide KF779251_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3787). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779252_HBSP_P-A Product feature CHAIN KF779252_HBSP_P-A of FT:mat_peptide KF779252_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3809). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779253_HBSP_P-A Product feature CHAIN KF779253_HBSP_P-A of FT:mat_peptide KF779253_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3817). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779254_HBSP_P-A Product feature CHAIN KF779254_HBSP_P-A of FT:mat_peptide KF779254_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3820). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779255_HBSP_P-A Product feature CHAIN KF779255_HBSP_P-A of FT:mat_peptide KF779255_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3825). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779256_HBSP_P-A Product feature CHAIN KF779256_HBSP_P-A of FT:mat_peptide KF779256_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3829). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779257_HBSP_P-A Product feature CHAIN KF779257_HBSP_P-A of FT:mat_peptide KF779257_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3857). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779258_HBSP_P-A Product feature CHAIN KF779258_HBSP_P-A of FT:mat_peptide KF779258_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3864). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779259_HBSP_P-A Product feature CHAIN KF779259_HBSP_P-A of FT:mat_peptide KF779259_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3892). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779260_HBSP_P-A Product feature CHAIN KF779260_HBSP_P-A of FT:mat_peptide KF779260_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3894). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779261_HBSP_P-A Product feature CHAIN KF779261_HBSP_P-A of FT:mat_peptide KF779261_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3896). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVPNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779262_HBSP_P-A Product feature CHAIN KF779262_HBSP_P-A of FT:mat_peptide KF779262_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3898). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779263_HBSP_P-A Product feature CHAIN KF779263_HBSP_P-A of FT:mat_peptide KF779263_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3903). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779264_HBSP_P-A Product feature CHAIN KF779264_HBSP_P-A of FT:mat_peptide KF779264_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3945). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARFLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779265_HBSP_P-A Product feature CHAIN KF779265_HBSP_P-A of FT:mat_peptide KF779265_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3946). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADAYLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779266_HBSP_P-A Product feature CHAIN KF779266_HBSP_P-A of FT:mat_peptide KF779266_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3949). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRHGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779268_HBSP_P-A Product feature CHAIN KF779268_HBSP_P-A of FT:mat_peptide KF779268_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3966). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADASLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779269_HBSP_P-A Product feature CHAIN KF779269_HBSP_P-A of FT:mat_peptide KF779269_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4207). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779270_HBSP_P-A Product feature CHAIN KF779270_HBSP_P-A of FT:mat_peptide KF779270_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4219). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779271_HBSP_P-A Product feature CHAIN KF779271_HBSP_P-A of FT:mat_peptide KF779271_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4233). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779272_HBSP_P-A Product feature CHAIN KF779272_HBSP_P-A of FT:mat_peptide KF779272_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4236). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFTSHRPGLSQNTYGSGPQSASLGSVY
>gnl|hbvpro|KF779273_HBSP_P-A Product feature CHAIN KF779273_HBSP_P-A of FT:mat_peptide KF779273_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4237). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779274_HBSP_P-A Product feature CHAIN KF779274_HBSP_P-A of FT:mat_peptide KF779274_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4259). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779275_HBSP_P-A Product feature CHAIN KF779275_HBSP_P-A of FT:mat_peptide KF779275_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4283). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779276_HBSP_P-A Product feature CHAIN KF779276_HBSP_P-A of FT:mat_peptide KF779276_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4314). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|KF779277_HBSP_P-A Product feature CHAIN KF779277_HBSP_P-A of FT:mat_peptide KF779277_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4322). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779279_HBSP_P-A Product feature CHAIN KF779279_HBSP_P-A of FT:mat_peptide KF779279_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4359). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779280_HBSP_P-A Product feature CHAIN KF779280_HBSP_P-A of FT:mat_peptide KF779280_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4364). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSASLGSVY
>gnl|hbvpro|KF779281_HBSP_P-A Product feature CHAIN KF779281_HBSP_P-A of FT:mat_peptide KF779281_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4390). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779282_HBSP_P-A Product feature CHAIN KF779282_HBSP_P-A of FT:mat_peptide KF779282_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4392). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779283_HBSP_P-A Product feature CHAIN KF779283_HBSP_P-A of FT:mat_peptide KF779283_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4394). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779284_HBSP_P-A Product feature CHAIN KF779284_HBSP_P-A of FT:mat_peptide KF779284_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0574). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLAVSHINRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779286_HBSP_P-A Product feature CHAIN KF779286_HBSP_P-A of FT:mat_peptide KF779286_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0606). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779287_HBSP_P-A Product feature CHAIN KF779287_HBSP_P-A of FT:mat_peptide KF779287_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0613). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779290_HBSP_P-A Product feature CHAIN KF779290_HBSP_P-A of FT:mat_peptide KF779290_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0756). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779291_HBSP_P-A Product feature CHAIN KF779291_HBSP_P-A of FT:mat_peptide KF779291_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0765). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779293_HBSP_P-A Product feature CHAIN KF779293_HBSP_P-A of FT:mat_peptide KF779293_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0787). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVLPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779294_HBSP_P-A Product feature CHAIN KF779294_HBSP_P-A of FT:mat_peptide KF779294_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0796). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779295_HBSP_P-A Product feature CHAIN KF779295_HBSP_P-A of FT:mat_peptide KF779295_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0854). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|KF779297_HBSP_P-A Product feature CHAIN KF779297_HBSP_P-A of FT:mat_peptide KF779297_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0874). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLYRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779298_HBSP_P-A Product feature CHAIN KF779298_HBSP_P-A of FT:mat_peptide KF779298_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0908). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779299_HBSP_P-A Product feature CHAIN KF779299_HBSP_P-A of FT:mat_peptide KF779299_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0943). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779304_HBSP_P-A Product feature CHAIN KF779304_HBSP_P-A of FT:mat_peptide KF779304_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1039). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779305_HBSP_P-A Product feature CHAIN KF779305_HBSP_P-A of FT:mat_peptide KF779305_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1043). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779306_HBSP_P-A Product feature CHAIN KF779306_HBSP_P-A of FT:mat_peptide KF779306_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1093). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779307_HBSP_P-A Product feature CHAIN KF779307_HBSP_P-A of FT:mat_peptide KF779307_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1227). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779308_HBSP_P-A Product feature CHAIN KF779308_HBSP_P-A of FT:mat_peptide KF779308_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1293). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADPNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779309_HBSP_P-A Product feature CHAIN KF779309_HBSP_P-A of FT:mat_peptide KF779309_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1294). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779310_HBSP_P-A Product feature CHAIN KF779310_HBSP_P-A of FT:mat_peptide KF779310_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3845). