HBVdb

Dataset for protein HBc of genotype A

[Download (right click)] [Alignment] [Repertoires]

1523 sequence(s)

>gnl|hbvpro|AB014370_HBc_P-A Product feature CHAIN AB014370_HBc_P-A of FT:mat_peptide AB014370_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11D11HCC). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB064314_HBc_P-A Product feature CHAIN AB064314_HBc_P-A of FT:mat_peptide AB064314_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRFPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB076678_HBc_P-A Product feature CHAIN AB076678_HBc_P-A of FT:mat_peptide AB076678_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala14). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB076679_HBc_P-A Product feature CHAIN AB076679_HBc_P-A of FT:mat_peptide AB076679_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala35). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELTTLATWVGNNLEDHA
SRDLVVNYVNDNMGLKLRQLLWFHISCLTFGKQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGGSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116076_HBc_P-A Product feature CHAIN AB116076_HBc_P-A of FT:mat_peptide AB116076_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA1911). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AB116077_HBc_P-A Product feature CHAIN AB116077_HBc_P-A of FT:mat_peptide AB116077_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA2126). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116078_HBc_P-A Product feature CHAIN AB116078_HBc_P-A of FT:mat_peptide AB116078_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA712). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116079_HBc_P-A Product feature CHAIN AB116079_HBc_P-A of FT:mat_peptide AB116079_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116080_HBc_P-A Product feature CHAIN AB116080_HBc_P-A of FT:mat_peptide AB116080_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116081_HBc_P-A Product feature CHAIN AB116081_HBc_P-A of FT:mat_peptide AB116081_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116082_HBc_P-A Product feature CHAIN AB116082_HBc_P-A of FT:mat_peptide AB116082_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRCRNRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116083_HBc_P-A Product feature CHAIN AB116083_HBc_P-A of FT:mat_peptide AB116083_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN36). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB116084_HBc_P-A Product feature CHAIN AB116084_HBc_P-A of FT:mat_peptide AB116084_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN81). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHTSCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB116085_HBc_P-A Product feature CHAIN AB116085_HBc_P-A of FT:mat_peptide AB116085_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN83). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116086_HBc_P-A Product feature CHAIN AB116086_HBc_P-A of FT:mat_peptide AB116086_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND18). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATADLLSFLPSDFFPSVQDLLDTASALYREALESPVHCSPHHTALRQAILCWGELRTLGTWVGNNLDDQA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116087_HBc_P-A Product feature CHAIN AB116087_HBc_P-A of FT:mat_peptide AB116087_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND8). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSRHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETAVVRRRVRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB116088_HBc_P-A Product feature CHAIN AB116088_HBc_P-A of FT:mat_peptide AB116088_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP30). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSSHHTALRQAIVCWGELMTLGTWVGNNLEDPE
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRGRGRSPRR
RTPSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|AB116089_HBc_P-A Product feature CHAIN AB116089_HBc_P-A of FT:mat_peptide AB116089_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP39). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQASLCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116090_HBc_P-A Product feature CHAIN AB116090_HBc_P-A of FT:mat_peptide AB116090_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP40). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116091_HBc_P-A Product feature CHAIN AB116091_HBc_P-A of FT:mat_peptide AB116091_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB116092_HBc_P-A Product feature CHAIN AB116092_HBc_P-A of FT:mat_peptide AB116092_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH20). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVAALFRDALESPEHCSAHHTALRQVILCWGELMTLATWVGTNLQDPA
SRDLVVSYVNDNMGLKIRQLLWFHTSCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB116093_HBc_P-A Product feature CHAIN AB116093_HBc_P-A of FT:mat_peptide AB116093_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH25). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB116094_HBc_P-A Product feature CHAIN AB116094_HBc_P-A of FT:mat_peptide AB116094_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH4). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB126580_HBc_P-A Product feature CHAIN AB126580_HBc_P-A of FT:mat_peptide AB126580_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-RU204). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPHKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB194950_HBc_P-A Product feature CHAIN AB194950_HBc_P-A of FT:mat_peptide AB194950_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR983). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTNLATWVGTNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB194951_HBc_P-A Product feature CHAIN AB194951_HBc_P-A of FT:mat_peptide AB194951_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR82). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTNLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB194952_HBc_P-A Product feature CHAIN AB194952_HBc_P-A of FT:mat_peptide AB194952_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR711). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTSAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB205118_HBc_P-A Product feature CHAIN AB205118_HBc_P-A of FT:mat_peptide AB205118_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TJ1-1-2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB222707_HBc_P-A Product feature CHAIN AB222707_HBc_P-A of FT:mat_peptide AB222707_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate UZTBV102). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB241114_HBc_P-A Product feature CHAIN AB241114_HBc_P-A of FT:mat_peptide AB241114_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhHCC01). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB241115_HBc_P-A Product feature CHAIN AB241115_HBc_P-A of FT:mat_peptide AB241115_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhCH09). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246317_HBc_P-A Product feature CHAIN AB246317_HBc_P-A of FT:mat_peptide AB246317_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TA112). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKVRQLLWFHISCITFGRQTVGEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246335_HBc_P-A Product feature CHAIN AB246335_HBc_P-A of FT:mat_peptide AB246335_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246336_HBc_P-A Product feature CHAIN AB246336_HBc_P-A of FT:mat_peptide AB246336_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246337_HBc_P-A Product feature CHAIN AB246337_HBc_P-A of FT:mat_peptide AB246337_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB246338_HBc_P-A Product feature CHAIN AB246338_HBc_P-A of FT:mat_peptide AB246338_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300366_HBc_P-A Product feature CHAIN AB300366_HBc_P-A of FT:mat_peptide AB300366_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient8). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB300367_HBc_P-A Product feature CHAIN AB300367_HBc_P-A of FT:mat_peptide AB300367_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient9). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB362931_HBc_P-A Product feature CHAIN AB362931_HBc_P-A of FT:mat_peptide AB362931_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWVELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB453979_HBc_P-A Product feature CHAIN AB453979_HBc_P-A of FT:mat_peptide AB453979_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB453980_HBc_P-A Product feature CHAIN AB453980_HBc_P-A of FT:mat_peptide AB453980_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB453981_HBc_P-A Product feature CHAIN AB453981_HBc_P-A of FT:mat_peptide AB453981_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB453982_HBc_P-A Product feature CHAIN AB453982_HBc_P-A of FT:mat_peptide AB453982_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH4). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELTTLGTWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AB453983_HBc_P-A Product feature CHAIN AB453983_HBc_P-A of FT:mat_peptide AB453983_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH5). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB453984_HBc_P-A Product feature CHAIN AB453984_HBc_P-A of FT:mat_peptide AB453984_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH6). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB453986_HBc_P-A Product feature CHAIN AB453986_HBc_P-A of FT:mat_peptide AB453986_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH8). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGTWVGNNLQDQT
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB453987_HBc_P-A Product feature CHAIN AB453987_HBc_P-A of FT:mat_peptide AB453987_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH9). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB453988_HBc_P-A Product feature CHAIN AB453988_HBc_P-A of FT:mat_peptide AB453988_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH10). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB453989_HBc_P-A Product feature CHAIN AB453989_HBc_P-A of FT:mat_peptide AB453989_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH11). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHTSCITFGREIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRYRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AB480036_HBc_P-A Product feature CHAIN AB480036_HBc_P-A of FT:mat_peptide AB480036_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB480038_HBc_P-A Product feature CHAIN AB480038_HBc_P-A of FT:mat_peptide AB480038_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB480039_HBc_P-A Product feature CHAIN AB480039_HBc_P-A of FT:mat_peptide AB480039_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB480040_HBc_P-A Product feature CHAIN AB480040_HBc_P-A of FT:mat_peptide AB480040_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB480041_HBc_P-A Product feature CHAIN AB480041_HBc_P-A of FT:mat_peptide AB480041_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB549213_HBc_P-A Product feature CHAIN AB549213_HBc_P-A of FT:mat_peptide AB549213_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697487_HBc_P-A Product feature CHAIN AB697487_HBc_P-A of FT:mat_peptide AB697487_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGAXVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMXLATWVGXNLEDPA
SRXLVVXYVNXNMGLKIRQLLWFHXSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697488_HBc_P-A Product feature CHAIN AB697488_HBc_P-A of FT:mat_peptide AB697488_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697489_HBc_P-A Product feature CHAIN AB697489_HBc_P-A of FT:mat_peptide AB697489_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697491_HBc_P-A Product feature CHAIN AB697491_HBc_P-A of FT:mat_peptide AB697491_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No6). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
XTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697492_HBc_P-A Product feature CHAIN AB697492_HBc_P-A of FT:mat_peptide AB697492_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No7). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697493_HBc_P-A Product feature CHAIN AB697493_HBc_P-A of FT:mat_peptide AB697493_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No8). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697495_HBc_P-A Product feature CHAIN AB697495_HBc_P-A of FT:mat_peptide AB697495_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No10). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697496_HBc_P-A Product feature CHAIN AB697496_HBc_P-A of FT:mat_peptide AB697496_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No11). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697497_HBc_P-A Product feature CHAIN AB697497_HBc_P-A of FT:mat_peptide AB697497_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No14). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697498_HBc_P-A Product feature CHAIN AB697498_HBc_P-A of FT:mat_peptide AB697498_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No15). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGAXVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMXLATWVGXNLEDXA
SRDLVVXYVNXNMGXKIRQLLWFHXSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697499_HBc_P-A Product feature CHAIN AB697499_HBc_P-A of FT:mat_peptide AB697499_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No16). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697501_HBc_P-A Product feature CHAIN AB697501_HBc_P-A of FT:mat_peptide AB697501_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No19). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697503_HBc_P-A Product feature CHAIN AB697503_HBc_P-A of FT:mat_peptide AB697503_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No22). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697504_HBc_P-A Product feature CHAIN AB697504_HBc_P-A of FT:mat_peptide AB697504_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No23). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697505_HBc_P-A Product feature CHAIN AB697505_HBc_P-A of FT:mat_peptide AB697505_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No25). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697506_HBc_P-A Product feature CHAIN AB697506_HBc_P-A of FT:mat_peptide AB697506_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No28). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697507_HBc_P-A Product feature CHAIN AB697507_HBc_P-A of FT:mat_peptide AB697507_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No29). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697508_HBc_P-A Product feature CHAIN AB697508_HBc_P-A of FT:mat_peptide AB697508_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No31). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697509_HBc_P-A Product feature CHAIN AB697509_HBc_P-A of FT:mat_peptide AB697509_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No32). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697511_HBc_P-A Product feature CHAIN AB697511_HBc_P-A of FT:mat_peptide AB697511_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No36). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB697512_HBc_P-A Product feature CHAIN AB697512_HBc_P-A of FT:mat_peptide AB697512_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No37). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB775198_HBc_P-A Product feature CHAIN AB775198_HBc_P-A of FT:mat_peptide AB775198_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0707). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB775199_HBc_P-A Product feature CHAIN AB775199_HBc_P-A of FT:mat_peptide AB775199_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0708). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB775200_HBc_P-A Product feature CHAIN AB775200_HBc_P-A of FT:mat_peptide AB775200_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0925). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB775201_HBc_P-A Product feature CHAIN AB775201_HBc_P-A of FT:mat_peptide AB775201_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0929). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB937791_HBc_P-A Product feature CHAIN AB937791_HBc_P-A of FT:mat_peptide AB937791_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB05-0890). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB937792_HBc_P-A Product feature CHAIN AB937792_HBc_P-A of FT:mat_peptide AB937792_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1205). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB937793_HBc_P-A Product feature CHAIN AB937793_HBc_P-A of FT:mat_peptide AB937793_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0302). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB937794_HBc_P-A Product feature CHAIN AB937794_HBc_P-A of FT:mat_peptide AB937794_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0666). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB937795_HBc_P-A Product feature CHAIN AB937795_HBc_P-A of FT:mat_peptide AB937795_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1191). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|AB937796_HBc_P-A Product feature CHAIN AB937796_HBc_P-A of FT:mat_peptide AB937796_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1196). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AB937797_HBc_P-A Product feature CHAIN AB937797_HBc_P-A of FT:mat_peptide AB937797_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1204). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVKDLLDTASALYRDALESPEHCSAHHTALRQVSLCWVELMTLATWVGNNLQDPA
SRDQVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVXRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|AB937798_HBc_P-A Product feature CHAIN AB937798_HBc_P-A of FT:mat_peptide AB937798_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0383). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF043560_HBc_P-A Product feature CHAIN AF043560_HBc_P-A of FT:mat_peptide AF043560_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF043580_HBc_P-A Product feature CHAIN AF043580_HBc_P-A of FT:mat_peptide AF043580_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF090838_HBc_P-A Product feature CHAIN AF090838_HBc_P-A of FT:mat_peptide AF090838_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPNVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVMNLATWVGANLEDQA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF090839_HBc_P-A Product feature CHAIN AF090839_HBc_P-A of FT:mat_peptide AF090839_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF090840_HBc_P-A Product feature CHAIN AF090840_HBc_P-A of FT:mat_peptide AF090840_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF090841_HBc_P-A Product feature CHAIN AF090841_HBc_P-A of FT:mat_peptide AF090841_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF090842_HBc_P-A Product feature CHAIN AF090842_HBc_P-A of FT:mat_peptide AF090842_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF297621_HBc_P-A Product feature CHAIN AF297621_HBc_P-A of FT:mat_peptide AF297621_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 78). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGSTVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF297622_HBc_P-A Product feature CHAIN AF297622_HBc_P-A of FT:mat_peptide AF297622_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 79). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF297623_HBc_P-A Product feature CHAIN AF297623_HBc_P-A of FT:mat_peptide AF297623_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 83). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF297624_HBc_P-A Product feature CHAIN AF297624_HBc_P-A of FT:mat_peptide AF297624_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 80). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF297625_HBc_P-A Product feature CHAIN AF297625_HBc_P-A of FT:mat_peptide AF297625_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 84). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRETILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324071_HBc_P-A Product feature CHAIN AF324071_HBc_P-A of FT:mat_peptide AF324071_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A16). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTGVRRRDRGRSPRR
RTPSLRRRRSQSPRTRRSQSRESQC
>gnl|hbvpro|AF324072_HBc_P-A Product feature CHAIN AF324072_HBc_P-A of FT:mat_peptide AF324072_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A19). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLWFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQCREHQC
>gnl|hbvpro|AF324107_HBc_P-A Product feature CHAIN AF324107_HBc_P-A of FT:mat_peptide AF324107_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 0012). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLISFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AF324118_HBc_P-A Product feature CHAIN AF324118_HBc_P-A of FT:mat_peptide AF324118_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate U2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQEILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324120_HBc_P-A Product feature CHAIN AF324120_HBc_P-A of FT:mat_peptide AF324120_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate U4). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324121_HBc_P-A Product feature CHAIN AF324121_HBc_P-A of FT:mat_peptide AF324121_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate U5). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324122_HBc_P-A Product feature CHAIN AF324122_HBc_P-A of FT:mat_peptide AF324122_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate U6). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|AF324123_HBc_P-A Product feature CHAIN AF324123_HBc_P-A of FT:mat_peptide AF324123_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate U7). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRPRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324125_HBc_P-A Product feature CHAIN AF324125_HBc_P-A of FT:mat_peptide AF324125_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate U9). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324126_HBc_P-A Product feature CHAIN AF324126_HBc_P-A of FT:mat_peptide AF324126_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate U10). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLATWVGANLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324127_HBc_P-A Product feature CHAIN AF324127_HBc_P-A of FT:mat_peptide AF324127_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8.19). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGGWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324128_HBc_P-A Product feature CHAIN AF324128_HBc_P-A of FT:mat_peptide AF324128_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8.21). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324133_HBc_P-A Product feature CHAIN AF324133_HBc_P-A of FT:mat_peptide AF324133_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8.31). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQCRESQC