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779311_HBSP_P-A Product feature CHAIN KF779311_HBSP_P-A of FT:mat_peptide KF779311_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3863). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADPNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779312_HBSP_P-A Product feature CHAIN KF779312_HBSP_P-A of FT:mat_peptide KF779312_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3907). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779313_HBSP_P-A Product feature CHAIN KF779313_HBSP_P-A of FT:mat_peptide KF779313_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3958). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779314_HBSP_P-A Product feature CHAIN KF779314_HBSP_P-A of FT:mat_peptide KF779314_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3985). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779315_HBSP_P-A Product feature CHAIN KF779315_HBSP_P-A of FT:mat_peptide KF779315_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4204). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779316_HBSP_P-A Product feature CHAIN KF779316_HBSP_P-A of FT:mat_peptide KF779316_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4247). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779317_HBSP_P-A Product feature CHAIN KF779317_HBSP_P-A of FT:mat_peptide KF779317_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4308). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779319_HBSP_P-A Product feature CHAIN KF779319_HBSP_P-A of FT:mat_peptide KF779319_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4323). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779320_HBSP_P-A Product feature CHAIN KF779320_HBSP_P-A of FT:mat_peptide KF779320_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4350). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779321_HBSP_P-A Product feature CHAIN KF779321_HBSP_P-A of FT:mat_peptide KF779321_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4362). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779322_HBSP_P-A Product feature CHAIN KF779322_HBSP_P-A of FT:mat_peptide KF779322_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4406). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779323_HBSP_P-A Product feature CHAIN KF779323_HBSP_P-A of FT:mat_peptide KF779323_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4414). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779324_HBSP_P-A Product feature CHAIN KF779324_HBSP_P-A of FT:mat_peptide KF779324_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4416). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779325_HBSP_P-A Product feature CHAIN KF779325_HBSP_P-A of FT:mat_peptide KF779325_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4422). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779326_HBSP_P-A Product feature CHAIN KF779326_HBSP_P-A of FT:mat_peptide KF779326_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4424). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779328_HBSP_P-A Product feature CHAIN KF779328_HBSP_P-A of FT:mat_peptide KF779328_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4532). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779329_HBSP_P-A Product feature CHAIN KF779329_HBSP_P-A of FT:mat_peptide KF779329_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4540). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVPEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779330_HBSP_P-A Product feature CHAIN KF779330_HBSP_P-A of FT:mat_peptide KF779330_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4541). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779331_HBSP_P-A Product feature CHAIN KF779331_HBSP_P-A of FT:mat_peptide KF779331_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4543). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779332_HBSP_P-A Product feature CHAIN KF779332_HBSP_P-A of FT:mat_peptide KF779332_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4549). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSENTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779333_HBSP_P-A Product feature CHAIN KF779333_HBSP_P-A of FT:mat_peptide KF779333_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4661). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779334_HBSP_P-A Product feature CHAIN KF779334_HBSP_P-A of FT:mat_peptide KF779334_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4673). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADAAPYRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779335_HBSP_P-A Product feature CHAIN KF779335_HBSP_P-A of FT:mat_peptide KF779335_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4687). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779336_HBSP_P-A Product feature CHAIN KF779336_HBSP_P-A of FT:mat_peptide KF779336_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4730). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779337_HBSP_P-A Product feature CHAIN KF779337_HBSP_P-A of FT:mat_peptide KF779337_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4733). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779338_HBSP_P-A Product feature CHAIN KF779338_HBSP_P-A of FT:mat_peptide KF779338_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4756). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779339_HBSP_P-A Product feature CHAIN KF779339_HBSP_P-A of FT:mat_peptide KF779339_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4804). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779342_HBSP_P-A Product feature CHAIN KF779342_HBSP_P-A of FT:mat_peptide KF779342_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4865). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779344_HBSP_P-A Product feature CHAIN KF779344_HBSP_P-A of FT:mat_peptide KF779344_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4928). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779345_HBSP_P-A Product feature CHAIN KF779345_HBSP_P-A of FT:mat_peptide KF779345_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4936). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779346_HBSP_P-A Product feature CHAIN KF779346_HBSP_P-A of FT:mat_peptide KF779346_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4938). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779347_HBSP_P-A Product feature CHAIN KF779347_HBSP_P-A of FT:mat_peptide KF779347_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4950). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779348_HBSP_P-A Product feature CHAIN KF779348_HBSP_P-A of FT:mat_peptide KF779348_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4951). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779349_HBSP_P-A Product feature CHAIN KF779349_HBSP_P-A of FT:mat_peptide KF779349_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4999). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779350_HBSP_P-A Product feature CHAIN KF779350_HBSP_P-A of FT:mat_peptide KF779350_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5005). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779351_HBSP_P-A Product feature CHAIN KF779351_HBSP_P-A of FT:mat_peptide KF779351_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5017). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779352_HBSP_P-A Product feature CHAIN KF779352_HBSP_P-A of FT:mat_peptide KF779352_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5034). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779354_HBSP_P-A Product feature CHAIN KF779354_HBSP_P-A of FT:mat_peptide KF779354_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5084). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779355_HBSP_P-A Product feature CHAIN KF779355_HBSP_P-A of FT:mat_peptide KF779355_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5121). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779356_HBSP_P-A Product feature CHAIN KF779356_HBSP_P-A of FT:mat_peptide KF779356_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5185). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779358_HBSP_P-A Product feature CHAIN KF779358_HBSP_P-A of FT:mat_peptide KF779358_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5263). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779359_HBSP_P-A Product feature CHAIN KF779359_HBSP_P-A of FT:mat_peptide KF779359_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5268). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779360_HBSP_P-A Product feature CHAIN KF779360_HBSP_P-A of FT:mat_peptide KF779360_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5279). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MLLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779361_HBSP_P-A Product feature CHAIN KF779361_HBSP_P-A of FT:mat_peptide KF779361_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5291). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779362_HBSP_P-A Product feature CHAIN KF779362_HBSP_P-A of FT:mat_peptide KF779362_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5296). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779363_HBSP_P-A Product feature CHAIN KF779363_HBSP_P-A of FT:mat_peptide KF779363_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5350). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779364_HBSP_P-A Product feature CHAIN KF779364_HBSP_P-A of FT:mat_peptide KF779364_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5374). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779365_HBSP_P-A Product feature CHAIN KF779365_HBSP_P-A of FT:mat_peptide KF779365_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5380). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KF779366_HBSP_P-A Product feature CHAIN KF779366_HBSP_P-A of FT:mat_peptide KF779366_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5383). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779367_HBSP_P-A Product feature CHAIN KF779367_HBSP_P-A of FT:mat_peptide KF779367_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5403). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779368_HBSP_P-A Product feature CHAIN KF779368_HBSP_P-A of FT:mat_peptide KF779368_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5421). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779369_HBSP_P-A Product feature CHAIN KF779369_HBSP_P-A of FT:mat_peptide KF779369_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5521). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779370_HBSP_P-A Product feature CHAIN KF779370_HBSP_P-A of FT:mat_peptide KF779370_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5594). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779371_HBSP_P-A Product feature CHAIN KF779371_HBSP_P-A of FT:mat_peptide KF779371_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5608). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779372_HBSP_P-A Product feature CHAIN KF779372_HBSP_P-A of FT:mat_peptide KF779372_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5654). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779373_HBSP_P-A Product feature CHAIN KF779373_HBSP_P-A of FT:mat_peptide KF779373_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5680). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779374_HBSP_P-A Product feature CHAIN KF779374_HBSP_P-A of FT:mat_peptide KF779374_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5743). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779375_HBSP_P-A Product feature CHAIN KF779375_HBSP_P-A of FT:mat_peptide KF779375_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5760). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779378_HBSP_P-A Product feature CHAIN KF779378_HBSP_P-A of FT:mat_peptide KF779378_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6064). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779379_HBSP_P-A Product feature CHAIN KF779379_HBSP_P-A of FT:mat_peptide KF779379_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6136). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779381_HBSP_P-A Product feature CHAIN KF779381_HBSP_P-A of FT:mat_peptide KF779381_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6268). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779383_HBSP_P-A Product feature CHAIN KF779383_HBSP_P-A of FT:mat_peptide KF779383_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6296). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779384_HBSP_P-A Product feature CHAIN KF779384_HBSP_P-A of FT:mat_peptide KF779384_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0061). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|KF779385_HBSP_P-A Product feature CHAIN KF779385_HBSP_P-A of FT:mat_peptide KF779385_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0098). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF779386_HBSP_P-A Product feature CHAIN KF779386_HBSP_P-A of FT:mat_peptide KF779386_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0138). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922406_HBSP_P-A Product feature CHAIN KF922406_HBSP_P-A of FT:mat_peptide KF922406_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922407_HBSP_P-A Product feature CHAIN KF922407_HBSP_P-A of FT:mat_peptide KF922407_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922408_HBSP_P-A Product feature CHAIN KF922408_HBSP_P-A of FT:mat_peptide KF922408_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922409_HBSP_P-A Product feature CHAIN KF922409_HBSP_P-A of FT:mat_peptide KF922409_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922414_HBSP_P-A Product feature CHAIN KF922414_HBSP_P-A of FT:mat_peptide KF922414_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDEAETGPLEEELPRLADEDLNRRVAEDLNLGNLNEQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922415_HBSP_P-A Product feature CHAIN KF922415_HBSP_P-A of FT:mat_peptide KF922415_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922416_HBSP_P-A Product feature CHAIN KF922416_HBSP_P-A of FT:mat_peptide KF922416_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922417_HBSP_P-A Product feature CHAIN KF922417_HBSP_P-A of FT:mat_peptide KF922417_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v4). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922418_HBSP_P-A Product feature CHAIN KF922418_HBSP_P-A of FT:mat_peptide KF922418_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922419_HBSP_P-A Product feature CHAIN KF922419_HBSP_P-A of FT:mat_peptide KF922419_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v6). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922420_HBSP_P-A Product feature CHAIN KF922420_HBSP_P-A of FT:mat_peptide KF922420_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v7). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922421_HBSP_P-A Product feature CHAIN KF922421_HBSP_P-A of FT:mat_peptide KF922421_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922424_HBSP_P-A Product feature CHAIN KF922424_HBSP_P-A of FT:mat_peptide KF922424_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070v1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922425_HBSP_P-A Product feature CHAIN KF922425_HBSP_P-A of FT:mat_peptide KF922425_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070v2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922426_HBSP_P-A Product feature CHAIN KF922426_HBSP_P-A of FT:mat_peptide KF922426_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922427_HBSP_P-A Product feature CHAIN KF922427_HBSP_P-A of FT:mat_peptide KF922427_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922428_HBSP_P-A Product feature CHAIN KF922428_HBSP_P-A of FT:mat_peptide KF922428_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922429_HBSP_P-A Product feature CHAIN KF922429_HBSP_P-A of FT:mat_peptide KF922429_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQLFRRLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922430_HBSP_P-A Product feature CHAIN KF922430_HBSP_P-A of FT:mat_peptide KF922430_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQLFRRLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922431_HBSP_P-A Product feature CHAIN KF922431_HBSP_P-A of FT:mat_peptide KF922431_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v3). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQLFRRLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922433_HBSP_P-A Product feature CHAIN KF922433_HBSP_P-A of FT:mat_peptide KF922433_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3658v1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQRVRDPAKPARLLLRTTLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922434_HBSP_P-A Product feature CHAIN KF922434_HBSP_P-A of FT:mat_peptide KF922434_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3658v2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQRVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922435_HBSP_P-A Product feature CHAIN KF922435_HBSP_P-A of FT:mat_peptide KF922435_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQSFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922436_HBSP_P-A Product feature CHAIN KF922436_HBSP_P-A of FT:mat_peptide KF922436_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQSFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KF922437_HBSP_P-A Product feature CHAIN KF922437_HBSP_P-A of FT:mat_peptide KF922437_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQSFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ010776_HBSP_P-A Product feature CHAIN KJ010776_HBSP_P-A of FT:mat_peptide KJ010776_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ010777_HBSP_P-A Product feature CHAIN KJ010777_HBSP_P-A of FT:mat_peptide KJ010777_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ010778_HBSP_P-A Product feature CHAIN KJ010778_HBSP_P-A of FT:mat_peptide KJ010778_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ194506_HBSP_P-A Product feature CHAIN KJ194506_HBSP_P-A of FT:mat_peptide KJ194506_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV_Amsterdam_1_1994). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ586809_HBSP_P-A Product feature CHAIN KJ586809_HBSP_P-A of FT:mat_peptide KJ586809_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843166_HBSP_P-A Product feature CHAIN KJ843166_HBSP_P-A of FT:mat_peptide KJ843166_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag04). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843172_HBSP_P-A Product feature CHAIN KJ843172_HBSP_P-A of FT:mat_peptide KJ843172_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RLEIAPVFPSHRPGLSQNTYGSGSQSVSLGSVY
>gnl|hbvpro|KJ843173_HBSP_P-A Product feature CHAIN KJ843173_HBSP_P-A of FT:mat_peptide KJ843173_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag11). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843182_HBSP_P-A Product feature CHAIN KJ843182_HBSP_P-A of FT:mat_peptide KJ843182_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843183_HBSP_P-A Product feature CHAIN KJ843183_HBSP_P-A of FT:mat_peptide KJ843183_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag22). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843184_HBSP_P-A Product feature CHAIN KJ843184_HBSP_P-A of FT:mat_peptide KJ843184_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag23). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843186_HBSP_P-A Product feature CHAIN KJ843186_HBSP_P-A of FT:mat_peptide KJ843186_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843188_HBSP_P-A Product feature CHAIN KJ843188_HBSP_P-A of FT:mat_peptide KJ843188_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843192_HBSP_P-A Product feature CHAIN KJ843192_HBSP_P-A of FT:mat_peptide KJ843192_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843214_HBSP_P-A Product feature CHAIN KJ843214_HBSP_P-A of FT:mat_peptide KJ843214_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag55). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843215_HBSP_P-A Product feature CHAIN KJ843215_HBSP_P-A of FT:mat_peptide KJ843215_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag56). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843216_HBSP_P-A Product feature CHAIN KJ843216_HBSP_P-A of FT:mat_peptide KJ843216_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag57). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPIRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843217_HBSP_P-A Product feature CHAIN KJ843217_HBSP_P-A of FT:mat_peptide KJ843217_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag62). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADGDLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ843218_HBSP_P-A Product feature CHAIN KJ843218_HBSP_P-A of FT:mat_peptide KJ843218_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag63). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854685_HBSP_P-A Product feature CHAIN KJ854685_HBSP_P-A of FT:mat_peptide KJ854685_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 116-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854686_HBSP_P-A Product feature CHAIN KJ854686_HBSP_P-A of FT:mat_peptide KJ854686_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1356-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854687_HBSP_P-A Product feature CHAIN KJ854687_HBSP_P-A of FT:mat_peptide KJ854687_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1377-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854688_HBSP_P-A Product feature CHAIN KJ854688_HBSP_P-A of FT:mat_peptide KJ854688_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1379-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854689_HBSP_P-A Product feature CHAIN KJ854689_HBSP_P-A of FT:mat_peptide KJ854689_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16202-NE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPARPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQPVSLGSIY
>gnl|hbvpro|KJ854690_HBSP_P-A Product feature CHAIN KJ854690_HBSP_P-A of FT:mat_peptide KJ854690_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16338-NE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854691_HBSP_P-A Product feature CHAIN KJ854691_HBSP_P-A of FT:mat_peptide KJ854691_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16650-NE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854692_HBSP_P-A Product feature CHAIN KJ854692_HBSP_P-A of FT:mat_peptide KJ854692_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17372-NE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854693_HBSP_P-A Product feature CHAIN KJ854693_HBSP_P-A of FT:mat_peptide KJ854693_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17545-NE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854694_HBSP_P-A Product feature CHAIN KJ854694_HBSP_P-A of FT:mat_peptide KJ854694_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17822-NE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854695_HBSP_P-A Product feature CHAIN KJ854695_HBSP_P-A of FT:mat_peptide KJ854695_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1814-N-BRA). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854696_HBSP_P-A Product feature CHAIN KJ854696_HBSP_P-A of FT:mat_peptide KJ854696_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 18158-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854697_HBSP_P-A Product feature CHAIN KJ854697_HBSP_P-A of FT:mat_peptide KJ854697_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1969-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854698_HBSP_P-A Product feature CHAIN KJ854698_HBSP_P-A of FT:mat_peptide KJ854698_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1993-N-BRA). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854699_HBSP_P-A Product feature CHAIN KJ854699_HBSP_P-A of FT:mat_peptide KJ854699_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2340-N-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGXGPQSVSLGSVY
>gnl|hbvpro|KJ854700_HBSP_P-A Product feature CHAIN KJ854700_HBSP_P-A of FT:mat_peptide KJ854700_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 313-N-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854701_HBSP_P-A Product feature CHAIN KJ854701_HBSP_P-A of FT:mat_peptide KJ854701_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 349-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLTDPQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854702_HBSP_P-A Product feature CHAIN KJ854702_HBSP_P-A of FT:mat_peptide KJ854702_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 41-CW-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854703_HBSP_P-A Product feature CHAIN KJ854703_HBSP_P-A of FT:mat_peptide KJ854703_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 65-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPARPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854704_HBSP_P-A Product feature CHAIN KJ854704_HBSP_P-A of FT:mat_peptide KJ854704_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 66-CW-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDEETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854705_HBSP_P-A Product feature CHAIN KJ854705_HBSP_P-A of FT:mat_peptide KJ854705_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 67-CW-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854706_HBSP_P-A Product feature CHAIN KJ854706_HBSP_P-A of FT:mat_peptide KJ854706_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 753-CW-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQRFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854707_HBSP_P-A Product feature CHAIN KJ854707_HBSP_P-A of FT:mat_peptide KJ854707_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 895-N-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854708_HBSP_P-A Product feature CHAIN KJ854708_HBSP_P-A of FT:mat_peptide KJ854708_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16-S-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854709_HBSP_P-A Product feature CHAIN KJ854709_HBSP_P-A of FT:mat_peptide KJ854709_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24-S-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDXTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KJ854710_HBSP_P-A Product feature CHAIN KJ854710_HBSP_P-A of FT:mat_peptide KJ854710_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 274-SE-BRA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM243029_HBSP_P-A Product feature CHAIN KM243029_HBSP_P-A of FT:mat_peptide KM243029_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TAC455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM519452_HBSP_P-A Product feature CHAIN KM519452_HBSP_P-A of FT:mat_peptide KM519452_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_G1862T_Mutant_SA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM519453_HBSP_P-A Product feature CHAIN KM519453_HBSP_P-A of FT:mat_peptide KM519453_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_Wild_SA). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM519454_HBSP_P-A Product feature CHAIN KM519454_HBSP_P-A of FT:mat_peptide KM519454_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_WT_BEL). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSHGSVY
>gnl|hbvpro|KM606737_HBSP_P-A Product feature CHAIN KM606737_HBSP_P-A of FT:mat_peptide KM606737_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba13a). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|KM606742_HBSP_P-A Product feature CHAIN KM606742_HBSP_P-A of FT:mat_peptide KM606742_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM606746_HBSP_P-A Product feature CHAIN KM606746_HBSP_P-A of FT:mat_peptide KM606746_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba14). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM606748_HBSP_P-A Product feature CHAIN KM606748_HBSP_P-A of FT:mat_peptide KM606748_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba51). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KM606749_HBSP_P-A Product feature CHAIN KM606749_HBSP_P-A of FT:mat_peptide KM606749_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba56). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168422_HBSP_P-A Product feature CHAIN KP168422_HBSP_P-A of FT:mat_peptide KP168422_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN136). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDXETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDLAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168423_HBSP_P-A Product feature CHAIN KP168423_HBSP_P-A of FT:mat_peptide KP168423_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB517). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168424_HBSP_P-A Product feature CHAIN KP168424_HBSP_P-A of FT:mat_peptide KP168424_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM571). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVX
>gnl|hbvpro|KP168425_HBSP_P-A Product feature CHAIN KP168425_HBSP_P-A of FT:mat_peptide KP168425_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS119). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168426_HBSP_P-A Product feature CHAIN KP168426_HBSP_P-A of FT:mat_peptide KP168426_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM05). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNXYGSGPQSVSLGSVY
>gnl|hbvpro|KP168427_HBSP_P-A Product feature CHAIN KP168427_HBSP_P-A of FT:mat_peptide KP168427_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB201). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQQPARDPAKPARLLLKATLCFPHVAVQNL
RXEIAPVFPSHHLGLSQNXYGXGPQSVSLGSVY
>gnl|hbvpro|KP168428_HBSP_P-A Product feature CHAIN KP168428_HBSP_P-A of FT:mat_peptide KP168428_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN195). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVATEXGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHAAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168429_HBSP_P-A Product feature CHAIN KP168429_HBSP_P-A of FT:mat_peptide KP168429_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN033). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KP168430_HBSP_P-A Product feature CHAIN KP168430_HBSP_P-A of FT:mat_peptide KP168430_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168431_HBSP_P-A Product feature CHAIN KP168431_HBSP_P-A of FT:mat_peptide KP168431_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM03). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARGPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168432_HBSP_P-A Product feature CHAIN KP168432_HBSP_P-A of FT:mat_peptide KP168432_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB213). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168433_HBSP_P-A Product feature CHAIN KP168433_HBSP_P-A of FT:mat_peptide KP168433_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB04). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168434_HBSP_P-A Product feature CHAIN KP168434_HBSP_P-A of FT:mat_peptide KP168434_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM564). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP168435_HBSP_P-A Product feature CHAIN KP168435_HBSP_P-A of FT:mat_peptide KP168435_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS117). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEELNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RXEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP274925_HBSP_P-A Product feature CHAIN KP274925_HBSP_P-A of FT:mat_peptide KP274925_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADGDLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP274927_HBSP_P-A Product feature CHAIN KP274927_HBSP_P-A of FT:mat_peptide KP274927_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP274928_HBSP_P-A Product feature CHAIN KP274928_HBSP_P-A of FT:mat_peptide KP274928_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718085_HBSP_P-A Product feature CHAIN KP718085_HBSP_P-A of FT:mat_peptide KP718085_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-12-1-26). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718086_HBSP_P-A Product feature CHAIN KP718086_HBSP_P-A of FT:mat_peptide KP718086_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-03-02-1-60). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718087_HBSP_P-A Product feature CHAIN KP718087_HBSP_P-A of FT:mat_peptide KP718087_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1897). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718088_HBSP_P-A Product feature CHAIN KP718088_HBSP_P-A of FT:mat_peptide KP718088_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1162). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718089_HBSP_P-A Product feature CHAIN KP718089_HBSP_P-A of FT:mat_peptide KP718089_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1249). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|KP718090_HBSP_P-A Product feature CHAIN KP718090_HBSP_P-A of FT:mat_peptide KP718090_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1348). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718091_HBSP_P-A Product feature CHAIN KP718091_HBSP_P-A of FT:mat_peptide KP718091_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1771). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718092_HBSP_P-A Product feature CHAIN KP718092_HBSP_P-A of FT:mat_peptide KP718092_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1891). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718093_HBSP_P-A Product feature CHAIN KP718093_HBSP_P-A of FT:mat_peptide KP718093_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1202). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718094_HBSP_P-A Product feature CHAIN KP718094_HBSP_P-A of FT:mat_peptide KP718094_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8757_TR). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718095_HBSP_P-A Product feature CHAIN KP718095_HBSP_P-A of FT:mat_peptide KP718095_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8809_TR). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEAEAGPLEEEPPRLADEDLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718096_HBSP_P-A Product feature CHAIN KP718096_HBSP_P-A of FT:mat_peptide KP718096_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-0004). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718097_HBSP_P-A Product feature CHAIN KP718097_HBSP_P-A of FT:mat_peptide KP718097_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13-1943). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718098_HBSP_P-A Product feature CHAIN KP718098_HBSP_P-A of FT:mat_peptide KP718098_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3106_HIV). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718099_HBSP_P-A Product feature CHAIN KP718099_HBSP_P-A of FT:mat_peptide KP718099_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13-378). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718100_HBSP_P-A Product feature CHAIN KP718100_HBSP_P-A of FT:mat_peptide KP718100_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 137_HIV). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718101_HBSP_P-A Product feature CHAIN KP718101_HBSP_P-A of FT:mat_peptide KP718101_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP11-3018). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP718102_HBSP_P-A Product feature CHAIN KP718102_HBSP_P-A of FT:mat_peptide KP718102_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP12-1400). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELXRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KP995108_HBSP_P-A Product feature CHAIN KP995108_HBSP_P-A of FT:mat_peptide KP995108_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 203-Cirrhosis). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KR905425_HBSP_P-A Product feature CHAIN KR905425_HBSP_P-A of FT:mat_peptide KR905425_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-24). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLYFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGGGPQSVSLGSVH
>gnl|hbvpro|KR905426_HBSP_P-A Product feature CHAIN KR905426_HBSP_P-A of FT:mat_peptide KR905426_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGGGPQPVSLGSVY
>gnl|hbvpro|KR905427_HBSP_P-A Product feature CHAIN KR905427_HBSP_P-A of FT:mat_peptide KR905427_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-30). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDQQQPALDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KR905429_HBSP_P-A Product feature CHAIN KR905429_HBSP_P-A of FT:mat_peptide KR905429_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-35). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNEHQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGVSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|KR905430_HBSP_P-A Product feature CHAIN KR905430_HBSP_P-A of FT:mat_peptide KR905430_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-47). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPAQDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KR905431_HBSP_P-A Product feature CHAIN KR905431_HBSP_P-A of FT:mat_peptide KR905431_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-77). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPAQDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT151611_HBSP_P-A Product feature CHAIN KT151611_HBSP_P-A of FT:mat_peptide KT151611_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 398). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPAQDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHXGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT151612_HBSP_P-A Product feature CHAIN KT151612_HBSP_P-A of FT:mat_peptide KT151612_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 500). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLEEEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHXGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT151613_HBSP_P-A Product feature CHAIN KT151613_HBSP_P-A of FT:mat_peptide KT151613_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 792). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHXGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT151614_HBSP_P-A Product feature CHAIN KT151614_HBSP_P-A of FT:mat_peptide KT151614_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 969). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHXGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT151615_HBSP_P-A Product feature CHAIN KT151615_HBSP_P-A of FT:mat_peptide KT151615_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 191). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHXGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT151616_HBSP_P-A Product feature CHAIN KT151616_HBSP_P-A of FT:mat_peptide KT151616_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 655). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHXGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT151617_HBSP_P-A Product feature CHAIN KT151617_HBSP_P-A of FT:mat_peptide KT151617_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 803). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLEEEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHXGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT151618_HBSP_P-A Product feature CHAIN KT151618_HBSP_P-A of FT:mat_peptide KT151618_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 590). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHXGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT347087_HBSP_P-A Product feature CHAIN KT347087_HBSP_P-A of FT:mat_peptide KT347087_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM265). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQRVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT347088_HBSP_P-A Product feature CHAIN KT347088_HBSP_P-A of FT:mat_peptide KT347088_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM285). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT347091_HBSP_P-A Product feature CHAIN KT347091_HBSP_P-A of FT:mat_peptide KT347091_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM3). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT347092_HBSP_P-A Product feature CHAIN KT347092_HBSP_P-A of FT:mat_peptide KT347092_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT366466_HBSP_P-A Product feature CHAIN KT366466_HBSP_P-A of FT:mat_peptide KT366466_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.7). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLYFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGGGPQSVSLGSVH
>gnl|hbvpro|KT366467_HBSP_P-A Product feature CHAIN KT366467_HBSP_P-A of FT:mat_peptide KT366467_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.9). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGGGPQPVSLGSIY
>gnl|hbvpro|KT366468_HBSP_P-A Product feature CHAIN KT366468_HBSP_P-A of FT:mat_peptide KT366468_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.27). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPAQDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT366469_HBSP_P-A Product feature CHAIN KT366469_HBSP_P-A of FT:mat_peptide KT366469_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.28). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT366470_HBSP_P-A Product feature CHAIN KT366470_HBSP_P-A of FT:mat_peptide KT366470_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.31). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPAQDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT366471_HBSP_P-A Product feature CHAIN KT366471_HBSP_P-A of FT:mat_peptide KT366471_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.50). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749822_HBSP_P-A Product feature CHAIN KT749822_HBSP_P-A of FT:mat_peptide KT749822_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL19). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRNVLLLDTGTEAGLLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDHAKLARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749824_HBSP_P-A Product feature CHAIN KT749824_HBSP_P-A of FT:mat_peptide KT749824_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL2b). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749825_HBSP_P-A Product feature CHAIN KT749825_HBSP_P-A of FT:mat_peptide KT749825_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4a). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KT749826_HBSP_P-A Product feature CHAIN KT749826_HBSP_P-A of FT:mat_peptide KT749826_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4b). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KT749829_HBSP_P-A Product feature CHAIN KT749829_HBSP_P-A of FT:mat_peptide KT749829_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL7). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749830_HBSP_P-A Product feature CHAIN KT749830_HBSP_P-A of FT:mat_peptide KT749830_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5b). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749831_HBSP_P-A Product feature CHAIN KT749831_HBSP_P-A of FT:mat_peptide KT749831_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL8). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749832_HBSP_P-A Product feature CHAIN KT749832_HBSP_P-A of FT:mat_peptide KT749832_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749833_HBSP_P-A Product feature CHAIN KT749833_HBSP_P-A of FT:mat_peptide KT749833_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9b). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RKEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749834_HBSP_P-A Product feature CHAIN KT749834_HBSP_P-A of FT:mat_peptide KT749834_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9a). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLAYADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|KT749835_HBSP_P-A Product feature CHAIN KT749835_HBSP_P-A of FT:mat_peptide KT749835_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9c). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749836_HBSP_P-A Product feature CHAIN KT749836_HBSP_P-A of FT:mat_peptide KT749836_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL12). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749837_HBSP_P-A Product feature CHAIN KT749837_HBSP_P-A of FT:mat_peptide KT749837_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL15). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749838_HBSP_P-A Product feature CHAIN KT749838_HBSP_P-A of FT:mat_peptide KT749838_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749839_HBSP_P-A Product feature CHAIN KT749839_HBSP_P-A of FT:mat_peptide KT749839_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5d). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEQELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|KT749840_HBSP_P-A Product feature CHAIN KT749840_HBSP_P-A of FT:mat_peptide KT749840_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL18). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749842_HBSP_P-A Product feature CHAIN KT749842_HBSP_P-A of FT:mat_peptide KT749842_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4e). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|KT749843_HBSP_P-A Product feature CHAIN KT749843_HBSP_P-A of FT:mat_peptide KT749843_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5c). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749844_HBSP_P-A Product feature CHAIN KT749844_HBSP_P-A of FT:mat_peptide KT749844_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KT749846_HBSP_P-A Product feature CHAIN KT749846_HBSP_P-A of FT:mat_peptide KT749846_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4f). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|KT749847_HBSP_P-A Product feature CHAIN KT749847_HBSP_P-A of FT:mat_peptide KT749847_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4d). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|KT749849_HBSP_P-A Product feature CHAIN KT749849_HBSP_P-A of FT:mat_peptide KT749849_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4c). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGIGPQSVSHGSVY
>gnl|hbvpro|KT749850_HBSP_P-A Product feature CHAIN KT749850_HBSP_P-A of FT:mat_peptide KT749850_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL21). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU605532_HBSP_P-A Product feature CHAIN KU605532_HBSP_P-A of FT:mat_peptide KU605532_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486Baseline). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU605533_HBSP_P-A Product feature CHAIN KU605533_HBSP_P-A of FT:mat_peptide KU605533_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787Baseline). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU605534_HBSP_P-A Product feature CHAIN KU605534_HBSP_P-A of FT:mat_peptide KU605534_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU605535_HBSP_P-A Product feature CHAIN KU605535_HBSP_P-A of FT:mat_peptide KU605535_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163Baseline). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU605536_HBSP_P-A Product feature CHAIN KU605536_HBSP_P-A of FT:mat_peptide KU605536_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643Baseline). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQPQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU605537_HBSP_P-A Product feature CHAIN KU605537_HBSP_P-A of FT:mat_peptide KU605537_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQPQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU605538_HBSP_P-A Product feature CHAIN KU605538_HBSP_P-A of FT:mat_peptide KU605538_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQPQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU605539_HBSP_P-A Product feature CHAIN KU605539_HBSP_P-A of FT:mat_peptide KU605539_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQPQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU736918_HBSP_P-A Product feature CHAIN KU736918_HBSP_P-A of FT:mat_peptide KU736918_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU736919_HBSP_P-A Product feature CHAIN KU736919_HBSP_P-A of FT:mat_peptide KU736919_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KU736920_HBSP_P-A Product feature CHAIN KU736920_HBSP_P-A of FT:mat_peptide KU736920_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Sudan_10). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX276769_HBSP_P-A Product feature CHAIN KX276769_HBSP_P-A of FT:mat_peptide KX276769_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEELNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGXSXNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357640_HBSP_P-A Product feature CHAIN KX357640_HBSP_P-A of FT:mat_peptide KX357640_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA11ETH). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357642_HBSP_P-A Product feature CHAIN KX357642_HBSP_P-A of FT:mat_peptide KX357642_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JM16ETH). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357643_HBSP_P-A Product feature CHAIN KX357643_HBSP_P-A of FT:mat_peptide KX357643_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MK156ETH). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQRPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357644_HBSP_P-A Product feature CHAIN KX357644_HBSP_P-A of FT:mat_peptide KX357644_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA152ETH). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357645_HBSP_P-A Product feature CHAIN KX357645_HBSP_P-A of FT:mat_peptide KX357645_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA162ETH). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357646_HBSP_P-A Product feature CHAIN KX357646_HBSP_P-A of FT:mat_peptide KX357646_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL185ETH). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
WMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357647_HBSP_P-A Product feature CHAIN KX357647_HBSP_P-A of FT:mat_peptide KX357647_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL13ETH). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357649_HBSP_P-A Product feature CHAIN KX357649_HBSP_P-A of FT:mat_peptide KX357649_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA86ETH). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX357650_HBSP_P-A Product feature CHAIN KX357650_HBSP_P-A of FT:mat_peptide KX357650_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA46ETH). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX648547_HBSP_P-A Product feature CHAIN KX648547_HBSP_P-A of FT:mat_peptide KX648547_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi12_103). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEAAAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLFFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|KX648548_HBSP_P-A Product feature CHAIN KX648548_HBSP_P-A of FT:mat_peptide KX648548_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_091). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|KX648549_HBSP_P-A Product feature CHAIN KX648549_HBSP_P-A of FT:mat_peptide KX648549_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_172). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPAGPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSIY
>gnl|hbvpro|KX827293_HBSP_P-A Product feature CHAIN KX827293_HBSP_P-A of FT:mat_peptide KX827293_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno5.4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX827294_HBSP_P-A Product feature CHAIN KX827294_HBSP_P-A of FT:mat_peptide KX827294_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.2). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX827295_HBSP_P-A Product feature CHAIN KX827295_HBSP_P-A of FT:mat_peptide KX827295_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.3). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX827296_HBSP_P-A Product feature CHAIN KX827296_HBSP_P-A of FT:mat_peptide KX827296_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.5). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX827297_HBSP_P-A Product feature CHAIN KX827297_HBSP_P-A of FT:mat_peptide KX827297_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno9.1). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLSRRVAEDLNLGNLNDQQQPVRDHARPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KX827298_HBSP_P-A Product feature CHAIN KX827298_HBSP_P-A of FT:mat_peptide KX827298_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno9.4). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY003230_HBSP_P-A Product feature CHAIN KY003230_HBSP_P-A of FT:mat_peptide KY003230_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 20160922). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY382410_HBSP_P-A Product feature CHAIN KY382410_HBSP_P-A of FT:mat_peptide KY382410_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_wt). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|KY886219_HBSP_P-A Product feature CHAIN KY886219_HBSP_P-A of FT:mat_peptide KY886219_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|L13994_HBSP_P-A Product feature CHAIN L13994_HBSP_P-A of FT:mat_peptide L13994_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC051141_HBSP_P-A Product feature CHAIN LC051141_HBSP_P-A of FT:mat_peptide LC051141_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0620). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC074724_HBSP_P-A Product feature CHAIN LC074724_HBSP_P-A of FT:mat_peptide LC074724_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p621). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC311241_HBSP_P-A Product feature CHAIN LC311241_HBSP_P-A of FT:mat_peptide LC311241_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p509). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC311242_HBSP_P-A Product feature CHAIN LC311242_HBSP_P-A of FT:mat_peptide LC311242_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p90). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC311243_HBSP_P-A Product feature CHAIN LC311243_HBSP_P-A of FT:mat_peptide LC311243_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p121). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC458430_HBSP_P-A Product feature CHAIN LC458430_HBSP_P-A of FT:mat_peptide LC458430_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB01). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LC458431_HBSP_P-A Product feature CHAIN LC458431_HBSP_P-A of FT:mat_peptide LC458431_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB03). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|LT992440_HBSP_P-A Product feature CHAIN LT992440_HBSP_P-A of FT:mat_peptide LT992440_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DA119). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|LT992441_HBSP_P-A Product feature CHAIN LT992441_HBSP_P-A of FT:mat_peptide LT992441_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DA195). Complete genome. [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDQQRPVRDHAKPARLLLKATLCFPHVAVQNLRM
EIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|LT992448_HBSP_P-A Product feature CHAIN LT992448_HBSP_P-A of FT:mat_peptide LT992448_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RISE386). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=111 residues).
MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPRPPVRDHAKPARLLLKATLCIPHVAVQNLRM
EIAPVFPSHHLGLSQNTYGSGPQPVSPGSVY
>gnl|hbvpro|M57663_HBSP_P-A Product feature CHAIN M57663_HBSP_P-A of FT:mat_peptide M57663_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF772344_HBSP_P-A Product feature CHAIN MF772344_HBSP_P-A of FT:mat_peptide MF772344_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV1662). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRAHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF772345_HBSP_P-A Product feature CHAIN MF772345_HBSP_P-A of FT:mat_peptide MF772345_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1959). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLVLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPARDHARPAQLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF772346_HBSP_P-A Product feature CHAIN MF772346_HBSP_P-A of FT:mat_peptide MF772346_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 855_16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLVLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVREHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF772347_HBSP_P-A Product feature CHAIN MF772347_HBSP_P-A of FT:mat_peptide MF772347_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 970). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLQFPHVAVQNL
RMEIAPVFPSRRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF772348_HBSP_P-A Product feature CHAIN MF772348_HBSP_P-A of FT:mat_peptide MF772348_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV120). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTESGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF772350_HBSP_P-A Product feature CHAIN MF772350_HBSP_P-A of FT:mat_peptide MF772350_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 64106). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF772351_HBSP_P-A Product feature CHAIN MF772351_HBSP_P-A of FT:mat_peptide MF772351_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1141). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF772353_HBSP_P-A Product feature CHAIN MF772353_HBSP_P-A of FT:mat_peptide MF772353_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV580). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQDTYGSGPQSVSLGSVY
>gnl|hbvpro|MF925361_HBSP_P-A Product feature CHAIN MF925361_HBSP_P-A of FT:mat_peptide MF925361_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV04). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF925362_HBSP_P-A Product feature CHAIN MF925362_HBSP_P-A of FT:mat_peptide MF925362_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV05). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEAKAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF925368_HBSP_P-A Product feature CHAIN MF925368_HBSP_P-A of FT:mat_peptide MF925368_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV12). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF925372_HBSP_P-A Product feature CHAIN MF925372_HBSP_P-A of FT:mat_peptide MF925372_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV16). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF925373_HBSP_P-A Product feature CHAIN MF925373_HBSP_P-A of FT:mat_peptide MF925373_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV17). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF925385_HBSP_P-A Product feature CHAIN MF925385_HBSP_P-A of FT:mat_peptide MF925385_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV29). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF925400_HBSP_P-A Product feature CHAIN MF925400_HBSP_P-A of FT:mat_peptide MF925400_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV46). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MF925407_HBSP_P-A Product feature CHAIN MF925407_HBSP_P-A of FT:mat_peptide MF925407_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV54). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464808_HBSP_P-A Product feature CHAIN MH464808_HBSP_P-A of FT:mat_peptide MH464808_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA86). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFXKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGXGPQSVSLGSVY
>gnl|hbvpro|MH464809_HBSP_P-A Product feature CHAIN MH464809_HBSP_P-A of FT:mat_peptide MH464809_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA87). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDAELEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHPGLSQNTYGSGPQSVSLGPVY
>gnl|hbvpro|MH464810_HBSP_P-A Product feature CHAIN MH464810_HBSP_P-A of FT:mat_peptide MH464810_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA88). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464811_HBSP_P-A Product feature CHAIN MH464811_HBSP_P-A of FT:mat_peptide MH464811_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA89). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDAELEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARXLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464812_HBSP_P-A Product feature CHAIN MH464812_HBSP_P-A of FT:mat_peptide MH464812_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA90). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464813_HBSP_P-A Product feature CHAIN MH464813_HBSP_P-A of FT:mat_peptide MH464813_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA91). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464814_HBSP_P-A Product feature CHAIN MH464814_HBSP_P-A of FT:mat_peptide MH464814_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA92). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464815_HBSP_P-A Product feature CHAIN MH464815_HBSP_P-A of FT:mat_peptide MH464815_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA93). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464816_HBSP_P-A Product feature CHAIN MH464816_HBSP_P-A of FT:mat_peptide MH464816_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA94). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIALVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464818_HBSP_P-A Product feature CHAIN MH464818_HBSP_P-A of FT:mat_peptide MH464818_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA96). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464819_HBSP_P-A Product feature CHAIN MH464819_HBSP_P-A of FT:mat_peptide MH464819_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA97). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464820_HBSP_P-A Product feature CHAIN MH464820_HBSP_P-A of FT:mat_peptide MH464820_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA98). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDQQQPVRDPAKPTRLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464821_HBSP_P-A Product feature CHAIN MH464821_HBSP_P-A of FT:mat_peptide MH464821_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA99). Partial genome (Contains: HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464822_HBSP_P-A Product feature CHAIN MH464822_HBSP_P-A of FT:mat_peptide MH464822_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA100). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464824_HBSP_P-A Product feature CHAIN MH464824_HBSP_P-A of FT:mat_peptide MH464824_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA102). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464825_HBSP_P-A Product feature CHAIN MH464825_HBSP_P-A of FT:mat_peptide MH464825_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA103). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAEPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQPVSLGSVY
>gnl|hbvpro|MH464826_HBSP_P-A Product feature CHAIN MH464826_HBSP_P-A of FT:mat_peptide MH464826_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA104). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464827_HBSP_P-A Product feature CHAIN MH464827_HBSP_P-A of FT:mat_peptide MH464827_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA105). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464828_HBSP_P-A Product feature CHAIN MH464828_HBSP_P-A of FT:mat_peptide MH464828_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA106). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464829_HBSP_P-A Product feature CHAIN MH464829_HBSP_P-A of FT:mat_peptide MH464829_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA107). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKANLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH464830_HBSP_P-A Product feature CHAIN MH464830_HBSP_P-A of FT:mat_peptide MH464830_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA108). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKAPLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MH580627_HBSP_P-A Product feature CHAIN MH580627_HBSP_P-A of FT:mat_peptide MH580627_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 299). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|MH580639_HBSP_P-A Product feature CHAIN MH580639_HBSP_P-A of FT:mat_peptide MH580639_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 420). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|MH580642_HBSP_P-A Product feature CHAIN MH580642_HBSP_P-A of FT:mat_peptide MH580642_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 443). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|MH580643_HBSP_P-A Product feature CHAIN MH580643_HBSP_P-A of FT:mat_peptide MH580643_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 446). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQPPVRDPAEPARLLLKATLCFPHVVVQNL
RTEIAPVFPSHHPGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|MH932713_HBSP_P-A Product feature CHAIN MH932713_HBSP_P-A of FT:mat_peptide MH932713_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Hiroshima GtA CL1). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512456_HBSP_P-A Product feature CHAIN MK512456_HBSP_P-A of FT:mat_peptide MK512456_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw3531). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512457_HBSP_P-A Product feature CHAIN MK512457_HBSP_P-A of FT:mat_peptide MK512457_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw3173). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512458_HBSP_P-A Product feature CHAIN MK512458_HBSP_P-A of FT:mat_peptide MK512458_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2244). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512459_HBSP_P-A Product feature CHAIN MK512459_HBSP_P-A of FT:mat_peptide MK512459_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2226). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512460_HBSP_P-A Product feature CHAIN MK512460_HBSP_P-A of FT:mat_peptide MK512460_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2199). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLANKNLNRRVAKDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512461_HBSP_P-A Product feature CHAIN MK512461_HBSP_P-A of FT:mat_peptide MK512461_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2157). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512462_HBSP_P-A Product feature CHAIN MK512462_HBSP_P-A of FT:mat_peptide MK512462_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2113). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSFS
>gnl|hbvpro|MK512463_HBSP_P-A Product feature CHAIN MK512463_HBSP_P-A of FT:mat_peptide MK512463_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2086). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEVGPLEEELPRLADKDLNRRVAENLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512464_HBSP_P-A Product feature CHAIN MK512464_HBSP_P-A of FT:mat_peptide MK512464_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2016). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLFLDDETEAGPLEEELPRLADEDFNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|MK512465_HBSP_P-A Product feature CHAIN MK512465_HBSP_P-A of FT:mat_peptide MK512465_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2003). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512466_HBSP_P-A Product feature CHAIN MK512466_HBSP_P-A of FT:mat_peptide MK512466_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-226). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNSYGSGPQSVSLGSVY
>gnl|hbvpro|MK512467_HBSP_P-A Product feature CHAIN MK512467_HBSP_P-A of FT:mat_peptide MK512467_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-220). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512469_HBSP_P-A Product feature CHAIN MK512469_HBSP_P-A of FT:mat_peptide MK512469_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-136). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSPGSVY
>gnl|hbvpro|MK512470_HBSP_P-A Product feature CHAIN MK512470_HBSP_P-A of FT:mat_peptide MK512470_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-126). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512471_HBSP_P-A Product feature CHAIN MK512471_HBSP_P-A of FT:mat_peptide MK512471_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-120). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512472_HBSP_P-A Product feature CHAIN MK512472_HBSP_P-A of FT:mat_peptide MK512472_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-65). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512473_HBSP_P-A Product feature CHAIN MK512473_HBSP_P-A of FT:mat_peptide MK512473_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-48). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512474_HBSP_P-A Product feature CHAIN MK512474_HBSP_P-A of FT:mat_peptide MK512474_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-37). Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRPADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512475_HBSP_P-A Product feature CHAIN MK512475_HBSP_P-A of FT:mat_peptide MK512475_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-25). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPARDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSIY
>gnl|hbvpro|MK512476_HBSP_P-A Product feature CHAIN MK512476_HBSP_P-A of FT:mat_peptide MK512476_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-14). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RTEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|MK512477_HBSP_P-A Product feature CHAIN MK512477_HBSP_P-A of FT:mat_peptide MK512477_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-03). Partial genome (Contains: HBx, SHBs, HBSP). [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDVESEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|V00866_HBSP_P-A Product feature CHAIN V00866_HBSP_P-A of FT:mat_peptide V00866_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLSFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|X02763_HBSP_C-A Product feature CHAIN X02763_HBSP_C-A of FT:mat_peptide X02763_HBSP_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLHRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|X51970_HBSP_P-A Product feature CHAIN X51970_HBSP_P-A of FT:mat_peptide X51970_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRLGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|X70185_HBSP_P-A Product feature CHAIN X70185_HBSP_P-A of FT:mat_peptide X70185_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A938). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|Z35717_HBSP_P-A Product feature CHAIN Z35717_HBSP_P-A of FT:mat_peptide Z35717_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hb614). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RMEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
>gnl|hbvpro|Z72478_HBSP_P-A Product feature CHAIN Z72478_HBSP_P-A of FT:mat_peptide Z72478_HBSP_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A317). Complete genome. [Hepadnaviridae] (length=113 residues).
MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNL
RLEIAPVFPSHRPGLSQNTYGSGPQSVSLGSVY
© 1998-2019