>gnl|hbvpro|AF324135_HBc_P-A Product feature CHAIN AF324135_HBc_P-A of FT:mat_peptide AF324135_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9.5). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324136_HBc_P-A Product feature CHAIN AF324136_HBc_P-A of FT:mat_peptide AF324136_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 7.32). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324147_HBc_P-A Product feature CHAIN AF324147_HBc_P-A of FT:mat_peptide AF324147_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I60). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF324148_HBc_P-A Product feature CHAIN AF324148_HBc_P-A of FT:mat_peptide AF324148_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I68). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350080_HBc_P-A Product feature CHAIN AF350080_HBc_P-A of FT:mat_peptide AF350080_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1196). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350081_HBc_P-A Product feature CHAIN AF350081_HBc_P-A of FT:mat_peptide AF350081_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1199). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVPDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTLPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350082_HBc_P-A Product feature CHAIN AF350082_HBc_P-A of FT:mat_peptide AF350082_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1213). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350083_HBc_P-A Product feature CHAIN AF350083_HBc_P-A of FT:mat_peptide AF350083_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1314F79). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIICWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350084_HBc_P-A Product feature CHAIN AF350084_HBc_P-A of FT:mat_peptide AF350084_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1315F80). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350085_HBc_P-A Product feature CHAIN AF350085_HBc_P-A of FT:mat_peptide AF350085_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1316F79). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350086_HBc_P-A Product feature CHAIN AF350086_HBc_P-A of FT:mat_peptide AF350086_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1330F80). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350087_HBc_P-A Product feature CHAIN AF350087_HBc_P-A of FT:mat_peptide AF350087_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1486F125). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALNREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350088_HBc_P-A Product feature CHAIN AF350088_HBc_P-A of FT:mat_peptide AF350088_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1487F125). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350089_HBc_P-A Product feature CHAIN AF350089_HBc_P-A of FT:mat_peptide AF350089_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1606). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350090_HBc_P-A Product feature CHAIN AF350090_HBc_P-A of FT:mat_peptide AF350090_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1687). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350091_HBc_P-A Product feature CHAIN AF350091_HBc_P-A of FT:mat_peptide AF350091_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1730F202). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350092_HBc_P-A Product feature CHAIN AF350092_HBc_P-A of FT:mat_peptide AF350092_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1746). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350093_HBc_P-A Product feature CHAIN AF350093_HBc_P-A of FT:mat_peptide AF350093_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1747). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350094_HBc_P-A Product feature CHAIN AF350094_HBc_P-A of FT:mat_peptide AF350094_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1800). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350095_HBc_P-A Product feature CHAIN AF350095_HBc_P-A of FT:mat_peptide AF350095_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1815F214). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350096_HBc_P-A Product feature CHAIN AF350096_HBc_P-A of FT:mat_peptide AF350096_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1817F214). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350097_HBc_P-A Product feature CHAIN AF350097_HBc_P-A of FT:mat_peptide AF350097_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1835F222). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF350098_HBc_P-A Product feature CHAIN AF350098_HBc_P-A of FT:mat_peptide AF350098_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1841F222). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419534_HBc_P-A Product feature CHAIN AF419534_HBc_P-A of FT:mat_peptide AF419534_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I5-Fam B). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVSALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHSSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419535_HBc_P-A Product feature CHAIN AF419535_HBc_P-A of FT:mat_peptide AF419535_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I6-Fam B). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVSALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHTXCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF419536_HBc_P-A Product feature CHAIN AF419536_HBc_P-A of FT:mat_peptide AF419536_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I7-Fam B). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTVSALYREALESPEHCSPHHTAIRQAILCWGQLMTLATWVGNNLQDPA
SRDLVVNYVNDNMGLMIRQLLWFHSSCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRHRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF536524_HBc_P-A Product feature CHAIN AF536524_HBc_P-A of FT:mat_peptide AF536524_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASTLYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AF537371_HBc_P-A Product feature CHAIN AF537371_HBc_P-A of FT:mat_peptide AF537371_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|AF537372_HBc_P-A Product feature CHAIN AF537372_HBc_P-A of FT:mat_peptide AF537372_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRCRGRGRSPRR
RTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AJ012207_HBc_P-A Product feature CHAIN AJ012207_HBc_P-A of FT:mat_peptide AJ012207_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ309369_HBc_P-A Product feature CHAIN AJ309369_HBc_P-A of FT:mat_peptide AJ309369_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ309370_HBc_P-A Product feature CHAIN AJ309370_HBc_P-A of FT:mat_peptide AJ309370_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ309371_HBc_P-A Product feature CHAIN AJ309371_HBc_P-A of FT:mat_peptide AJ309371_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRIPPPYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ344115_HBc_P-A Product feature CHAIN AJ344115_HBc_P-A of FT:mat_peptide AJ344115_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBsAg negative patient X27). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKDTVLEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AJ627226_HBc_P-A Product feature CHAIN AJ627226_HBc_P-A of FT:mat_peptide AJ627226_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 20952). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPPDFFPSARDLLDTASALFRDALESPEHCSAHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQILWFHLSCIMFGRDIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ627227_HBc_P-A Product feature CHAIN AJ627227_HBc_P-A of FT:mat_peptide AJ627227_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 21077). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDLYKEFGASVELLSFLPXDFYPSVRDLLDTAXALYREALESPEHCSPHHTAIRQAIVCWGELTNLGTWVGNNLQDPA
SRDLVVNHVNTNMGLKIRQLLWFHISCLTFGRNTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVXRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AJ627228_HBc_P-A Product feature CHAIN AJ627228_HBc_P-A of FT:mat_peptide AJ627228_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 34408). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQCVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLDYLVSFGVWIRTPPAYRPPNAPILSILPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AM180624_HBc_P-A Product feature CHAIN AM180624_HBc_P-A of FT:mat_peptide AM180624_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE168). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHGSXHHTAXRQAILCWGXVMTLATWVGXNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRXSQC
>gnl|hbvpro|AM184125_HBc_P-A Product feature CHAIN AM184125_HBc_P-A of FT:mat_peptide AM184125_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate O64). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM184126_HBc_P-A Product feature CHAIN AM184126_HBc_P-A of FT:mat_peptide AM184126_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N35). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM282986_HBc_P-A Product feature CHAIN AM282986_HBc_P-A of FT:mat_peptide AM282986_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM295795_HBc_P-A Product feature CHAIN AM295795_HBc_P-A of FT:mat_peptide AM295795_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM295796_HBc_P-A Product feature CHAIN AM295796_HBc_P-A of FT:mat_peptide AM295796_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM295797_HBc_P-A Product feature CHAIN AM295797_HBc_P-A of FT:mat_peptide AM295797_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM410963_HBc_P-A Product feature CHAIN AM410963_HBc_P-A of FT:mat_peptide AM410963_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AM494718_HBc_P-A Product feature CHAIN AM494718_HBc_P-A of FT:mat_peptide AM494718_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAR204). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY034878_HBc_P-A Product feature CHAIN AY034878_HBc_P-A of FT:mat_peptide AY034878_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVKL). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLDDPA
SKDLVVNYVNTKHGLKIRQLLWVHTSCLTFGRETVLEYLVSFGVWIRTPPAYRTTNAPILSTLPEATVVRQRDRRRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY128092_HBc_P-A Product feature CHAIN AY128092_HBc_P-A of FT:mat_peptide AY128092_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY152726_HBc_P-A Product feature CHAIN AY152726_HBc_P-A of FT:mat_peptide AY152726_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8.22). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY161138_HBc_P-A Product feature CHAIN AY161138_HBc_P-A of FT:mat_peptide AY161138_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY161139_HBc_P-A Product feature CHAIN AY161139_HBc_P-A of FT:mat_peptide AY161139_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY161142_HBc_P-A Product feature CHAIN AY161142_HBc_P-A of FT:mat_peptide AY161142_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCCGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYVVSFGVWIRTPPAYRPPNAPILSALPETTVVRRRDRGRSPRR
RLPSPCRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY161143_HBc_P-A Product feature CHAIN AY161143_HBc_P-A of FT:mat_peptide AY161143_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCCGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYVVSFGVWIRTPPAYRPPNAPILSALPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY161144_HBc_P-A Product feature CHAIN AY161144_HBc_P-A of FT:mat_peptide AY161144_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCCGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYVVSFGVWIRTPPAYRPPNAPILSALPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY230111_HBc_P-A Product feature CHAIN AY230111_HBc_P-A of FT:mat_peptide AY230111_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDTYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAIVCWGELMNLATWVGNNLQDPA
SRDLVVNYVNTNMGIKIRQLLWFHISCITFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY233274_HBc_P-A Product feature CHAIN AY233274_HBc_P-A of FT:mat_peptide AY233274_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 0962). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233275_HBc_P-A Product feature CHAIN AY233275_HBc_P-A of FT:mat_peptide AY233275_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 163). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233276_HBc_P-A Product feature CHAIN AY233276_HBc_P-A of FT:mat_peptide AY233276_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1839). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233278_HBc_P-A Product feature CHAIN AY233278_HBc_P-A of FT:mat_peptide AY233278_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233279_HBc_P-A Product feature CHAIN AY233279_HBc_P-A of FT:mat_peptide AY233279_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 28). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAHRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233280_HBc_P-A Product feature CHAIN AY233280_HBc_P-A of FT:mat_peptide AY233280_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233281_HBc_P-A Product feature CHAIN AY233281_HBc_P-A of FT:mat_peptide AY233281_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 303). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|AY233282_HBc_P-A Product feature CHAIN AY233282_HBc_P-A of FT:mat_peptide AY233282_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 306). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233283_HBc_P-A Product feature CHAIN AY233283_HBc_P-A of FT:mat_peptide AY233283_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4038). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRPPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233284_HBc_P-A Product feature CHAIN AY233284_HBc_P-A of FT:mat_peptide AY233284_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5283). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233285_HBc_P-A Product feature CHAIN AY233285_HBc_P-A of FT:mat_peptide AY233285_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 795). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASAQYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRTPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233286_HBc_P-A Product feature CHAIN AY233286_HBc_P-A of FT:mat_peptide AY233286_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 818). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233287_HBc_P-A Product feature CHAIN AY233287_HBc_P-A of FT:mat_peptide AY233287_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8225). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMALATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233288_HBc_P-A Product feature CHAIN AY233288_HBc_P-A of FT:mat_peptide AY233288_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 823). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233289_HBc_P-A Product feature CHAIN AY233289_HBc_P-A of FT:mat_peptide AY233289_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 833). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY233290_HBc_P-A Product feature CHAIN AY233290_HBc_P-A of FT:mat_peptide AY233290_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 85). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLASWVGNNLDDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY236165_HBc_P-A Product feature CHAIN AY236165_HBc_P-A of FT:mat_peptide AY236165_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDTYKEFGATVELLSFLPPDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAIVCWGELMNLATWVGNNLQDPA
SRDLVVNYVNTNMGIKIRQLLWFHISCITFGREIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY236166_HBc_P-A Product feature CHAIN AY236166_HBc_P-A of FT:mat_peptide AY236166_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDVDTYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAIVCWGELMNLATWVGNNLQDPA
SRDLVVNYVNTNMGIKIRQLLWFHISCITFGREVVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY236167_HBc_P-A Product feature CHAIN AY236167_HBc_P-A of FT:mat_peptide AY236167_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDTYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAIVCWGELMNLATWVGNNLQDPA
SRDLVVNYVNTNMGIKIRQLLRFHISCITFGREVVLEYLVSFGVWIRTPPAYRPPXAPILSTLPETTVIRRRDRGWSHRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY236168_HBc_P-A Product feature CHAIN AY236168_HBc_P-A of FT:mat_peptide AY236168_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDTYKEFGATVELLSFLPPDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAIVCWGELMNLATWVGNNLQDPA
SRDLVVNYVNTNMGIKIRQLLWFHISCITFGREIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY236169_HBc_P-A Product feature CHAIN AY236169_HBc_P-A of FT:mat_peptide AY236169_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDTYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAIACWGELMNLATWVGNNLQDPA
SRDLVVNYVNTNMGIKIRQLLWFHISCITFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|AY373428_HBc_P-A Product feature CHAIN AY373428_HBc_P-A of FT:mat_peptide AY373428_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY373429_HBc_P-A Product feature CHAIN AY373429_HBc_P-A of FT:mat_peptide AY373429_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWSHISCLTFGRETALEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPSR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY373432_HBc_P-A Product feature CHAIN AY373432_HBc_P-A of FT:mat_peptide AY373432_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603429_HBc_P-A Product feature CHAIN AY603429_HBc_P-A of FT:mat_peptide AY603429_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 15T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVDYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603430_HBc_P-A Product feature CHAIN AY603430_HBc_P-A of FT:mat_peptide AY603430_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 19T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603431_HBc_P-A Product feature CHAIN AY603431_HBc_P-A of FT:mat_peptide AY603431_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 23T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSNRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603432_HBc_P-A Product feature CHAIN AY603432_HBc_P-A of FT:mat_peptide AY603432_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVLDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603435_HBc_P-A Product feature CHAIN AY603435_HBc_P-A of FT:mat_peptide AY603435_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 31T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603436_HBc_P-A Product feature CHAIN AY603436_HBc_P-A of FT:mat_peptide AY603436_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 32T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603438_HBc_P-A Product feature CHAIN AY603438_HBc_P-A of FT:mat_peptide AY603438_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 36T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSNRRRRAQSPRRRRSQSRESQC
>gnl|hbvpro|AY603441_HBc_P-A Product feature CHAIN AY603441_HBc_P-A of FT:mat_peptide AY603441_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 59T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY603446_HBc_P-A Product feature CHAIN AY603446_HBc_P-A of FT:mat_peptide AY603446_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSSGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY707087_HBc_P-A Product feature CHAIN AY707087_HBc_P-A of FT:mat_peptide AY707087_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-N10). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY738139_HBc_P-A Product feature CHAIN AY738139_HBc_P-A of FT:mat_peptide AY738139_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY738140_HBc_P-A Product feature CHAIN AY738140_HBc_P-A of FT:mat_peptide AY738140_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY738141_HBc_P-A Product feature CHAIN AY738141_HBc_P-A of FT:mat_peptide AY738141_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY738142_HBc_P-A Product feature CHAIN AY738142_HBc_P-A of FT:mat_peptide AY738142_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY738143_HBc_P-A Product feature CHAIN AY738143_HBc_P-A of FT:mat_peptide AY738143_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY862867_HBc_P-A Product feature CHAIN AY862867_HBc_P-A of FT:mat_peptide AY862867_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY862868_HBc_P-A Product feature CHAIN AY862868_HBc_P-A of FT:mat_peptide AY862868_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY902775_HBc_P-A Product feature CHAIN AY902775_HBc_P-A of FT:mat_peptide AY902775_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MTB162). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY903452_HBc_P-A Product feature CHAIN AY903452_HBc_P-A of FT:mat_peptide AY903452_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRGRSPRRRT
PSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|AY934763_HBc_P-A Product feature CHAIN AY934763_HBc_P-A of FT:mat_peptide AY934763_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ik3346). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934764_HBc_P-A Product feature CHAIN AY934764_HBc_P-A of FT:mat_peptide AY934764_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9210699). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934765_HBc_P-A Product feature CHAIN AY934765_HBc_P-A of FT:mat_peptide AY934765_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24306). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934766_HBc_P-A Product feature CHAIN AY934766_HBc_P-A of FT:mat_peptide AY934766_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24233). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934767_HBc_P-A Product feature CHAIN AY934767_HBc_P-A of FT:mat_peptide AY934767_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27178). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934768_HBc_P-A Product feature CHAIN AY934768_HBc_P-A of FT:mat_peptide AY934768_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 25830). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934769_HBc_P-A Product feature CHAIN AY934769_HBc_P-A of FT:mat_peptide AY934769_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 23719). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934770_HBc_P-A Product feature CHAIN AY934770_HBc_P-A of FT:mat_peptide AY934770_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 953642). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934771_HBc_P-A Product feature CHAIN AY934771_HBc_P-A of FT:mat_peptide AY934771_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27439). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934772_HBc_P-A Product feature CHAIN AY934772_HBc_P-A of FT:mat_peptide AY934772_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1908). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934773_HBc_P-A Product feature CHAIN AY934773_HBc_P-A of FT:mat_peptide AY934773_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9414346). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|AY934774_HBc_P-A Product feature CHAIN AY934774_HBc_P-A of FT:mat_peptide AY934774_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9615549). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ020002_HBc_P-A Product feature CHAIN DQ020002_HBc_P-A of FT:mat_peptide DQ020002_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 380). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ020003_HBc_P-A Product feature CHAIN DQ020003_HBc_P-A of FT:mat_peptide DQ020003_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5780). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ298161_HBc_P-A Product feature CHAIN DQ298161_HBc_P-A of FT:mat_peptide DQ298161_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDTYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAIVCWGELMNLATWVGNNLQDPA
SRDLVVNYVNTNMGIKIRQLLWFHISCITFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ298162_HBc_P-A Product feature CHAIN DQ298162_HBc_P-A of FT:mat_peptide DQ298162_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDTYKEFGATVELLSFLPPDFFPSVRDLLDTASALFREALESPEHCSPHHTALRLAIVCWGELMNLATWVGNNWQDPA
SRDVVVNYVNTNMGIKIRQLLWFHISCITFGREIVLEYLVSFGVWIRSPPAYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRFQSPRHRRSRSRGSQC
>gnl|hbvpro|DQ298163_HBc_P-A Product feature CHAIN DQ298163_HBc_P-A of FT:mat_peptide DQ298163_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDTYKEFGATVELLSFLPPDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAIVCWGELMNLATWVGNNLQDPA
SRDLVVNYVNTNMGIKIRQLLWFHISCITFGREIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ298164_HBc_P-A Product feature CHAIN DQ298164_HBc_P-A of FT:mat_peptide DQ298164_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=185 residues).
MDVDTYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAIVCWGELMNLATWVGNNLQDPA
SRDLVVNYVNTNMGIKIRQLLWFHISCITFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ298165_HBc_P-A Product feature CHAIN DQ298165_HBc_P-A of FT:mat_peptide DQ298165_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LT3.12AM). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDTYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAIVCWGELMNLATWVGNNLQDPA
SRDLVVNYVNTNMGIKIRQLLRFHISCITFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRDRGWSHRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|DQ315784_HBc_P-A Product feature CHAIN DQ315784_HBc_P-A of FT:mat_peptide DQ315784_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI03101). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ315786_HBc_P-A Product feature CHAIN DQ315786_HBc_P-A of FT:mat_peptide DQ315786_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI057). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|DQ788725_HBc_P-A Product feature CHAIN DQ788725_HBc_P-A of FT:mat_peptide DQ788725_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate serum 07/92). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|EF103278_HBc_P-A Product feature CHAIN EF103278_HBc_P-A of FT:mat_peptide EF103278_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ran60). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EF208113_HBc_P-A Product feature CHAIN EF208113_HBc_P-A of FT:mat_peptide EF208113_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient B, serum 05/93). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU054331_HBc_C-A Product feature CHAIN EU054331_HBc_C-A of FT:mat_peptide EU054331_HBc_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU086721_HBc_P-A Product feature CHAIN EU086721_HBc_P-A of FT:mat_peptide EU086721_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HRO/w4601-2002). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU185746_HBc_P-A Product feature CHAIN EU185746_HBc_P-A of FT:mat_peptide EU185746_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM9). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYXPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU185750_HBc_P-A Product feature CHAIN EU185750_HBc_P-A of FT:mat_peptide EU185750_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQ
>gnl|hbvpro|EU185765_HBc_P-A Product feature CHAIN EU185765_HBc_P-A of FT:mat_peptide EU185765_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSMLPETAVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|EU185774_HBc_P-A Product feature CHAIN EU185774_HBc_P-A of FT:mat_peptide EU185774_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H-IDU1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLBTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLXWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU185775_HBc_P-A Product feature CHAIN EU185775_HBc_P-A of FT:mat_peptide EU185775_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H-IDU2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|EU185776_HBc_P-A Product feature CHAIN EU185776_HBc_P-A of FT:mat_peptide EU185776_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H-IDU3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLXTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPP
SRDLVVNYVNTNMGLKIRQLXWFHISCLTFGRETVLEYLVSFGVWIRTPPAYKPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU185777_HBc_P-A Product feature CHAIN EU185777_HBc_P-A of FT:mat_peptide EU185777_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H-IDU4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSXRDLLXTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPP
SRDLVVNYVNTNMGLKIRQLXWFHISCLTFGRETVLEYLVSFGVWIRTPPAYKPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSHSPRRRRSQSRESQC
>gnl|hbvpro|EU185786_HBc_P-A Product feature CHAIN EU185786_HBc_P-A of FT:mat_peptide EU185786_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU11). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGTWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU185787_HBc_P-A Product feature CHAIN EU185787_HBc_P-A of FT:mat_peptide EU185787_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU4). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU185789_HBc_P-A Product feature CHAIN EU185789_HBc_P-A of FT:mat_peptide EU185789_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU8). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU304331_HBc_P-A Product feature CHAIN EU304331_HBc_P-A of FT:mat_peptide EU304331_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA84). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRDXVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRQRHRGRSPRG
RTPSPRRXRSKSPRRRRSQSRESQC
>gnl|hbvpro|EU366129_HBc_P-A Product feature CHAIN EU366129_HBc_P-A of FT:mat_peptide EU366129_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA92). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALFREALESPEHCSPHHTAIRQAILCWGELMTLATWVGNNLXDPA
SRDLVVNYVNTHMGLKIRQLLWFHXSCICFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRCRVRGRSPRR
RTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|EU410082_HBc_P-A Product feature CHAIN EU410082_HBc_P-A of FT:mat_peptide EU410082_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ph81). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414048_HBc_P-A Product feature CHAIN EU414048_HBc_P-A of FT:mat_peptide EU414048_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414049_HBc_P-A Product feature CHAIN EU414049_HBc_P-A of FT:mat_peptide EU414049_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWXXXXTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVXRRRDRGRSPRR
RTPSPRRRRSQSPRRRRXQSRESQC
>gnl|hbvpro|EU414050_HBc_P-A Product feature CHAIN EU414050_HBc_P-A of FT:mat_peptide EU414050_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVTNLATWVGTNLNDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414052_HBc_P-A Product feature CHAIN EU414052_HBc_P-A of FT:mat_peptide EU414052_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWADVTNLATWVGNNLEDQA
SRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRNRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU414133_HBc_P-A Product feature CHAIN EU414133_HBc_P-A of FT:mat_peptide EU414133_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWADVTNLATWVGNNLEDQA
SRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRNRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594383_HBc_P-A Product feature CHAIN EU594383_HBc_P-A of FT:mat_peptide EU594383_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594384_HBc_P-A Product feature CHAIN EU594384_HBc_P-A of FT:mat_peptide EU594384_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594385_HBc_P-A Product feature CHAIN EU594385_HBc_P-A of FT:mat_peptide EU594385_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594386_HBc_P-A Product feature CHAIN EU594386_HBc_P-A of FT:mat_peptide EU594386_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594387_HBc_P-A Product feature CHAIN EU594387_HBc_P-A of FT:mat_peptide EU594387_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594388_HBc_P-A Product feature CHAIN EU594388_HBc_P-A of FT:mat_peptide EU594388_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594389_HBc_P-A Product feature CHAIN EU594389_HBc_P-A of FT:mat_peptide EU594389_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594390_HBc_P-A Product feature CHAIN EU594390_HBc_P-A of FT:mat_peptide EU594390_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594391_HBc_P-A Product feature CHAIN EU594391_HBc_P-A of FT:mat_peptide EU594391_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594392_HBc_P-A Product feature CHAIN EU594392_HBc_P-A of FT:mat_peptide EU594392_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594393_HBc_P-A Product feature CHAIN EU594393_HBc_P-A of FT:mat_peptide EU594393_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594394_HBc_P-A Product feature CHAIN EU594394_HBc_P-A of FT:mat_peptide EU594394_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU594395_HBc_P-A Product feature CHAIN EU594395_HBc_P-A of FT:mat_peptide EU594395_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859898_HBc_P-A Product feature CHAIN EU859898_HBc_P-A of FT:mat_peptide EU859898_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P45). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRKRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859899_HBc_P-A Product feature CHAIN EU859899_HBc_P-A of FT:mat_peptide EU859899_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P44). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859900_HBc_P-A Product feature CHAIN EU859900_HBc_P-A of FT:mat_peptide EU859900_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P42). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859901_HBc_P-A Product feature CHAIN EU859901_HBc_P-A of FT:mat_peptide EU859901_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P37). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859902_HBc_P-A Product feature CHAIN EU859902_HBc_P-A of FT:mat_peptide EU859902_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P32). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859903_HBc_P-A Product feature CHAIN EU859903_HBc_P-A of FT:mat_peptide EU859903_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859904_HBc_P-A Product feature CHAIN EU859904_HBc_P-A of FT:mat_peptide EU859904_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P39). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859905_HBc_P-A Product feature CHAIN EU859905_HBc_P-A of FT:mat_peptide EU859905_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P38). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859906_HBc_P-A Product feature CHAIN EU859906_HBc_P-A of FT:mat_peptide EU859906_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859907_HBc_P-A Product feature CHAIN EU859907_HBc_P-A of FT:mat_peptide EU859907_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859908_HBc_P-A Product feature CHAIN EU859908_HBc_P-A of FT:mat_peptide EU859908_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859909_HBc_P-A Product feature CHAIN EU859909_HBc_P-A of FT:mat_peptide EU859909_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859910_HBc_P-A Product feature CHAIN EU859910_HBc_P-A of FT:mat_peptide EU859910_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859911_HBc_P-A Product feature CHAIN EU859911_HBc_P-A of FT:mat_peptide EU859911_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P26). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859912_HBc_P-A Product feature CHAIN EU859912_HBc_P-A of FT:mat_peptide EU859912_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P23). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVGRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859913_HBc_P-A Product feature CHAIN EU859913_HBc_P-A of FT:mat_peptide EU859913_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859914_HBc_P-A Product feature CHAIN EU859914_HBc_P-A of FT:mat_peptide EU859914_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859915_HBc_P-A Product feature CHAIN EU859915_HBc_P-A of FT:mat_peptide EU859915_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P07). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859916_HBc_P-A Product feature CHAIN EU859916_HBc_P-A of FT:mat_peptide EU859916_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P03). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859917_HBc_P-A Product feature CHAIN EU859917_HBc_P-A of FT:mat_peptide EU859917_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P13). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859918_HBc_P-A Product feature CHAIN EU859918_HBc_P-A of FT:mat_peptide EU859918_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P17). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859919_HBc_P-A Product feature CHAIN EU859919_HBc_P-A of FT:mat_peptide EU859919_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVEFLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859920_HBc_P-A Product feature CHAIN EU859920_HBc_P-A of FT:mat_peptide EU859920_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P21). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859921_HBc_P-A Product feature CHAIN EU859921_HBc_P-A of FT:mat_peptide EU859921_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P08). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859922_HBc_P-A Product feature CHAIN EU859922_HBc_P-A of FT:mat_peptide EU859922_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P09). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859923_HBc_P-A Product feature CHAIN EU859923_HBc_P-A of FT:mat_peptide EU859923_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P15). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859924_HBc_P-A Product feature CHAIN EU859924_HBc_P-A of FT:mat_peptide EU859924_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859925_HBc_P-A Product feature CHAIN EU859925_HBc_P-A of FT:mat_peptide EU859925_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P22). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859926_HBc_P-A Product feature CHAIN EU859926_HBc_P-A of FT:mat_peptide EU859926_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P06). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859927_HBc_P-A Product feature CHAIN EU859927_HBc_P-A of FT:mat_peptide EU859927_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P25). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859928_HBc_P-A Product feature CHAIN EU859928_HBc_P-A of FT:mat_peptide EU859928_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P01). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859929_HBc_P-A Product feature CHAIN EU859929_HBc_P-A of FT:mat_peptide EU859929_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P43). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859930_HBc_P-A Product feature CHAIN EU859930_HBc_P-A of FT:mat_peptide EU859930_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C126). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859931_HBc_P-A Product feature CHAIN EU859931_HBc_P-A of FT:mat_peptide EU859931_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C96). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859932_HBc_P-A Product feature CHAIN EU859932_HBc_P-A of FT:mat_peptide EU859932_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C69). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859933_HBc_P-A Product feature CHAIN EU859933_HBc_P-A of FT:mat_peptide EU859933_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C67). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859934_HBc_P-A Product feature CHAIN EU859934_HBc_P-A of FT:mat_peptide EU859934_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C60). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859935_HBc_P-A Product feature CHAIN EU859935_HBc_P-A of FT:mat_peptide EU859935_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C14). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859936_HBc_P-A Product feature CHAIN EU859936_HBc_P-A of FT:mat_peptide EU859936_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C10). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859937_HBc_P-A Product feature CHAIN EU859937_HBc_P-A of FT:mat_peptide EU859937_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C40). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859938_HBc_P-A Product feature CHAIN EU859938_HBc_P-A of FT:mat_peptide EU859938_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C133). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|EU859939_HBc_P-A Product feature CHAIN EU859939_HBc_P-A of FT:mat_peptide EU859939_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C130). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859940_HBc_P-A Product feature CHAIN EU859940_HBc_P-A of FT:mat_peptide EU859940_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C122). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859941_HBc_P-A Product feature CHAIN EU859941_HBc_P-A of FT:mat_peptide EU859941_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C153). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859942_HBc_P-A Product feature CHAIN EU859942_HBc_P-A of FT:mat_peptide EU859942_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C110). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859943_HBc_P-A Product feature CHAIN EU859943_HBc_P-A of FT:mat_peptide EU859943_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C109). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859944_HBc_P-A Product feature CHAIN EU859944_HBc_P-A of FT:mat_peptide EU859944_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C105). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859945_HBc_P-A Product feature CHAIN EU859945_HBc_P-A of FT:mat_peptide EU859945_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C102). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859946_HBc_P-A Product feature CHAIN EU859946_HBc_P-A of FT:mat_peptide EU859946_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C155). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859947_HBc_P-A Product feature CHAIN EU859947_HBc_P-A of FT:mat_peptide EU859947_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C85). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859948_HBc_P-A Product feature CHAIN EU859948_HBc_P-A of FT:mat_peptide EU859948_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C151). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859949_HBc_P-A Product feature CHAIN EU859949_HBc_P-A of FT:mat_peptide EU859949_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C152). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859950_HBc_P-A Product feature CHAIN EU859950_HBc_P-A of FT:mat_peptide EU859950_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C64). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859951_HBc_P-A Product feature CHAIN EU859951_HBc_P-A of FT:mat_peptide EU859951_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C62). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859952_HBc_P-A Product feature CHAIN EU859952_HBc_P-A of FT:mat_peptide EU859952_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C56). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|EU859953_HBc_P-A Product feature CHAIN EU859953_HBc_P-A of FT:mat_peptide EU859953_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C55). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859954_HBc_P-A Product feature CHAIN EU859954_HBc_P-A of FT:mat_peptide EU859954_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C42). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859955_HBc_P-A Product feature CHAIN EU859955_HBc_P-A of FT:mat_peptide EU859955_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C39). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|EU859956_HBc_P-A Product feature CHAIN EU859956_HBc_P-A of FT:mat_peptide EU859956_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C35). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349222_HBc_P-A Product feature CHAIN FJ349222_HBc_P-A of FT:mat_peptide FJ349222_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H20). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349224_HBc_P-A Product feature CHAIN FJ349224_HBc_P-A of FT:mat_peptide FJ349224_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H71). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ349296_HBc_P-A Product feature CHAIN FJ349296_HBc_P-A of FT:mat_peptide FJ349296_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATGELLSFLPSDFFPSVRDLLNTASALYREALKSPGHCSPHHTALRQAILCWGELMTLATWVGNNLENPA
SRDLVVNYVNTNMGLKIRQLWGFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692554_HBc_P-A Product feature CHAIN FJ692554_HBc_P-A of FT:mat_peptide FJ692554_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24063). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692555_HBc_P-A Product feature CHAIN FJ692555_HBc_P-A of FT:mat_peptide FJ692555_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24074). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTASXLYREALESPEHCSPXHTAIRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTXMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPXNAPILSTLPETXVVRCRDRGRSSRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692557_HBc_P-A Product feature CHAIN FJ692557_HBc_P-A of FT:mat_peptide FJ692557_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48004). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692558_HBc_P-A Product feature CHAIN FJ692558_HBc_P-A of FT:mat_peptide FJ692558_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48008). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPYDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDAA
SRDLVVNYVNTNMGLKIRQLLWFHISCITFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692559_HBc_P-A Product feature CHAIN FJ692559_HBc_P-A of FT:mat_peptide FJ692559_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48032). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRXSQC
>gnl|hbvpro|FJ692561_HBc_P-A Product feature CHAIN FJ692561_HBc_P-A of FT:mat_peptide FJ692561_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48040). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETAVVRCRARGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692562_HBc_P-A Product feature CHAIN FJ692562_HBc_P-A of FT:mat_peptide FJ692562_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48044). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRPTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692563_HBc_P-A Product feature CHAIN FJ692563_HBc_P-A of FT:mat_peptide FJ692563_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48049). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692564_HBc_P-A Product feature CHAIN FJ692564_HBc_P-A of FT:mat_peptide FJ692564_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48074). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCXTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692565_HBc_P-A Product feature CHAIN FJ692565_HBc_P-A of FT:mat_peptide FJ692565_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48077). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVVRRRXRGRSPRR
RTPSPRRRRSQSPRRRRSQSRZSQC
>gnl|hbvpro|FJ692566_HBc_P-A Product feature CHAIN FJ692566_HBc_P-A of FT:mat_peptide FJ692566_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48090). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRESLESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692567_HBc_P-A Product feature CHAIN FJ692567_HBc_P-A of FT:mat_peptide FJ692567_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48113). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDGLESPEHCXPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRCRNRGRSPRR
RTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|FJ692570_HBc_P-A Product feature CHAIN FJ692570_HBc_P-A of FT:mat_peptide FJ692570_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50010). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTNLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692571_HBc_P-A Product feature CHAIN FJ692571_HBc_P-A of FT:mat_peptide FJ692571_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50011). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692573_HBc_P-A Product feature CHAIN FJ692573_HBc_P-A of FT:mat_peptide FJ692573_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50014). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSSLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692574_HBc_P-A Product feature CHAIN FJ692574_HBc_P-A of FT:mat_peptide FJ692574_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50015). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692575_HBc_P-A Product feature CHAIN FJ692575_HBc_P-A of FT:mat_peptide FJ692575_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50020). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692576_HBc_P-A Product feature CHAIN FJ692576_HBc_P-A of FT:mat_peptide FJ692576_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50022). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEFLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRGRPRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692577_HBc_P-A Product feature CHAIN FJ692577_HBc_P-A of FT:mat_peptide FJ692577_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50024). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGXXTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRRRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692578_HBc_P-A Product feature CHAIN FJ692578_HBc_P-A of FT:mat_peptide FJ692578_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50083). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692579_HBc_P-A Product feature CHAIN FJ692579_HBc_P-A of FT:mat_peptide FJ692579_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50084). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692580_HBc_P-A Product feature CHAIN FJ692580_HBc_P-A of FT:mat_peptide FJ692580_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50085). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692581_HBc_P-A Product feature CHAIN FJ692581_HBc_P-A of FT:mat_peptide FJ692581_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50086). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692582_HBc_P-A Product feature CHAIN FJ692582_HBc_P-A of FT:mat_peptide FJ692582_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50088). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692583_HBc_P-A Product feature CHAIN FJ692583_HBc_P-A of FT:mat_peptide FJ692583_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50089). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692584_HBc_P-A Product feature CHAIN FJ692584_HBc_P-A of FT:mat_peptide FJ692584_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50090). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692585_HBc_P-A Product feature CHAIN FJ692585_HBc_P-A of FT:mat_peptide FJ692585_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50091). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692586_HBc_P-A Product feature CHAIN FJ692586_HBc_P-A of FT:mat_peptide FJ692586_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50099). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPADFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLTTLGSWVGNNLEDQA
SRALVVNYVDTNMGLKIRQLLWFHISCLTFGRETVLQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRNRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692587_HBc_P-A Product feature CHAIN FJ692587_HBc_P-A of FT:mat_peptide FJ692587_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50115). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGDVMTLGTWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRNRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692588_HBc_P-A Product feature CHAIN FJ692588_HBc_P-A of FT:mat_peptide FJ692588_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50119). Complete genome. [Hepadnaviridae] (length=186 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRQGRSPR
RRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692590_HBc_P-A Product feature CHAIN FJ692590_HBc_P-A of FT:mat_peptide FJ692590_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50152). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692591_HBc_P-A Product feature CHAIN FJ692591_HBc_P-A of FT:mat_peptide FJ692591_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50167). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692592_HBc_P-A Product feature CHAIN FJ692592_HBc_P-A of FT:mat_peptide FJ692592_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50175). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYREGLESPEHCSPHHTALRQAILXWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|FJ692593_HBc_P-A Product feature CHAIN FJ692593_HBc_P-A of FT:mat_peptide FJ692593_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48054). Non-functional genomic sequence. [Hepadnaviridae] (length=183 residues).
MDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLDDPV
SRDLVVNYVNTNMGLRIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYXPQNAPILSTLPETXVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692595_HBc_P-A Product feature CHAIN FJ692595_HBc_P-A of FT:mat_peptide FJ692595_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48093). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNDNMGIKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPPYRPLNAPILSTLPETTVVRQRYRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692596_HBc_P-A Product feature CHAIN FJ692596_HBc_P-A of FT:mat_peptide FJ692596_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48103). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHTSSITFGREXVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692597_HBc_P-A Product feature CHAIN FJ692597_HBc_P-A of FT:mat_peptide FJ692597_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48125). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALFXEALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDQVVNYVNXNMGLKIRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETAVVRXRXRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692598_HBc_P-A Product feature CHAIN FJ692598_HBc_P-A of FT:mat_peptide FJ692598_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50018). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGEVMBLGNWVGNNLEDXA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRXTVLEYLVSFGVWIRTPPPYRPXNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692599_HBc_P-A Product feature CHAIN FJ692599_HBc_P-A of FT:mat_peptide FJ692599_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50033). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692600_HBc_P-A Product feature CHAIN FJ692600_HBc_P-A of FT:mat_peptide FJ692600_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50034). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPTDYYPSVRDLLDTASALYRXALESPEHCSPHHTALRQAXLCWGELMTLATWVGNNLEDPA
SRDXVVNYVNXNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRXRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692601_HBc_P-A Product feature CHAIN FJ692601_HBc_P-A of FT:mat_peptide FJ692601_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50035). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692602_HBc_P-A Product feature CHAIN FJ692602_HBc_P-A of FT:mat_peptide FJ692602_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50041). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAILCWGDLSTLATWVGNNLADPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692603_HBc_P-A Product feature CHAIN FJ692603_HBc_P-A of FT:mat_peptide FJ692603_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50050). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDHYKEFGAXVELLSFLPSDFYPSVRDLLDTATALYRXXLESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRTQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692604_HBc_P-A Product feature CHAIN FJ692604_HBc_P-A of FT:mat_peptide FJ692604_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50052). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGNNLEDPA
SRDLVVNYVNTTTGLRIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692605_HBc_P-A Product feature CHAIN FJ692605_HBc_P-A of FT:mat_peptide FJ692605_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50059). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDXYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLXDPA
SRDLVVNYVNTXMGLKIRQLLWFHISCLTFGREXVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|FJ692606_HBc_P-A Product feature CHAIN FJ692606_HBc_P-A of FT:mat_peptide FJ692606_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50061). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692607_HBc_P-A Product feature CHAIN FJ692607_HBc_P-A of FT:mat_peptide FJ692607_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50068). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPPYRPQNAPILSTLPETTVVRRGDRGRSLRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692608_HBc_P-A Product feature CHAIN FJ692608_HBc_P-A of FT:mat_peptide FJ692608_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50075). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692609_HBc_P-A Product feature CHAIN FJ692609_HBc_P-A of FT:mat_peptide FJ692609_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50098). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGTWVGNNLQDPA
SRDQVVXYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPXYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692610_HBc_P-A Product feature CHAIN FJ692610_HBc_P-A of FT:mat_peptide FJ692610_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50104). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDXYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHXSPHHTALRQAILCWGELTTLXTWVGNNLQDPA
SRDQVVBYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRXPNAPILSTLPETTVVRRRXRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FJ692611_HBc_P-A Product feature CHAIN FJ692611_HBc_P-A of FT:mat_peptide FJ692611_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50127). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDTYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLASWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRPTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ692612_HBc_P-A Product feature CHAIN FJ692612_HBc_P-A of FT:mat_peptide FJ692612_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50132). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDXYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTXMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPXYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|FJ692613_HBc_P-A Product feature CHAIN FJ692613_HBc_P-A of FT:mat_peptide FJ692613_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50156). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|FJ867946_HBc_P-A Product feature CHAIN FJ867946_HBc_P-A of FT:mat_peptide FJ867946_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCMPC5). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867947_HBc_P-A Product feature CHAIN FJ867947_HBc_P-A of FT:mat_peptide FJ867947_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCMPC9). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867948_HBc_P-A Product feature CHAIN FJ867948_HBc_P-A of FT:mat_peptide FJ867948_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCMPC17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867949_HBc_P-A Product feature CHAIN FJ867949_HBc_P-A of FT:mat_peptide FJ867949_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCMPC4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867958_HBc_P-A Product feature CHAIN FJ867958_HBc_P-A of FT:mat_peptide FJ867958_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCNPC2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867959_HBc_P-A Product feature CHAIN FJ867959_HBc_P-A of FT:mat_peptide FJ867959_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCNPC13). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867960_HBc_P-A Product feature CHAIN FJ867960_HBc_P-A of FT:mat_peptide FJ867960_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCNPC21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867961_HBc_P-A Product feature CHAIN FJ867961_HBc_P-A of FT:mat_peptide FJ867961_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCNPC36). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867962_HBc_P-A Product feature CHAIN FJ867962_HBc_P-A of FT:mat_peptide FJ867962_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCNPC79). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867985_HBc_P-A Product feature CHAIN FJ867985_HBc_P-A of FT:mat_peptide FJ867985_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LCMPC19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867986_HBc_P-A Product feature CHAIN FJ867986_HBc_P-A of FT:mat_peptide FJ867986_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LCMPC26). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867994_HBc_P-A Product feature CHAIN FJ867994_HBc_P-A of FT:mat_peptide FJ867994_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LCNPC13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ867995_HBc_P-A Product feature CHAIN FJ867995_HBc_P-A of FT:mat_peptide FJ867995_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LCNPC29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRELVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ868002_HBc_P-A Product feature CHAIN FJ868002_HBc_P-A of FT:mat_peptide FJ868002_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CHMPC58). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHGSPHHTALRQAILCWGELMTLATWVGINLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREAVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ868007_HBc_P-A Product feature CHAIN FJ868007_HBc_P-A of FT:mat_peptide FJ868007_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CHNPC59). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ868008_HBc_P-A Product feature CHAIN FJ868008_HBc_P-A of FT:mat_peptide FJ868008_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CHNPC87). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRES
>gnl|hbvpro|FJ904411_HBc_P-A Product feature CHAIN FJ904411_HBc_P-A of FT:mat_peptide FJ904411_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A55). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELTDLGSWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FJ904434_HBc_P-A Product feature CHAIN FJ904434_HBc_P-A of FT:mat_peptide FJ904434_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B21). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPRDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQIILCWGDVMTLATWVGTNLZDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FM199974_HBc_P-A Product feature CHAIN FM199974_HBc_P-A of FT:mat_peptide FM199974_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMALASWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHTSCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FM199975_HBc_P-A Product feature CHAIN FM199975_HBc_P-A of FT:mat_peptide FM199975_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESXEHCXPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|FM199976_HBc_P-A Product feature CHAIN FM199976_HBc_P-A of FT:mat_peptide FM199976_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQXLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FM199977_HBc_P-A Product feature CHAIN FM199977_HBc_P-A of FT:mat_peptide FM199977_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALQREALESHEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FM199978_HBc_P-A Product feature CHAIN FM199978_HBc_P-A of FT:mat_peptide FM199978_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FM199979_HBc_P-A Product feature CHAIN FM199979_HBc_P-A of FT:mat_peptide FM199979_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FM199980_HBc_P-A Product feature CHAIN FM199980_HBc_P-A of FT:mat_peptide FM199980_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FM199981_HBc_P-A Product feature CHAIN FM199981_HBc_P-A of FT:mat_peptide FM199981_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMXLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545825_HBc_P-A Product feature CHAIN FN545825_HBc_P-A of FT:mat_peptide FN545825_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRXQSRESQC
>gnl|hbvpro|FN545826_HBc_P-A Product feature CHAIN FN545826_HBc_P-A of FT:mat_peptide FN545826_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELISFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGNNLEDPA
SRDLVVNYVNNTTGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FN545828_HBc_P-A Product feature CHAIN FN545828_HBc_P-A of FT:mat_peptide FN545828_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLASWVGNNLQDPA
SRDQVVDYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPLNAPILSTLPETTVVRRRDPGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545829_HBc_P-A Product feature CHAIN FN545829_HBc_P-A of FT:mat_peptide FN545829_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREGLESPEHCTPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRARSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545830_HBc_P-A Product feature CHAIN FN545830_HBc_P-A of FT:mat_peptide FN545830_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPLNAPILSTLPETAVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|FN545831_HBc_P-A Product feature CHAIN FN545831_HBc_P-A of FT:mat_peptide FN545831_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545832_HBc_P-A Product feature CHAIN FN545832_HBc_P-A of FT:mat_peptide FN545832_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRXALESPEHCTPHHTALRQAILCWGEXMTLATWVGNNLDDPA
SRDLVVNYVNTXMGLKIRQLLWFHISCLTFGREXVLZYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRXRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESXC
>gnl|hbvpro|FN545833_HBc_P-A Product feature CHAIN FN545833_HBc_P-A of FT:mat_peptide FN545833_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQILWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545834_HBc_P-A Product feature CHAIN FN545834_HBc_P-A of FT:mat_peptide FN545834_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSARDLLETASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCITFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545835_HBc_P-A Product feature CHAIN FN545835_HBc_P-A of FT:mat_peptide FN545835_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545836_HBc_P-A Product feature CHAIN FN545836_HBc_P-A of FT:mat_peptide FN545836_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545837_HBc_P-A Product feature CHAIN FN545837_HBc_P-A of FT:mat_peptide FN545837_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMXLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQXLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPLNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545838_HBc_P-A Product feature CHAIN FN545838_HBc_P-A of FT:mat_peptide FN545838_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVMSLATWVGTNLEDPA
SREQVVSYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRLRNRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|FN545839_HBc_P-A Product feature CHAIN FN545839_HBc_P-A of FT:mat_peptide FN545839_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRXTVLQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRXRDRGRSPRR
RTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|FN545840_HBc_P-A Product feature CHAIN FN545840_HBc_P-A of FT:mat_peptide FN545840_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ161813_HBc_P-A Product feature CHAIN GQ161813_HBc_P-A of FT:mat_peptide GQ161813_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GU1021). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ184323_HBc_P-A Product feature CHAIN GQ184323_HBc_P-A of FT:mat_peptide GQ184323_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1121). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ184324_HBc_P-A Product feature CHAIN GQ184324_HBc_P-A of FT:mat_peptide GQ184324_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1122). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATLELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ222208_HBc_P-A Product feature CHAIN GQ222208_HBc_P-A of FT:mat_peptide GQ222208_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1123). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWRELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|GQ331046_HBc_P-A Product feature CHAIN GQ331046_HBc_P-A of FT:mat_peptide GQ331046_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-188). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ331047_HBc_P-A Product feature CHAIN GQ331047_HBc_P-A of FT:mat_peptide GQ331047_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-56). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|GQ414522_HBc_P-A Product feature CHAIN GQ414522_HBc_P-A of FT:mat_peptide GQ414522_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477461_HBc_P-A Product feature CHAIN GQ477461_HBc_P-A of FT:mat_peptide GQ477461_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477462_HBc_P-A Product feature CHAIN GQ477462_HBc_P-A of FT:mat_peptide GQ477462_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P4). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPHDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTSLGTWVGNNLDDQA
SRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSPSRGSQC
>gnl|hbvpro|GQ477463_HBc_P-A Product feature CHAIN GQ477463_HBc_P-A of FT:mat_peptide GQ477463_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCTPHHTALRQAILCWVELMTLASWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ477464_HBc_P-A Product feature CHAIN GQ477464_HBc_P-A of FT:mat_peptide GQ477464_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P8). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPLDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ477465_HBc_P-A Product feature CHAIN GQ477465_HBc_P-A of FT:mat_peptide GQ477465_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P10). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLASWVGNNLQDPA
SRDLVVDYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVCRRRVRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477466_HBc_P-A Product feature CHAIN GQ477466_HBc_P-A of FT:mat_peptide GQ477466_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P12). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAVLCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHLSCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|GQ477467_HBc_P-A Product feature CHAIN GQ477467_HBc_P-A of FT:mat_peptide GQ477467_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P14). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477468_HBc_P-A Product feature CHAIN GQ477468_HBc_P-A of FT:mat_peptide GQ477468_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLATWVGNNLEDLA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477469_HBc_P-A Product feature CHAIN GQ477469_HBc_P-A of FT:mat_peptide GQ477469_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPLDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAVLCWGELMTLATWVGNNLEDQA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSILPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477470_HBc_P-A Product feature CHAIN GQ477470_HBc_P-A of FT:mat_peptide GQ477470_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPFDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTNLGTWVGNNLEDQA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477472_HBc_P-A Product feature CHAIN GQ477472_HBc_P-A of FT:mat_peptide GQ477472_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPTDFFPGVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSILPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477473_HBc_P-A Product feature CHAIN GQ477473_HBc_P-A of FT:mat_peptide GQ477473_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPLDFFPSARDLLDTASALYREGLESPEHCSPHHTALRQAILCWGELTALATWVGGNLDDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLDYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|GQ477474_HBc_P-A Product feature CHAIN GQ477474_HBc_P-A of FT:mat_peptide GQ477474_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELISFLPSDFFPSVRDLLDTASALYREALESSEHCSPHHTAIRHVLLCWVELMTLANWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRDRVRSPRR
RTPSPRRRRSQSPRRRRSPSREPQC
>gnl|hbvpro|GQ477475_HBc_P-A Product feature CHAIN GQ477475_HBc_P-A of FT:mat_peptide GQ477475_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTAIRQVVLCWGELMTLATWVGNNLQDQA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPLNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477476_HBc_P-A Product feature CHAIN GQ477476_HBc_P-A of FT:mat_peptide GQ477476_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPTDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELSTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHVSCIIFGREIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477477_HBc_P-A Product feature CHAIN GQ477477_HBc_P-A of FT:mat_peptide GQ477477_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASASLLSFLPHDFFPSVRDLLDTATALFQEALESPEHCSSHHTAIRQAILCWGELMSLASWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477478_HBc_P-A Product feature CHAIN GQ477478_HBc_P-A of FT:mat_peptide GQ477478_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P34). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPTDYYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPENTVVRPRGRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477479_HBc_P-A Product feature CHAIN GQ477479_HBc_P-A of FT:mat_peptide GQ477479_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPADYYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477480_HBc_P-A Product feature CHAIN GQ477480_HBc_P-A of FT:mat_peptide GQ477480_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P41). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASTELLSFLPSDFFPNVRDLLDTASALYREALESPEHCTPHHTALRQAVLCWGELMNLATWVGSNLQDPA
SRDLVVNYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRRRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477482_HBc_P-A Product feature CHAIN GQ477482_HBc_P-A of FT:mat_peptide GQ477482_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P46). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDHYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIICWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477484_HBc_P-A Product feature CHAIN GQ477484_HBc_P-A of FT:mat_peptide GQ477484_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P54). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVMSLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRQHRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477486_HBc_P-A Product feature CHAIN GQ477486_HBc_P-A of FT:mat_peptide GQ477486_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P57). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTAAALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477487_HBc_P-A Product feature CHAIN GQ477487_HBc_P-A of FT:mat_peptide GQ477487_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P60). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPHDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELSTLATWVGNNLQDSA
SRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRG
RTPSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|GQ477488_HBc_P-A Product feature CHAIN GQ477488_HBc_P-A of FT:mat_peptide GQ477488_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P64). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSHHHTAIRQAILCWGELMTLASWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477490_HBc_P-A Product feature CHAIN GQ477490_HBc_P-A of FT:mat_peptide GQ477490_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P74). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLATWVGSNLEDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477491_HBc_P-A Product feature CHAIN GQ477491_HBc_P-A of FT:mat_peptide GQ477491_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P75). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVDLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHSSCITFGRDTVLEYLVSFGVWIRTPPAYRPLNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GQ477493_HBc_P-A Product feature CHAIN GQ477493_HBc_P-A of FT:mat_peptide GQ477493_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P79). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPTDFFPSARDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCITFGRDTVLEYLVSFGVWIRTPPAYRPLNAPILSTLPETTVVRCRDRRRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477494_HBc_P-A Product feature CHAIN GQ477494_HBc_P-A of FT:mat_peptide GQ477494_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P80). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477495_HBc_P-A Product feature CHAIN GQ477495_HBc_P-A of FT:mat_peptide GQ477495_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P89). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477496_HBc_P-A Product feature CHAIN GQ477496_HBc_P-A of FT:mat_peptide GQ477496_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P94). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRVRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477497_HBc_P-A Product feature CHAIN GQ477497_HBc_P-A of FT:mat_peptide GQ477497_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P98). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGTWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPHC
>gnl|hbvpro|GQ477498_HBc_P-A Product feature CHAIN GQ477498_HBc_P-A of FT:mat_peptide GQ477498_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P100). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477499_HBc_P-A Product feature CHAIN GQ477499_HBc_P-A of FT:mat_peptide GQ477499_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P105). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPLDFYPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRCRDRRRSPRR
RTPSPRRRKSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477500_HBc_P-A Product feature CHAIN GQ477500_HBc_P-A of FT:mat_peptide GQ477500_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P107). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPTDFFPSVKDLLDTASALYREALESSEHCSPHHTAIRQVILCWGDVMTLGTWVGNNLEDPA
SKDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477501_HBc_P-A Product feature CHAIN GQ477501_HBc_P-A of FT:mat_peptide GQ477501_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P116). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGELTTLGTWVGNNLNDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSMLPETAVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477502_HBc_P-A Product feature CHAIN GQ477502_HBc_P-A of FT:mat_peptide GQ477502_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P123). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPADFFPNVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRPRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|GQ477503_HBc_P-A Product feature CHAIN GQ477503_HBc_P-A of FT:mat_peptide GQ477503_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P130). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GQ477504_HBc_P-A Product feature CHAIN GQ477504_HBc_P-A of FT:mat_peptide GQ477504_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P131). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELSTLATWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGREVVHEYLVSFGVWIRTPPAYRPINAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563545_HBc_P-A Product feature CHAIN GU563545_HBc_P-A of FT:mat_peptide GU563545_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-5). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLCDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563546_HBc_P-A Product feature CHAIN GU563546_HBc_P-A of FT:mat_peptide GU563546_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-66). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563547_HBc_P-A Product feature CHAIN GU563547_HBc_P-A of FT:mat_peptide GU563547_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-23). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATTDLLSFLPSDFFPSVRDLRDTTSALYREALESPEHCSSHHTAIRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHLSCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|GU563548_HBc_P-A Product feature CHAIN GU563548_HBc_P-A of FT:mat_peptide GU563548_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-108). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563550_HBc_P-A Product feature CHAIN GU563550_HBc_P-A of FT:mat_peptide GU563550_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-204). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563551_HBc_P-A Product feature CHAIN GU563551_HBc_P-A of FT:mat_peptide GU563551_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-124). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|GU563553_HBc_P-A Product feature CHAIN GU563553_HBc_P-A of FT:mat_peptide GU563553_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-10). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563554_HBc_P-A Product feature CHAIN GU563554_HBc_P-A of FT:mat_peptide GU563554_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-25). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563555_HBc_P-A Product feature CHAIN GU563555_HBc_P-A of FT:mat_peptide GU563555_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-35). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563557_HBc_P-A Product feature CHAIN GU563557_HBc_P-A of FT:mat_peptide GU563557_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-78). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563558_HBc_P-A Product feature CHAIN GU563558_HBc_P-A of FT:mat_peptide GU563558_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-90). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU563562_HBc_P-A Product feature CHAIN GU563562_HBc_P-A of FT:mat_peptide GU563562_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-189). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|GU827640_HBc_P-A Product feature CHAIN GU827640_HBc_P-A of FT:mat_peptide GU827640_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMC25B). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTSLGTWVGNNLEDQA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|HE576988_HBc_P-A Product feature CHAIN HE576988_HBc_P-A of FT:mat_peptide HE576988_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5.9). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HE576989_HBc_P-A Product feature CHAIN HE576989_HBc_P-A of FT:mat_peptide HE576989_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P2.2.11). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM011485_HBc_P-A Product feature CHAIN HM011485_HBc_P-A of FT:mat_peptide HM011485_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCXPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDQGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM042263_HBc_P-A Product feature CHAIN HM042263_HBc_P-A of FT:mat_peptide HM042263_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 469). Partial genome (Contains: HBc, HBx, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESAEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM042278_HBc_P-A Product feature CHAIN HM042278_HBc_P-A of FT:mat_peptide HM042278_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 484). Partial genome (Contains: HBc, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM363612_HBc_P-A Product feature CHAIN HM363612_HBc_P-A of FT:mat_peptide HM363612_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTSAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM363613_HBc_P-A Product feature CHAIN HM363613_HBc_P-A of FT:mat_peptide HM363613_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate V103). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTSAALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM535200_HBc_P-A Product feature CHAIN HM535200_HBc_P-A of FT:mat_peptide HM535200_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 947 Harare). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLRFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|HM535205_HBc_P-A Product feature CHAIN HM535205_HBc_P-A of FT:mat_peptide HM535205_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 72 Mutare). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRGRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439720_HBc_P-A Product feature CHAIN JF439720_HBc_P-A of FT:mat_peptide JF439720_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL437). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439721_HBc_P-A Product feature CHAIN JF439721_HBc_P-A of FT:mat_peptide JF439721_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL444). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELPSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439722_HBc_P-A Product feature CHAIN JF439722_HBc_P-A of FT:mat_peptide JF439722_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL445). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439723_HBc_P-A Product feature CHAIN JF439723_HBc_P-A of FT:mat_peptide JF439723_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL448). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439724_HBc_P-A Product feature CHAIN JF439724_HBc_P-A of FT:mat_peptide JF439724_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL450). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRGALESPEHCSPHHTALRQDILCWGELMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPQTTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439725_HBc_P-A Product feature CHAIN JF439725_HBc_P-A of FT:mat_peptide JF439725_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL451). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPQTTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439726_HBc_P-A Product feature CHAIN JF439726_HBc_P-A of FT:mat_peptide JF439726_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL452). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439727_HBc_P-A Product feature CHAIN JF439727_HBc_P-A of FT:mat_peptide JF439727_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL453). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439728_HBc_P-A Product feature CHAIN JF439728_HBc_P-A of FT:mat_peptide JF439728_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL454). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGKVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPQTTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439729_HBc_P-A Product feature CHAIN JF439729_HBc_P-A of FT:mat_peptide JF439729_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPQTTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439730_HBc_P-A Product feature CHAIN JF439730_HBc_P-A of FT:mat_peptide JF439730_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL456). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGKVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439731_HBc_P-A Product feature CHAIN JF439731_HBc_P-A of FT:mat_peptide JF439731_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL458). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGKVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439732_HBc_P-A Product feature CHAIN JF439732_HBc_P-A of FT:mat_peptide JF439732_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL459). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439733_HBc_P-A Product feature CHAIN JF439733_HBc_P-A of FT:mat_peptide JF439733_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL460). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439734_HBc_P-A Product feature CHAIN JF439734_HBc_P-A of FT:mat_peptide JF439734_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL461). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439735_HBc_P-A Product feature CHAIN JF439735_HBc_P-A of FT:mat_peptide JF439735_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL462). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439736_HBc_P-A Product feature CHAIN JF439736_HBc_P-A of FT:mat_peptide JF439736_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL463). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439737_HBc_P-A Product feature CHAIN JF439737_HBc_P-A of FT:mat_peptide JF439737_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL465). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMSLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439738_HBc_P-A Product feature CHAIN JF439738_HBc_P-A of FT:mat_peptide JF439738_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL466). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYREFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGNVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439740_HBc_P-A Product feature CHAIN JF439740_HBc_P-A of FT:mat_peptide JF439740_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL468). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLGSPEHCSPHHTALRQAILCWGNVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439741_HBc_P-A Product feature CHAIN JF439741_HBc_P-A of FT:mat_peptide JF439741_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL469). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGKVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439742_HBc_P-A Product feature CHAIN JF439742_HBc_P-A of FT:mat_peptide JF439742_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL471). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439743_HBc_P-A Product feature CHAIN JF439743_HBc_P-A of FT:mat_peptide JF439743_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL472). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRPPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439744_HBc_P-A Product feature CHAIN JF439744_HBc_P-A of FT:mat_peptide JF439744_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL473). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGGLMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPQTTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439746_HBc_P-A Product feature CHAIN JF439746_HBc_P-A of FT:mat_peptide JF439746_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL485). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439747_HBc_P-A Product feature CHAIN JF439747_HBc_P-A of FT:mat_peptide JF439747_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL489). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439748_HBc_P-A Product feature CHAIN JF439748_HBc_P-A of FT:mat_peptide JF439748_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL490). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTAPRQAILCWGNVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439750_HBc_P-A Product feature CHAIN JF439750_HBc_P-A of FT:mat_peptide JF439750_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL498). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGNVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439751_HBc_P-A Product feature CHAIN JF439751_HBc_P-A of FT:mat_peptide JF439751_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL499). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPQTTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439752_HBc_P-A Product feature CHAIN JF439752_HBc_P-A of FT:mat_peptide JF439752_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439753_HBc_P-A Product feature CHAIN JF439753_HBc_P-A of FT:mat_peptide JF439753_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439754_HBc_P-A Product feature CHAIN JF439754_HBc_P-A of FT:mat_peptide JF439754_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439755_HBc_P-A Product feature CHAIN JF439755_HBc_P-A of FT:mat_peptide JF439755_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A4). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439756_HBc_P-A Product feature CHAIN JF439756_HBc_P-A of FT:mat_peptide JF439756_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439757_HBc_P-A Product feature CHAIN JF439757_HBc_P-A of FT:mat_peptide JF439757_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439758_HBc_P-A Product feature CHAIN JF439758_HBc_P-A of FT:mat_peptide JF439758_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439759_HBc_P-A Product feature CHAIN JF439759_HBc_P-A of FT:mat_peptide JF439759_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439760_HBc_P-A Product feature CHAIN JF439760_HBc_P-A of FT:mat_peptide JF439760_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439761_HBc_P-A Product feature CHAIN JF439761_HBc_P-A of FT:mat_peptide JF439761_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439762_HBc_P-A Product feature CHAIN JF439762_HBc_P-A of FT:mat_peptide JF439762_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439763_HBc_P-A Product feature CHAIN JF439763_HBc_P-A of FT:mat_peptide JF439763_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439764_HBc_P-A Product feature CHAIN JF439764_HBc_P-A of FT:mat_peptide JF439764_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439765_HBc_P-A Product feature CHAIN JF439765_HBc_P-A of FT:mat_peptide JF439765_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439766_HBc_P-A Product feature CHAIN JF439766_HBc_P-A of FT:mat_peptide JF439766_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439767_HBc_P-A Product feature CHAIN JF439767_HBc_P-A of FT:mat_peptide JF439767_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSVLPCDFFPSVPDLLHAASTWYQEVLKSPGHCSPHHTALLHAILCWRELMTLATWVGDNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439768_HBc_P-A Product feature CHAIN JF439768_HBc_P-A of FT:mat_peptide JF439768_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439769_HBc_P-A Product feature CHAIN JF439769_HBc_P-A of FT:mat_peptide JF439769_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439770_HBc_P-A Product feature CHAIN JF439770_HBc_P-A of FT:mat_peptide JF439770_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B12). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439771_HBc_P-A Product feature CHAIN JF439771_HBc_P-A of FT:mat_peptide JF439771_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C3). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439772_HBc_P-A Product feature CHAIN JF439772_HBc_P-A of FT:mat_peptide JF439772_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C5). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439773_HBc_P-A Product feature CHAIN JF439773_HBc_P-A of FT:mat_peptide JF439773_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C7). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439774_HBc_P-A Product feature CHAIN JF439774_HBc_P-A of FT:mat_peptide JF439774_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALREAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439775_HBc_P-A Product feature CHAIN JF439775_HBc_P-A of FT:mat_peptide JF439775_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C9). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439777_HBc_P-A Product feature CHAIN JF439777_HBc_P-A of FT:mat_peptide JF439777_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05D2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439778_HBc_P-A Product feature CHAIN JF439778_HBc_P-A of FT:mat_peptide JF439778_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05D3). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439819_HBc_P-A Product feature CHAIN JF439819_HBc_P-A of FT:mat_peptide JF439819_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97A1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439820_HBc_P-A Product feature CHAIN JF439820_HBc_P-A of FT:mat_peptide JF439820_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97B1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439821_HBc_P-A Product feature CHAIN JF439821_HBc_P-A of FT:mat_peptide JF439821_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97B2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
RDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYQEALKSPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVFNYVNTNMGLKIRQLLWFHISCLSFGRKTVLEYLVSFGVWIRTPPDYKLPNAPILSTLPETTVVRRRDRRRFPKR
RTPSPRRRRSQSPRRRRSXSRESQC
>gnl|hbvpro|JF439822_HBc_P-A Product feature CHAIN JF439822_HBc_P-A of FT:mat_peptide JF439822_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97C1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQFRESQC
>gnl|hbvpro|JF439823_HBc_P-A Product feature CHAIN JF439823_HBc_P-A of FT:mat_peptide JF439823_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97C2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439824_HBc_P-A Product feature CHAIN JF439824_HBc_P-A of FT:mat_peptide JF439824_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97D1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439825_HBc_P-A Product feature CHAIN JF439825_HBc_P-A of FT:mat_peptide JF439825_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97D2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439826_HBc_P-A Product feature CHAIN JF439826_HBc_P-A of FT:mat_peptide JF439826_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97E1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGAAVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439827_HBc_P-A Product feature CHAIN JF439827_HBc_P-A of FT:mat_peptide JF439827_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97E2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439828_HBc_P-A Product feature CHAIN JF439828_HBc_P-A of FT:mat_peptide JF439828_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97F1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQPRESQC
>gnl|hbvpro|JF439829_HBc_P-A Product feature CHAIN JF439829_HBc_P-A of FT:mat_peptide JF439829_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97F2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHAALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439830_HBc_P-A Product feature CHAIN JF439830_HBc_P-A of FT:mat_peptide JF439830_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97G2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDVDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMALATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETALEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439831_HBc_P-A Product feature CHAIN JF439831_HBc_P-A of FT:mat_peptide JF439831_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97H1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439832_HBc_P-A Product feature CHAIN JF439832_HBc_P-A of FT:mat_peptide JF439832_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97H2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPGHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLASFGVWIRTPPVYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439833_HBc_P-A Product feature CHAIN JF439833_HBc_P-A of FT:mat_peptide JF439833_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99H4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439834_HBc_P-A Product feature CHAIN JF439834_HBc_P-A of FT:mat_peptide JF439834_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99A4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439835_HBc_P-A Product feature CHAIN JF439835_HBc_P-A of FT:mat_peptide JF439835_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99B3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439836_HBc_P-A Product feature CHAIN JF439836_HBc_P-A of FT:mat_peptide JF439836_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99B4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439837_HBc_P-A Product feature CHAIN JF439837_HBc_P-A of FT:mat_peptide JF439837_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99C3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439838_HBc_P-A Product feature CHAIN JF439838_HBc_P-A of FT:mat_peptide JF439838_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99C4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439839_HBc_P-A Product feature CHAIN JF439839_HBc_P-A of FT:mat_peptide JF439839_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99D3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439840_HBc_P-A Product feature CHAIN JF439840_HBc_P-A of FT:mat_peptide JF439840_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99D4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439841_HBc_P-A Product feature CHAIN JF439841_HBc_P-A of FT:mat_peptide JF439841_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99E4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439842_HBc_P-A Product feature CHAIN JF439842_HBc_P-A of FT:mat_peptide JF439842_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99F3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439843_HBc_P-A Product feature CHAIN JF439843_HBc_P-A of FT:mat_peptide JF439843_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99F4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439844_HBc_P-A Product feature CHAIN JF439844_HBc_P-A of FT:mat_peptide JF439844_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99H3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439845_HBc_P-A Product feature CHAIN JF439845_HBc_P-A of FT:mat_peptide JF439845_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00H6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RAPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439846_HBc_P-A Product feature CHAIN JF439846_HBc_P-A of FT:mat_peptide JF439846_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00A5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439847_HBc_P-A Product feature CHAIN JF439847_HBc_P-A of FT:mat_peptide JF439847_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00A6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439848_HBc_P-A Product feature CHAIN JF439848_HBc_P-A of FT:mat_peptide JF439848_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00B5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JF439849_HBc_P-A Product feature CHAIN JF439849_HBc_P-A of FT:mat_peptide JF439849_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00B6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439850_HBc_P-A Product feature CHAIN JF439850_HBc_P-A of FT:mat_peptide JF439850_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00C5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439851_HBc_P-A Product feature CHAIN JF439851_HBc_P-A of FT:mat_peptide JF439851_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00C6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439852_HBc_P-A Product feature CHAIN JF439852_HBc_P-A of FT:mat_peptide JF439852_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00D5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQR
>gnl|hbvpro|JF439853_HBc_P-A Product feature CHAIN JF439853_HBc_P-A of FT:mat_peptide JF439853_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00D6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439854_HBc_P-A Product feature CHAIN JF439854_HBc_P-A of FT:mat_peptide JF439854_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00E5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439855_HBc_P-A Product feature CHAIN JF439855_HBc_P-A of FT:mat_peptide JF439855_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00E6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVPFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439856_HBc_P-A Product feature CHAIN JF439856_HBc_P-A of FT:mat_peptide JF439856_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00F5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439857_HBc_P-A Product feature CHAIN JF439857_HBc_P-A of FT:mat_peptide JF439857_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00F6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439858_HBc_P-A Product feature CHAIN JF439858_HBc_P-A of FT:mat_peptide JF439858_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00G5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439859_HBc_P-A Product feature CHAIN JF439859_HBc_P-A of FT:mat_peptide JF439859_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00G6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLPDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439860_HBc_P-A Product feature CHAIN JF439860_HBc_P-A of FT:mat_peptide JF439860_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00H5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439861_HBc_P-A Product feature CHAIN JF439861_HBc_P-A of FT:mat_peptide JF439861_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05H8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEGPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439864_HBc_P-A Product feature CHAIN JF439864_HBc_P-A of FT:mat_peptide JF439864_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05D7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439865_HBc_P-A Product feature CHAIN JF439865_HBc_P-A of FT:mat_peptide JF439865_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05D8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439866_HBc_P-A Product feature CHAIN JF439866_HBc_P-A of FT:mat_peptide JF439866_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05F7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439867_HBc_P-A Product feature CHAIN JF439867_HBc_P-A of FT:mat_peptide JF439867_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05G8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439868_HBc_P-A Product feature CHAIN JF439868_HBc_P-A of FT:mat_peptide JF439868_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05H7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439869_HBc_P-A Product feature CHAIN JF439869_HBc_P-A of FT:mat_peptide JF439869_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439870_HBc_P-A Product feature CHAIN JF439870_HBc_P-A of FT:mat_peptide JF439870_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439871_HBc_P-A Product feature CHAIN JF439871_HBc_P-A of FT:mat_peptide JF439871_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439872_HBc_P-A Product feature CHAIN JF439872_HBc_P-A of FT:mat_peptide JF439872_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439873_HBc_P-A Product feature CHAIN JF439873_HBc_P-A of FT:mat_peptide JF439873_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439874_HBc_P-A Product feature CHAIN JF439874_HBc_P-A of FT:mat_peptide JF439874_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439875_HBc_P-A Product feature CHAIN JF439875_HBc_P-A of FT:mat_peptide JF439875_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439876_HBc_P-A Product feature CHAIN JF439876_HBc_P-A of FT:mat_peptide JF439876_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439877_HBc_P-A Product feature CHAIN JF439877_HBc_P-A of FT:mat_peptide JF439877_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439878_HBc_P-A Product feature CHAIN JF439878_HBc_P-A of FT:mat_peptide JF439878_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439879_HBc_P-A Product feature CHAIN JF439879_HBc_P-A of FT:mat_peptide JF439879_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439880_HBc_P-A Product feature CHAIN JF439880_HBc_P-A of FT:mat_peptide JF439880_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439881_HBc_P-A Product feature CHAIN JF439881_HBc_P-A of FT:mat_peptide JF439881_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439882_HBc_P-A Product feature CHAIN JF439882_HBc_P-A of FT:mat_peptide JF439882_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439883_HBc_P-A Product feature CHAIN JF439883_HBc_P-A of FT:mat_peptide JF439883_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439896_HBc_P-A Product feature CHAIN JF439896_HBc_P-A of FT:mat_peptide JF439896_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439897_HBc_P-A Product feature CHAIN JF439897_HBc_P-A of FT:mat_peptide JF439897_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439898_HBc_P-A Product feature CHAIN JF439898_HBc_P-A of FT:mat_peptide JF439898_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439899_HBc_P-A Product feature CHAIN JF439899_HBc_P-A of FT:mat_peptide JF439899_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439900_HBc_P-A Product feature CHAIN JF439900_HBc_P-A of FT:mat_peptide JF439900_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439901_HBc_P-A Product feature CHAIN JF439901_HBc_P-A of FT:mat_peptide JF439901_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439902_HBc_P-A Product feature CHAIN JF439902_HBc_P-A of FT:mat_peptide JF439902_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439903_HBc_P-A Product feature CHAIN JF439903_HBc_P-A of FT:mat_peptide JF439903_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439904_HBc_P-A Product feature CHAIN JF439904_HBc_P-A of FT:mat_peptide JF439904_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439905_HBc_P-A Product feature CHAIN JF439905_HBc_P-A of FT:mat_peptide JF439905_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439906_HBc_P-A Product feature CHAIN JF439906_HBc_P-A of FT:mat_peptide JF439906_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439907_HBc_P-A Product feature CHAIN JF439907_HBc_P-A of FT:mat_peptide JF439907_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439908_HBc_P-A Product feature CHAIN JF439908_HBc_P-A of FT:mat_peptide JF439908_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWWDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439909_HBc_P-A Product feature CHAIN JF439909_HBc_P-A of FT:mat_peptide JF439909_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439910_HBc_P-A Product feature CHAIN JF439910_HBc_P-A of FT:mat_peptide JF439910_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439911_HBc_P-A Product feature CHAIN JF439911_HBc_P-A of FT:mat_peptide JF439911_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF439912_HBc_P-A Product feature CHAIN JF439912_HBc_P-A of FT:mat_peptide JF439912_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF439913_HBc_P-A Product feature CHAIN JF439913_HBc_P-A of FT:mat_peptide JF439913_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF439914_HBc_P-A Product feature CHAIN JF439914_HBc_P-A of FT:mat_peptide JF439914_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF439915_HBc_P-A Product feature CHAIN JF439915_HBc_P-A of FT:mat_peptide JF439915_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A5). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFRISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF439916_HBc_P-A Product feature CHAIN JF439916_HBc_P-A of FT:mat_peptide JF439916_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF439917_HBc_P-A Product feature CHAIN JF439917_HBc_P-A of FT:mat_peptide JF439917_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF439918_HBc_P-A Product feature CHAIN JF439918_HBc_P-A of FT:mat_peptide JF439918_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF439919_HBc_P-A Product feature CHAIN JF439919_HBc_P-A of FT:mat_peptide JF439919_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A9). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF439920_HBc_P-A Product feature CHAIN JF439920_HBc_P-A of FT:mat_peptide JF439920_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF439921_HBc_P-A Product feature CHAIN JF439921_HBc_P-A of FT:mat_peptide JF439921_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A11). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDSFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF439922_HBc_P-A Product feature CHAIN JF439922_HBc_P-A of FT:mat_peptide JF439922_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00A12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF439923_HBc_P-A Product feature CHAIN JF439923_HBc_P-A of FT:mat_peptide JF439923_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=186 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQCE
>gnl|hbvpro|JF439924_HBc_P-A Product feature CHAIN JF439924_HBc_P-A of FT:mat_peptide JF439924_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF439925_HBc_P-A Product feature CHAIN JF439925_HBc_P-A of FT:mat_peptide JF439925_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF439926_HBc_P-A Product feature CHAIN JF439926_HBc_P-A of FT:mat_peptide JF439926_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B4). Partial genome (Contains: HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLMWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNVPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF439927_HBc_P-A Product feature CHAIN JF439927_HBc_P-A of FT:mat_peptide JF439927_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB00B6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|JF439928_HBc_P-A Product feature CHAIN JF439928_HBc_P-A of FT:mat_peptide JF439928_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRNLVVNYVSTNMGLKIRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439929_HBc_P-A Product feature CHAIN JF439929_HBc_P-A of FT:mat_peptide JF439929_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDSFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439930_HBc_P-A Product feature CHAIN JF439930_HBc_P-A of FT:mat_peptide JF439930_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B9). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALSRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439931_HBc_P-A Product feature CHAIN JF439931_HBc_P-A of FT:mat_peptide JF439931_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRNTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRDQGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439932_HBc_P-A Product feature CHAIN JF439932_HBc_P-A of FT:mat_peptide JF439932_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B11). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILPTLPECTVVRRRDRVRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439933_HBc_P-A Product feature CHAIN JF439933_HBc_P-A of FT:mat_peptide JF439933_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05B12). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439934_HBc_P-A Product feature CHAIN JF439934_HBc_P-A of FT:mat_peptide JF439934_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C1). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439935_HBc_P-A Product feature CHAIN JF439935_HBc_P-A of FT:mat_peptide JF439935_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C2). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQPLWFHISCLTFGRNTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRDQGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439936_HBc_P-A Product feature CHAIN JF439936_HBc_P-A of FT:mat_peptide JF439936_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C3). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439937_HBc_P-A Product feature CHAIN JF439937_HBc_P-A of FT:mat_peptide JF439937_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C4). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439938_HBc_P-A Product feature CHAIN JF439938_HBc_P-A of FT:mat_peptide JF439938_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C5). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439939_HBc_P-A Product feature CHAIN JF439939_HBc_P-A of FT:mat_peptide JF439939_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C6). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439940_HBc_P-A Product feature CHAIN JF439940_HBc_P-A of FT:mat_peptide JF439940_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C7). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439941_HBc_P-A Product feature CHAIN JF439941_HBc_P-A of FT:mat_peptide JF439941_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C8). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVIEYLVPFGVWIRTPPAYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439942_HBc_P-A Product feature CHAIN JF439942_HBc_P-A of FT:mat_peptide JF439942_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LAMB05C10). Partial genome (Contains: HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439943_HBc_P-A Product feature CHAIN JF439943_HBc_P-A of FT:mat_peptide JF439943_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439944_HBc_P-A Product feature CHAIN JF439944_HBc_P-A of FT:mat_peptide JF439944_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDMDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439945_HBc_P-A Product feature CHAIN JF439945_HBc_P-A of FT:mat_peptide JF439945_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439946_HBc_P-A Product feature CHAIN JF439946_HBc_P-A of FT:mat_peptide JF439946_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439947_HBc_P-A Product feature CHAIN JF439947_HBc_P-A of FT:mat_peptide JF439947_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439948_HBc_P-A Product feature CHAIN JF439948_HBc_P-A of FT:mat_peptide JF439948_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439949_HBc_P-A Product feature CHAIN JF439949_HBc_P-A of FT:mat_peptide JF439949_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439950_HBc_P-A Product feature CHAIN JF439950_HBc_P-A of FT:mat_peptide JF439950_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439951_HBc_P-A Product feature CHAIN JF439951_HBc_P-A of FT:mat_peptide JF439951_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439952_HBc_P-A Product feature CHAIN JF439952_HBc_P-A of FT:mat_peptide JF439952_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPCRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439953_HBc_P-A Product feature CHAIN JF439953_HBc_P-A of FT:mat_peptide JF439953_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLGYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439954_HBc_P-A Product feature CHAIN JF439954_HBc_P-A of FT:mat_peptide JF439954_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPDTTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSRSRESQC
>gnl|hbvpro|JF439955_HBc_P-A Product feature CHAIN JF439955_HBc_P-A of FT:mat_peptide JF439955_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439956_HBc_P-A Product feature CHAIN JF439956_HBc_P-A of FT:mat_peptide JF439956_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439957_HBc_P-A Product feature CHAIN JF439957_HBc_P-A of FT:mat_peptide JF439957_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439958_HBc_P-A Product feature CHAIN JF439958_HBc_P-A of FT:mat_peptide JF439958_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWEELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAHRPPNAPILSTLPETTVVRRRDRGRSPRG
GTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439959_HBc_P-A Product feature CHAIN JF439959_HBc_P-A of FT:mat_peptide JF439959_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439960_HBc_P-A Product feature CHAIN JF439960_HBc_P-A of FT:mat_peptide JF439960_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439961_HBc_P-A Product feature CHAIN JF439961_HBc_P-A of FT:mat_peptide JF439961_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439962_HBc_P-A Product feature CHAIN JF439962_HBc_P-A of FT:mat_peptide JF439962_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVPFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439964_HBc_P-A Product feature CHAIN JF439964_HBc_P-A of FT:mat_peptide JF439964_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSRSPRRRRSQSRESQC
>gnl|hbvpro|JF439965_HBc_P-A Product feature CHAIN JF439965_HBc_P-A of FT:mat_peptide JF439965_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439966_HBc_P-A Product feature CHAIN JF439966_HBc_P-A of FT:mat_peptide JF439966_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c8). Partial genome (Contains: HBe, HBc, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439968_HBc_P-A Product feature CHAIN JF439968_HBc_P-A of FT:mat_peptide JF439968_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439969_HBc_P-A Product feature CHAIN JF439969_HBc_P-A of FT:mat_peptide JF439969_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIGPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLAFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESPC
>gnl|hbvpro|JF439970_HBc_P-A Product feature CHAIN JF439970_HBc_P-A of FT:mat_peptide JF439970_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439971_HBc_P-A Product feature CHAIN JF439971_HBc_P-A of FT:mat_peptide JF439971_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439972_HBc_P-A Product feature CHAIN JF439972_HBc_P-A of FT:mat_peptide JF439972_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLPFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439973_HBc_P-A Product feature CHAIN JF439973_HBc_P-A of FT:mat_peptide JF439973_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDSFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439974_HBc_P-A Product feature CHAIN JF439974_HBc_P-A of FT:mat_peptide JF439974_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQY
>gnl|hbvpro|JF439975_HBc_P-A Product feature CHAIN JF439975_HBc_P-A of FT:mat_peptide JF439975_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTLSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439976_HBc_P-A Product feature CHAIN JF439976_HBc_P-A of FT:mat_peptide JF439976_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTLSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439977_HBc_P-A Product feature CHAIN JF439977_HBc_P-A of FT:mat_peptide JF439977_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439979_HBc_P-A Product feature CHAIN JF439979_HBc_P-A of FT:mat_peptide JF439979_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIPCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439980_HBc_P-A Product feature CHAIN JF439980_HBc_P-A of FT:mat_peptide JF439980_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439981_HBc_P-A Product feature CHAIN JF439981_HBc_P-A of FT:mat_peptide JF439981_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLGTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVKYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439982_HBc_P-A Product feature CHAIN JF439982_HBc_P-A of FT:mat_peptide JF439982_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439983_HBc_P-A Product feature CHAIN JF439983_HBc_P-A of FT:mat_peptide JF439983_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
GTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439984_HBc_P-A Product feature CHAIN JF439984_HBc_P-A of FT:mat_peptide JF439984_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439985_HBc_P-A Product feature CHAIN JF439985_HBc_P-A of FT:mat_peptide JF439985_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELPSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRAPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439986_HBc_P-A Product feature CHAIN JF439986_HBc_P-A of FT:mat_peptide JF439986_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYIEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELLTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439987_HBc_P-A Product feature CHAIN JF439987_HBc_P-A of FT:mat_peptide JF439987_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439988_HBc_P-A Product feature CHAIN JF439988_HBc_P-A of FT:mat_peptide JF439988_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439989_HBc_P-A Product feature CHAIN JF439989_HBc_P-A of FT:mat_peptide JF439989_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439990_HBc_P-A Product feature CHAIN JF439990_HBc_P-A of FT:mat_peptide JF439990_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILPTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439991_HBc_P-A Product feature CHAIN JF439991_HBc_P-A of FT:mat_peptide JF439991_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439992_HBc_P-A Product feature CHAIN JF439992_HBc_P-A of FT:mat_peptide JF439992_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDLFPSVRDLLDTASALYREALESPEHCSPHHTALGQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF439993_HBc_P-A Product feature CHAIN JF439993_HBc_P-A of FT:mat_peptide JF439993_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JF440016_HBc_P-A Product feature CHAIN JF440016_HBc_P-A of FT:mat_peptide JF440016_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B11). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182318_HBc_P-A Product feature CHAIN JN182318_HBc_P-A of FT:mat_peptide JN182318_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182319_HBc_P-A Product feature CHAIN JN182319_HBc_P-A of FT:mat_peptide JN182319_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182320_HBc_P-A Product feature CHAIN JN182320_HBc_P-A of FT:mat_peptide JN182320_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182321_HBc_P-A Product feature CHAIN JN182321_HBc_P-A of FT:mat_peptide JN182321_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182322_HBc_P-A Product feature CHAIN JN182322_HBc_P-A of FT:mat_peptide JN182322_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182323_HBc_P-A Product feature CHAIN JN182323_HBc_P-A of FT:mat_peptide JN182323_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSYGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182324_HBc_P-A Product feature CHAIN JN182324_HBc_P-A of FT:mat_peptide JN182324_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182325_HBc_P-A Product feature CHAIN JN182325_HBc_P-A of FT:mat_peptide JN182325_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILRWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182326_HBc_P-A Product feature CHAIN JN182326_HBc_P-A of FT:mat_peptide JN182326_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQTILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182327_HBc_P-A Product feature CHAIN JN182327_HBc_P-A of FT:mat_peptide JN182327_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182328_HBc_P-A Product feature CHAIN JN182328_HBc_P-A of FT:mat_peptide JN182328_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182329_HBc_P-A Product feature CHAIN JN182329_HBc_P-A of FT:mat_peptide JN182329_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182330_HBc_P-A Product feature CHAIN JN182330_HBc_P-A of FT:mat_peptide JN182330_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182331_HBc_P-A Product feature CHAIN JN182331_HBc_P-A of FT:mat_peptide JN182331_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182332_HBc_P-A Product feature CHAIN JN182332_HBc_P-A of FT:mat_peptide JN182332_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQRLWFHISCLTFGRETALEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182333_HBc_P-A Product feature CHAIN JN182333_HBc_P-A of FT:mat_peptide JN182333_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JN182334_HBc_P-A Product feature CHAIN JN182334_HBc_P-A of FT:mat_peptide JN182334_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGEPMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRSRSQSRESQC
>gnl|hbvpro|JQ023660_HBc_P-A Product feature CHAIN JQ023660_HBc_P-A of FT:mat_peptide JQ023660_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1160). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREDLESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPKAPILSTLPETTVVRRRDRGKSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ023661_HBc_P-A Product feature CHAIN JQ023661_HBc_P-A of FT:mat_peptide JQ023661_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1158). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREDLESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPKAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRKRSQSRESQC
>gnl|hbvpro|JQ687529_HBc_P-A Product feature CHAIN JQ687529_HBc_P-A of FT:mat_peptide JQ687529_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 176). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ687533_HBc_P-A Product feature CHAIN JQ687533_HBc_P-A of FT:mat_peptide JQ687533_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 210). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRKRRSQSPRRKRSQSRESQC
>gnl|hbvpro|JQ707299_HBc_P-A Product feature CHAIN JQ707299_HBc_P-A of FT:mat_peptide JQ707299_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|JQ707300_HBc_P-A Product feature CHAIN JQ707300_HBc_P-A of FT:mat_peptide JQ707300_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C11). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPHRRRSQSRESQC
>gnl|hbvpro|JQ707301_HBc_P-A Product feature CHAIN JQ707301_HBc_P-A of FT:mat_peptide JQ707301_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C12). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707302_HBc_P-A Product feature CHAIN JQ707302_HBc_P-A of FT:mat_peptide JQ707302_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C13). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707303_HBc_P-A Product feature CHAIN JQ707303_HBc_P-A of FT:mat_peptide JQ707303_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C14). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707304_HBc_P-A Product feature CHAIN JQ707304_HBc_P-A of FT:mat_peptide JQ707304_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C15). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707305_HBc_P-A Product feature CHAIN JQ707305_HBc_P-A of FT:mat_peptide JQ707305_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C16). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707306_HBc_P-A Product feature CHAIN JQ707306_HBc_P-A of FT:mat_peptide JQ707306_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C17). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707307_HBc_P-A Product feature CHAIN JQ707307_HBc_P-A of FT:mat_peptide JQ707307_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C18). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707308_HBc_P-A Product feature CHAIN JQ707308_HBc_P-A of FT:mat_peptide JQ707308_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C19). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707309_HBc_P-A Product feature CHAIN JQ707309_HBc_P-A of FT:mat_peptide JQ707309_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707310_HBc_P-A Product feature CHAIN JQ707310_HBc_P-A of FT:mat_peptide JQ707310_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C20). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707311_HBc_P-A Product feature CHAIN JQ707311_HBc_P-A of FT:mat_peptide JQ707311_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C21). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707312_HBc_P-A Product feature CHAIN JQ707312_HBc_P-A of FT:mat_peptide JQ707312_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C22). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFNISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707313_HBc_P-A Product feature CHAIN JQ707313_HBc_P-A of FT:mat_peptide JQ707313_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C23). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707314_HBc_P-A Product feature CHAIN JQ707314_HBc_P-A of FT:mat_peptide JQ707314_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C24). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707315_HBc_P-A Product feature CHAIN JQ707315_HBc_P-A of FT:mat_peptide JQ707315_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C25). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSGFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707316_HBc_P-A Product feature CHAIN JQ707316_HBc_P-A of FT:mat_peptide JQ707316_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C26). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707317_HBc_P-A Product feature CHAIN JQ707317_HBc_P-A of FT:mat_peptide JQ707317_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C27). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707318_HBc_P-A Product feature CHAIN JQ707318_HBc_P-A of FT:mat_peptide JQ707318_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C28). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707319_HBc_P-A Product feature CHAIN JQ707319_HBc_P-A of FT:mat_peptide JQ707319_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707320_HBc_P-A Product feature CHAIN JQ707320_HBc_P-A of FT:mat_peptide JQ707320_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C30). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707321_HBc_P-A Product feature CHAIN JQ707321_HBc_P-A of FT:mat_peptide JQ707321_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C31). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707322_HBc_P-A Product feature CHAIN JQ707322_HBc_P-A of FT:mat_peptide JQ707322_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C32). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707323_HBc_P-A Product feature CHAIN JQ707323_HBc_P-A of FT:mat_peptide JQ707323_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C33). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707324_HBc_P-A Product feature CHAIN JQ707324_HBc_P-A of FT:mat_peptide JQ707324_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C34). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707325_HBc_P-A Product feature CHAIN JQ707325_HBc_P-A of FT:mat_peptide JQ707325_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C35). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707326_HBc_P-A Product feature CHAIN JQ707326_HBc_P-A of FT:mat_peptide JQ707326_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C36). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707327_HBc_P-A Product feature CHAIN JQ707327_HBc_P-A of FT:mat_peptide JQ707327_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C37). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707329_HBc_P-A Product feature CHAIN JQ707329_HBc_P-A of FT:mat_peptide JQ707329_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C39). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSKLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707330_HBc_P-A Product feature CHAIN JQ707330_HBc_P-A of FT:mat_peptide JQ707330_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C4). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707331_HBc_P-A Product feature CHAIN JQ707331_HBc_P-A of FT:mat_peptide JQ707331_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C40). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707332_HBc_P-A Product feature CHAIN JQ707332_HBc_P-A of FT:mat_peptide JQ707332_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C41). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707333_HBc_P-A Product feature CHAIN JQ707333_HBc_P-A of FT:mat_peptide JQ707333_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C42). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707334_HBc_P-A Product feature CHAIN JQ707334_HBc_P-A of FT:mat_peptide JQ707334_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C43). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQR
>gnl|hbvpro|JQ707335_HBc_P-A Product feature CHAIN JQ707335_HBc_P-A of FT:mat_peptide JQ707335_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C44). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESRC
>gnl|hbvpro|JQ707336_HBc_P-A Product feature CHAIN JQ707336_HBc_P-A of FT:mat_peptide JQ707336_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C45). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707337_HBc_P-A Product feature CHAIN JQ707337_HBc_P-A of FT:mat_peptide JQ707337_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C46). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707338_HBc_P-A Product feature CHAIN JQ707338_HBc_P-A of FT:mat_peptide JQ707338_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C47). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707339_HBc_P-A Product feature CHAIN JQ707339_HBc_P-A of FT:mat_peptide JQ707339_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C48). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALGSPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707340_HBc_P-A Product feature CHAIN JQ707340_HBc_P-A of FT:mat_peptide JQ707340_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C5). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707341_HBc_P-A Product feature CHAIN JQ707341_HBc_P-A of FT:mat_peptide JQ707341_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C6). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707342_HBc_P-A Product feature CHAIN JQ707342_HBc_P-A of FT:mat_peptide JQ707342_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C7). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707343_HBc_P-A Product feature CHAIN JQ707343_HBc_P-A of FT:mat_peptide JQ707343_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C8). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707344_HBc_P-A Product feature CHAIN JQ707344_HBc_P-A of FT:mat_peptide JQ707344_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C9). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707345_HBc_P-A Product feature CHAIN JQ707345_HBc_P-A of FT:mat_peptide JQ707345_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C1). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELVSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707346_HBc_P-A Product feature CHAIN JQ707346_HBc_P-A of FT:mat_peptide JQ707346_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C12). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQEPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPDYRSPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707347_HBc_P-A Product feature CHAIN JQ707347_HBc_P-A of FT:mat_peptide JQ707347_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C13). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707348_HBc_P-A Product feature CHAIN JQ707348_HBc_P-A of FT:mat_peptide JQ707348_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C14). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707349_HBc_P-A Product feature CHAIN JQ707349_HBc_P-A of FT:mat_peptide JQ707349_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C15). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707350_HBc_P-A Product feature CHAIN JQ707350_HBc_P-A of FT:mat_peptide JQ707350_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C16). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707351_HBc_P-A Product feature CHAIN JQ707351_HBc_P-A of FT:mat_peptide JQ707351_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707352_HBc_P-A Product feature CHAIN JQ707352_HBc_P-A of FT:mat_peptide JQ707352_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C20). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707353_HBc_P-A Product feature CHAIN JQ707353_HBc_P-A of FT:mat_peptide JQ707353_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C21). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707354_HBc_P-A Product feature CHAIN JQ707354_HBc_P-A of FT:mat_peptide JQ707354_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C22-2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707355_HBc_P-A Product feature CHAIN JQ707355_HBc_P-A of FT:mat_peptide JQ707355_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C25). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707356_HBc_P-A Product feature CHAIN JQ707356_HBc_P-A of FT:mat_peptide JQ707356_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C28). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPSRRRSQSRESQC
>gnl|hbvpro|JQ707357_HBc_P-A Product feature CHAIN JQ707357_HBc_P-A of FT:mat_peptide JQ707357_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C29-2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707358_HBc_P-A Product feature CHAIN JQ707358_HBc_P-A of FT:mat_peptide JQ707358_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C33). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707359_HBc_P-A Product feature CHAIN JQ707359_HBc_P-A of FT:mat_peptide JQ707359_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C35). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707360_HBc_P-A Product feature CHAIN JQ707360_HBc_P-A of FT:mat_peptide JQ707360_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C36). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707361_HBc_P-A Product feature CHAIN JQ707361_HBc_P-A of FT:mat_peptide JQ707361_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C37). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707362_HBc_P-A Product feature CHAIN JQ707362_HBc_P-A of FT:mat_peptide JQ707362_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C39). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707363_HBc_P-A Product feature CHAIN JQ707363_HBc_P-A of FT:mat_peptide JQ707363_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C4). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707364_HBc_P-A Product feature CHAIN JQ707364_HBc_P-A of FT:mat_peptide JQ707364_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C41). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707365_HBc_P-A Product feature CHAIN JQ707365_HBc_P-A of FT:mat_peptide JQ707365_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C43). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707366_HBc_P-A Product feature CHAIN JQ707366_HBc_P-A of FT:mat_peptide JQ707366_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C44). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707367_HBc_P-A Product feature CHAIN JQ707367_HBc_P-A of FT:mat_peptide JQ707367_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C46). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707368_HBc_P-A Product feature CHAIN JQ707368_HBc_P-A of FT:mat_peptide JQ707368_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C47). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPSKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIVSTLPETTVVRRRDRGRFPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707369_HBc_P-A Product feature CHAIN JQ707369_HBc_P-A of FT:mat_peptide JQ707369_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C48). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIHTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707370_HBc_P-A Product feature CHAIN JQ707370_HBc_P-A of FT:mat_peptide JQ707370_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C5). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707371_HBc_P-A Product feature CHAIN JQ707371_HBc_P-A of FT:mat_peptide JQ707371_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707372_HBc_P-A Product feature CHAIN JQ707372_HBc_P-A of FT:mat_peptide JQ707372_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C11). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707373_HBc_P-A Product feature CHAIN JQ707373_HBc_P-A of FT:mat_peptide JQ707373_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C14). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707374_HBc_P-A Product feature CHAIN JQ707374_HBc_P-A of FT:mat_peptide JQ707374_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C15). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707375_HBc_P-A Product feature CHAIN JQ707375_HBc_P-A of FT:mat_peptide JQ707375_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C17-2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707376_HBc_P-A Product feature CHAIN JQ707376_HBc_P-A of FT:mat_peptide JQ707376_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707377_HBc_P-A Product feature CHAIN JQ707377_HBc_P-A of FT:mat_peptide JQ707377_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C21). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707378_HBc_P-A Product feature CHAIN JQ707378_HBc_P-A of FT:mat_peptide JQ707378_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C22). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707379_HBc_P-A Product feature CHAIN JQ707379_HBc_P-A of FT:mat_peptide JQ707379_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C24-9). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707380_HBc_P-A Product feature CHAIN JQ707380_HBc_P-A of FT:mat_peptide JQ707380_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C27). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707381_HBc_P-A Product feature CHAIN JQ707381_HBc_P-A of FT:mat_peptide JQ707381_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C28). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707382_HBc_P-A Product feature CHAIN JQ707382_HBc_P-A of FT:mat_peptide JQ707382_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVDNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707383_HBc_P-A Product feature CHAIN JQ707383_HBc_P-A of FT:mat_peptide JQ707383_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C31). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707384_HBc_P-A Product feature CHAIN JQ707384_HBc_P-A of FT:mat_peptide JQ707384_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C32). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707385_HBc_P-A Product feature CHAIN JQ707385_HBc_P-A of FT:mat_peptide JQ707385_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C33). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707386_HBc_P-A Product feature CHAIN JQ707386_HBc_P-A of FT:mat_peptide JQ707386_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C34). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707387_HBc_P-A Product feature CHAIN JQ707387_HBc_P-A of FT:mat_peptide JQ707387_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C36). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPAPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707388_HBc_P-A Product feature CHAIN JQ707388_HBc_P-A of FT:mat_peptide JQ707388_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C37). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLLVNYVNGDMGLKIRQLGRFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707389_HBc_P-A Product feature CHAIN JQ707389_HBc_P-A of FT:mat_peptide JQ707389_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C38). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707390_HBc_P-A Product feature CHAIN JQ707390_HBc_P-A of FT:mat_peptide JQ707390_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C39). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707391_HBc_P-A Product feature CHAIN JQ707391_HBc_P-A of FT:mat_peptide JQ707391_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C4). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707392_HBc_P-A Product feature CHAIN JQ707392_HBc_P-A of FT:mat_peptide JQ707392_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C40). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707393_HBc_P-A Product feature CHAIN JQ707393_HBc_P-A of FT:mat_peptide JQ707393_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C42). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707394_HBc_P-A Product feature CHAIN JQ707394_HBc_P-A of FT:mat_peptide JQ707394_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C44). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707395_HBc_P-A Product feature CHAIN JQ707395_HBc_P-A of FT:mat_peptide JQ707395_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C46). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707396_HBc_P-A Product feature CHAIN JQ707396_HBc_P-A of FT:mat_peptide JQ707396_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C47). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYINTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707397_HBc_P-A Product feature CHAIN JQ707397_HBc_P-A of FT:mat_peptide JQ707397_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C48). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707398_HBc_P-A Product feature CHAIN JQ707398_HBc_P-A of FT:mat_peptide JQ707398_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C5). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707399_HBc_P-A Product feature CHAIN JQ707399_HBc_P-A of FT:mat_peptide JQ707399_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C6). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707400_HBc_P-A Product feature CHAIN JQ707400_HBc_P-A of FT:mat_peptide JQ707400_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707401_HBc_P-A Product feature CHAIN JQ707401_HBc_P-A of FT:mat_peptide JQ707401_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C10). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707402_HBc_P-A Product feature CHAIN JQ707402_HBc_P-A of FT:mat_peptide JQ707402_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C11-3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707403_HBc_P-A Product feature CHAIN JQ707403_HBc_P-A of FT:mat_peptide JQ707403_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C16). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707404_HBc_P-A Product feature CHAIN JQ707404_HBc_P-A of FT:mat_peptide JQ707404_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C17). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707405_HBc_P-A Product feature CHAIN JQ707405_HBc_P-A of FT:mat_peptide JQ707405_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C18). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707406_HBc_P-A Product feature CHAIN JQ707406_HBc_P-A of FT:mat_peptide JQ707406_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C19). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707407_HBc_P-A Product feature CHAIN JQ707407_HBc_P-A of FT:mat_peptide JQ707407_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C20-9). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707408_HBc_P-A Product feature CHAIN JQ707408_HBc_P-A of FT:mat_peptide JQ707408_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C23). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707409_HBc_P-A Product feature CHAIN JQ707409_HBc_P-A of FT:mat_peptide JQ707409_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C26-5). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707410_HBc_P-A Product feature CHAIN JQ707410_HBc_P-A of FT:mat_peptide JQ707410_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C28). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707411_HBc_P-A Product feature CHAIN JQ707411_HBc_P-A of FT:mat_peptide JQ707411_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707412_HBc_P-A Product feature CHAIN JQ707412_HBc_P-A of FT:mat_peptide JQ707412_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C32). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707413_HBc_P-A Product feature CHAIN JQ707413_HBc_P-A of FT:mat_peptide JQ707413_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C34). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707414_HBc_P-A Product feature CHAIN JQ707414_HBc_P-A of FT:mat_peptide JQ707414_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C35). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASTLYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707415_HBc_P-A Product feature CHAIN JQ707415_HBc_P-A of FT:mat_peptide JQ707415_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C40). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707416_HBc_P-A Product feature CHAIN JQ707416_HBc_P-A of FT:mat_peptide JQ707416_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C41). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707417_HBc_P-A Product feature CHAIN JQ707417_HBc_P-A of FT:mat_peptide JQ707417_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C44). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707418_HBc_P-A Product feature CHAIN JQ707418_HBc_P-A of FT:mat_peptide JQ707418_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C47). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707419_HBc_P-A Product feature CHAIN JQ707419_HBc_P-A of FT:mat_peptide JQ707419_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C48). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707420_HBc_P-A Product feature CHAIN JQ707420_HBc_P-A of FT:mat_peptide JQ707420_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C6). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707531_HBc_P-A Product feature CHAIN JQ707531_HBc_P-A of FT:mat_peptide JQ707531_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707532_HBc_P-A Product feature CHAIN JQ707532_HBc_P-A of FT:mat_peptide JQ707532_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C10). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707533_HBc_P-A Product feature CHAIN JQ707533_HBc_P-A of FT:mat_peptide JQ707533_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C11). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707534_HBc_P-A Product feature CHAIN JQ707534_HBc_P-A of FT:mat_peptide JQ707534_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C12). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707535_HBc_P-A Product feature CHAIN JQ707535_HBc_P-A of FT:mat_peptide JQ707535_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C13). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707536_HBc_P-A Product feature CHAIN JQ707536_HBc_P-A of FT:mat_peptide JQ707536_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C14). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707537_HBc_P-A Product feature CHAIN JQ707537_HBc_P-A of FT:mat_peptide JQ707537_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C15). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707538_HBc_P-A Product feature CHAIN JQ707538_HBc_P-A of FT:mat_peptide JQ707538_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C16). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707539_HBc_P-A Product feature CHAIN JQ707539_HBc_P-A of FT:mat_peptide JQ707539_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C17). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707540_HBc_P-A Product feature CHAIN JQ707540_HBc_P-A of FT:mat_peptide JQ707540_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C18). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707541_HBc_P-A Product feature CHAIN JQ707541_HBc_P-A of FT:mat_peptide JQ707541_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C19). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707542_HBc_P-A Product feature CHAIN JQ707542_HBc_P-A of FT:mat_peptide JQ707542_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C21). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707543_HBc_P-A Product feature CHAIN JQ707543_HBc_P-A of FT:mat_peptide JQ707543_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C22). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707544_HBc_P-A Product feature CHAIN JQ707544_HBc_P-A of FT:mat_peptide JQ707544_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C23). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707545_HBc_P-A Product feature CHAIN JQ707545_HBc_P-A of FT:mat_peptide JQ707545_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C24). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707546_HBc_P-A Product feature CHAIN JQ707546_HBc_P-A of FT:mat_peptide JQ707546_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C26). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707547_HBc_P-A Product feature CHAIN JQ707547_HBc_P-A of FT:mat_peptide JQ707547_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C27). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707548_HBc_P-A Product feature CHAIN JQ707548_HBc_P-A of FT:mat_peptide JQ707548_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C28). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707549_HBc_P-A Product feature CHAIN JQ707549_HBc_P-A of FT:mat_peptide JQ707549_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C29). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707550_HBc_P-A Product feature CHAIN JQ707550_HBc_P-A of FT:mat_peptide JQ707550_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707551_HBc_P-A Product feature CHAIN JQ707551_HBc_P-A of FT:mat_peptide JQ707551_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C30). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707552_HBc_P-A Product feature CHAIN JQ707552_HBc_P-A of FT:mat_peptide JQ707552_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C31). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707553_HBc_P-A Product feature CHAIN JQ707553_HBc_P-A of FT:mat_peptide JQ707553_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C32). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707554_HBc_P-A Product feature CHAIN JQ707554_HBc_P-A of FT:mat_peptide JQ707554_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C33). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707555_HBc_P-A Product feature CHAIN JQ707555_HBc_P-A of FT:mat_peptide JQ707555_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C34). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707556_HBc_P-A Product feature CHAIN JQ707556_HBc_P-A of FT:mat_peptide JQ707556_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C35). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707557_HBc_P-A Product feature CHAIN JQ707557_HBc_P-A of FT:mat_peptide JQ707557_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C36). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707558_HBc_P-A Product feature CHAIN JQ707558_HBc_P-A of FT:mat_peptide JQ707558_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C38). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707559_HBc_P-A Product feature CHAIN JQ707559_HBc_P-A of FT:mat_peptide JQ707559_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C4). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707560_HBc_P-A Product feature CHAIN JQ707560_HBc_P-A of FT:mat_peptide JQ707560_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C40). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707561_HBc_P-A Product feature CHAIN JQ707561_HBc_P-A of FT:mat_peptide JQ707561_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C41). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707562_HBc_P-A Product feature CHAIN JQ707562_HBc_P-A of FT:mat_peptide JQ707562_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C42). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707563_HBc_P-A Product feature CHAIN JQ707563_HBc_P-A of FT:mat_peptide JQ707563_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C43). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707564_HBc_P-A Product feature CHAIN JQ707564_HBc_P-A of FT:mat_peptide JQ707564_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C44). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707565_HBc_P-A Product feature CHAIN JQ707565_HBc_P-A of FT:mat_peptide JQ707565_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C45). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHSSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707566_HBc_P-A Product feature CHAIN JQ707566_HBc_P-A of FT:mat_peptide JQ707566_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C46). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707567_HBc_P-A Product feature CHAIN JQ707567_HBc_P-A of FT:mat_peptide JQ707567_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C47). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707568_HBc_P-A Product feature CHAIN JQ707568_HBc_P-A of FT:mat_peptide JQ707568_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C48). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707569_HBc_P-A Product feature CHAIN JQ707569_HBc_P-A of FT:mat_peptide JQ707569_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C5). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707570_HBc_P-A Product feature CHAIN JQ707570_HBc_P-A of FT:mat_peptide JQ707570_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C6). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707571_HBc_P-A Product feature CHAIN JQ707571_HBc_P-A of FT:mat_peptide JQ707571_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C7). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707572_HBc_P-A Product feature CHAIN JQ707572_HBc_P-A of FT:mat_peptide JQ707572_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C8). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707573_HBc_P-A Product feature CHAIN JQ707573_HBc_P-A of FT:mat_peptide JQ707573_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C9). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707574_HBc_P-A Product feature CHAIN JQ707574_HBc_P-A of FT:mat_peptide JQ707574_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C10). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707575_HBc_P-A Product feature CHAIN JQ707575_HBc_P-A of FT:mat_peptide JQ707575_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C13). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707576_HBc_P-A Product feature CHAIN JQ707576_HBc_P-A of FT:mat_peptide JQ707576_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C14). Complete genome. [Hepadnaviridae] (length=185 residues).
MNIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707577_HBc_P-A Product feature CHAIN JQ707577_HBc_P-A of FT:mat_peptide JQ707577_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C15). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707578_HBc_P-A Product feature CHAIN JQ707578_HBc_P-A of FT:mat_peptide JQ707578_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C16). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLLFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707579_HBc_P-A Product feature CHAIN JQ707579_HBc_P-A of FT:mat_peptide JQ707579_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C17). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707580_HBc_P-A Product feature CHAIN JQ707580_HBc_P-A of FT:mat_peptide JQ707580_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C18). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707581_HBc_P-A Product feature CHAIN JQ707581_HBc_P-A of FT:mat_peptide JQ707581_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C19). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707582_HBc_P-A Product feature CHAIN JQ707582_HBc_P-A of FT:mat_peptide JQ707582_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C2). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707583_HBc_P-A Product feature CHAIN JQ707583_HBc_P-A of FT:mat_peptide JQ707583_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C21). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707584_HBc_P-A Product feature CHAIN JQ707584_HBc_P-A of FT:mat_peptide JQ707584_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C22). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707585_HBc_P-A Product feature CHAIN JQ707585_HBc_P-A of FT:mat_peptide JQ707585_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C23). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707586_HBc_P-A Product feature CHAIN JQ707586_HBc_P-A of FT:mat_peptide JQ707586_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C24). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707587_HBc_P-A Product feature CHAIN JQ707587_HBc_P-A of FT:mat_peptide JQ707587_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C25). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707588_HBc_P-A Product feature CHAIN JQ707588_HBc_P-A of FT:mat_peptide JQ707588_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C26). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707589_HBc_P-A Product feature CHAIN JQ707589_HBc_P-A of FT:mat_peptide JQ707589_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C27). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707590_HBc_P-A Product feature CHAIN JQ707590_HBc_P-A of FT:mat_peptide JQ707590_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C28). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707591_HBc_P-A Product feature CHAIN JQ707591_HBc_P-A of FT:mat_peptide JQ707591_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C29). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707592_HBc_P-A Product feature CHAIN JQ707592_HBc_P-A of FT:mat_peptide JQ707592_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707593_HBc_P-A Product feature CHAIN JQ707593_HBc_P-A of FT:mat_peptide JQ707593_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C33). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLAFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707594_HBc_P-A Product feature CHAIN JQ707594_HBc_P-A of FT:mat_peptide JQ707594_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C34). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707595_HBc_P-A Product feature CHAIN JQ707595_HBc_P-A of FT:mat_peptide JQ707595_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C35). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707596_HBc_P-A Product feature CHAIN JQ707596_HBc_P-A of FT:mat_peptide JQ707596_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C36). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707597_HBc_P-A Product feature CHAIN JQ707597_HBc_P-A of FT:mat_peptide JQ707597_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C37). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707598_HBc_P-A Product feature CHAIN JQ707598_HBc_P-A of FT:mat_peptide JQ707598_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C38). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707599_HBc_P-A Product feature CHAIN JQ707599_HBc_P-A of FT:mat_peptide JQ707599_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C4). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707600_HBc_P-A Product feature CHAIN JQ707600_HBc_P-A of FT:mat_peptide JQ707600_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C40). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|JQ707601_HBc_P-A Product feature CHAIN JQ707601_HBc_P-A of FT:mat_peptide JQ707601_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C41). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707602_HBc_P-A Product feature CHAIN JQ707602_HBc_P-A of FT:mat_peptide JQ707602_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C42). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGKLMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707603_HBc_P-A Product feature CHAIN JQ707603_HBc_P-A of FT:mat_peptide JQ707603_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C43). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707604_HBc_P-A Product feature CHAIN JQ707604_HBc_P-A of FT:mat_peptide JQ707604_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C44). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707605_HBc_P-A Product feature CHAIN JQ707605_HBc_P-A of FT:mat_peptide JQ707605_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C45). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707606_HBc_P-A Product feature CHAIN JQ707606_HBc_P-A of FT:mat_peptide JQ707606_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C48). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707607_HBc_P-A Product feature CHAIN JQ707607_HBc_P-A of FT:mat_peptide JQ707607_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C8). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|JQ707608_HBc_P-A Product feature CHAIN JQ707608_HBc_P-A of FT:mat_peptide JQ707608_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C9). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707609_HBc_P-A Product feature CHAIN JQ707609_HBc_P-A of FT:mat_peptide JQ707609_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707610_HBc_P-A Product feature CHAIN JQ707610_HBc_P-A of FT:mat_peptide JQ707610_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C10). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707611_HBc_P-A Product feature CHAIN JQ707611_HBc_P-A of FT:mat_peptide JQ707611_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C11). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707612_HBc_P-A Product feature CHAIN JQ707612_HBc_P-A of FT:mat_peptide JQ707612_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C13). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707613_HBc_P-A Product feature CHAIN JQ707613_HBc_P-A of FT:mat_peptide JQ707613_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C15). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707614_HBc_P-A Product feature CHAIN JQ707614_HBc_P-A of FT:mat_peptide JQ707614_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C17). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707615_HBc_P-A Product feature CHAIN JQ707615_HBc_P-A of FT:mat_peptide JQ707615_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C18). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707616_HBc_P-A Product feature CHAIN JQ707616_HBc_P-A of FT:mat_peptide JQ707616_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707617_HBc_P-A Product feature CHAIN JQ707617_HBc_P-A of FT:mat_peptide JQ707617_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C21). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707618_HBc_P-A Product feature CHAIN JQ707618_HBc_P-A of FT:mat_peptide JQ707618_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C22). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707619_HBc_P-A Product feature CHAIN JQ707619_HBc_P-A of FT:mat_peptide JQ707619_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C23). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707620_HBc_P-A Product feature CHAIN JQ707620_HBc_P-A of FT:mat_peptide JQ707620_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C24). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707621_HBc_P-A Product feature CHAIN JQ707621_HBc_P-A of FT:mat_peptide JQ707621_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C26). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707622_HBc_P-A Product feature CHAIN JQ707622_HBc_P-A of FT:mat_peptide JQ707622_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C27). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707623_HBc_P-A Product feature CHAIN JQ707623_HBc_P-A of FT:mat_peptide JQ707623_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C28). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALEFPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707624_HBc_P-A Product feature CHAIN JQ707624_HBc_P-A of FT:mat_peptide JQ707624_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707625_HBc_P-A Product feature CHAIN JQ707625_HBc_P-A of FT:mat_peptide JQ707625_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C30). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707626_HBc_P-A Product feature CHAIN JQ707626_HBc_P-A of FT:mat_peptide JQ707626_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C31). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707627_HBc_P-A Product feature CHAIN JQ707627_HBc_P-A of FT:mat_peptide JQ707627_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C32). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707628_HBc_P-A Product feature CHAIN JQ707628_HBc_P-A of FT:mat_peptide JQ707628_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C33). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707629_HBc_P-A Product feature CHAIN JQ707629_HBc_P-A of FT:mat_peptide JQ707629_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C34). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707630_HBc_P-A Product feature CHAIN JQ707630_HBc_P-A of FT:mat_peptide JQ707630_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C35). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707631_HBc_P-A Product feature CHAIN JQ707631_HBc_P-A of FT:mat_peptide JQ707631_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C36-6). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707632_HBc_P-A Product feature CHAIN JQ707632_HBc_P-A of FT:mat_peptide JQ707632_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C4). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707633_HBc_P-A Product feature CHAIN JQ707633_HBc_P-A of FT:mat_peptide JQ707633_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C41). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707634_HBc_P-A Product feature CHAIN JQ707634_HBc_P-A of FT:mat_peptide JQ707634_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C42). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRELVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707635_HBc_P-A Product feature CHAIN JQ707635_HBc_P-A of FT:mat_peptide JQ707635_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C45). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707636_HBc_P-A Product feature CHAIN JQ707636_HBc_P-A of FT:mat_peptide JQ707636_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C46). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707637_HBc_P-A Product feature CHAIN JQ707637_HBc_P-A of FT:mat_peptide JQ707637_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C5-5). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707638_HBc_P-A Product feature CHAIN JQ707638_HBc_P-A of FT:mat_peptide JQ707638_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C12). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707639_HBc_P-A Product feature CHAIN JQ707639_HBc_P-A of FT:mat_peptide JQ707639_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C13-9). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707640_HBc_P-A Product feature CHAIN JQ707640_HBc_P-A of FT:mat_peptide JQ707640_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C14). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707641_HBc_P-A Product feature CHAIN JQ707641_HBc_P-A of FT:mat_peptide JQ707641_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C17). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707642_HBc_P-A Product feature CHAIN JQ707642_HBc_P-A of FT:mat_peptide JQ707642_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707643_HBc_P-A Product feature CHAIN JQ707643_HBc_P-A of FT:mat_peptide JQ707643_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C20-7). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707644_HBc_P-A Product feature CHAIN JQ707644_HBc_P-A of FT:mat_peptide JQ707644_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C22). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707645_HBc_P-A Product feature CHAIN JQ707645_HBc_P-A of FT:mat_peptide JQ707645_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C24). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707646_HBc_P-A Product feature CHAIN JQ707646_HBc_P-A of FT:mat_peptide JQ707646_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C26). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707647_HBc_P-A Product feature CHAIN JQ707647_HBc_P-A of FT:mat_peptide JQ707647_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C27). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707648_HBc_P-A Product feature CHAIN JQ707648_HBc_P-A of FT:mat_peptide JQ707648_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C28). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707649_HBc_P-A Product feature CHAIN JQ707649_HBc_P-A of FT:mat_peptide JQ707649_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707650_HBc_P-A Product feature CHAIN JQ707650_HBc_P-A of FT:mat_peptide JQ707650_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C30). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707651_HBc_P-A Product feature CHAIN JQ707651_HBc_P-A of FT:mat_peptide JQ707651_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C33). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707652_HBc_P-A Product feature CHAIN JQ707652_HBc_P-A of FT:mat_peptide JQ707652_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C34). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707653_HBc_P-A Product feature CHAIN JQ707653_HBc_P-A of FT:mat_peptide JQ707653_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C38). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707654_HBc_P-A Product feature CHAIN JQ707654_HBc_P-A of FT:mat_peptide JQ707654_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C40). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707655_HBc_P-A Product feature CHAIN JQ707655_HBc_P-A of FT:mat_peptide JQ707655_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C41). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRELLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707656_HBc_P-A Product feature CHAIN JQ707656_HBc_P-A of FT:mat_peptide JQ707656_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C43). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707658_HBc_P-A Product feature CHAIN JQ707658_HBc_P-A of FT:mat_peptide JQ707658_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_13). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707659_HBc_P-A Product feature CHAIN JQ707659_HBc_P-A of FT:mat_peptide JQ707659_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_14). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707661_HBc_P-A Product feature CHAIN JQ707661_HBc_P-A of FT:mat_peptide JQ707661_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_18). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707662_HBc_P-A Product feature CHAIN JQ707662_HBc_P-A of FT:mat_peptide JQ707662_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_19). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707663_HBc_P-A Product feature CHAIN JQ707663_HBc_P-A of FT:mat_peptide JQ707663_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707664_HBc_P-A Product feature CHAIN JQ707664_HBc_P-A of FT:mat_peptide JQ707664_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_20). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707665_HBc_P-A Product feature CHAIN JQ707665_HBc_P-A of FT:mat_peptide JQ707665_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_21). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707667_HBc_P-A Product feature CHAIN JQ707667_HBc_P-A of FT:mat_peptide JQ707667_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_25). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707669_HBc_P-A Product feature CHAIN JQ707669_HBc_P-A of FT:mat_peptide JQ707669_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_28). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707670_HBc_P-A Product feature CHAIN JQ707670_HBc_P-A of FT:mat_peptide JQ707670_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_29). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707672_HBc_P-A Product feature CHAIN JQ707672_HBc_P-A of FT:mat_peptide JQ707672_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_32). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707674_HBc_P-A Product feature CHAIN JQ707674_HBc_P-A of FT:mat_peptide JQ707674_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_38). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707675_HBc_P-A Product feature CHAIN JQ707675_HBc_P-A of FT:mat_peptide JQ707675_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_41). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707676_HBc_P-A Product feature CHAIN JQ707676_HBc_P-A of FT:mat_peptide JQ707676_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_42). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JQ707681_HBc_P-A Product feature CHAIN JQ707681_HBc_P-A of FT:mat_peptide JQ707681_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_9-12). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX096952_HBc_P-A Product feature CHAIN JX096952_HBc_P-A of FT:mat_peptide JX096952_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11-10165). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX096953_HBc_P-A Product feature CHAIN JX096953_HBc_P-A of FT:mat_peptide JX096953_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 12-8957). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELPSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX154579_HBc_P-A Product feature CHAIN JX154579_HBc_P-A of FT:mat_peptide JX154579_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS36). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGTWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRKSQC
>gnl|hbvpro|JX154580_HBc_P-A Product feature CHAIN JX154580_HBc_P-A of FT:mat_peptide JX154580_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS46). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGTWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX154581_HBc_P-A Product feature CHAIN JX154581_HBc_P-A of FT:mat_peptide JX154581_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS51). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGTWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX154582_HBc_P-A Product feature CHAIN JX154582_HBc_P-A of FT:mat_peptide JX154582_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS64). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGTWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX310721_HBc_P-A Product feature CHAIN JX310721_HBc_P-A of FT:mat_peptide JX310721_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX310722_HBc_P-A Product feature CHAIN JX310722_HBc_P-A of FT:mat_peptide JX310722_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX310723_HBc_P-A Product feature CHAIN JX310723_HBc_P-A of FT:mat_peptide JX310723_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D5). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX310724_HBc_P-A Product feature CHAIN JX310724_HBc_P-A of FT:mat_peptide JX310724_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|JX310725_HBc_P-A Product feature CHAIN JX310725_HBc_P-A of FT:mat_peptide JX310725_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836831_HBc_P-A Product feature CHAIN KC836831_HBc_P-A of FT:mat_peptide KC836831_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836832_HBc_P-A Product feature CHAIN KC836832_HBc_P-A of FT:mat_peptide KC836832_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836834_HBc_P-A Product feature CHAIN KC836834_HBc_P-A of FT:mat_peptide KC836834_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH5). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836846_HBc_P-A Product feature CHAIN KC836846_HBc_P-A of FT:mat_peptide KC836846_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836849_HBc_P-A Product feature CHAIN KC836849_HBc_P-A of FT:mat_peptide KC836849_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836854_HBc_P-A Product feature CHAIN KC836854_HBc_P-A of FT:mat_peptide KC836854_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC836858_HBc_P-A Product feature CHAIN KC836858_HBc_P-A of FT:mat_peptide KC836858_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH38). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875251_HBc_P-A Product feature CHAIN KC875251_HBc_P-A of FT:mat_peptide KC875251_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV1). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALGSPEHCSPHHPALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875252_HBc_P-A Product feature CHAIN KC875252_HBc_P-A of FT:mat_peptide KC875252_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV3). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIHCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875253_HBc_P-A Product feature CHAIN KC875253_HBc_P-A of FT:mat_peptide KC875253_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV23). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDVDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875254_HBc_P-A Product feature CHAIN KC875254_HBc_P-A of FT:mat_peptide KC875254_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV12). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875255_HBc_P-A Product feature CHAIN KC875255_HBc_P-A of FT:mat_peptide KC875255_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV24). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVPFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875256_HBc_P-A Product feature CHAIN KC875256_HBc_P-A of FT:mat_peptide KC875256_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV27). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCAPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875257_HBc_P-A Product feature CHAIN KC875257_HBc_P-A of FT:mat_peptide KC875257_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV14). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWAGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875258_HBc_P-A Product feature CHAIN KC875258_HBc_P-A of FT:mat_peptide KC875258_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV66). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875259_HBc_P-A Product feature CHAIN KC875259_HBc_P-A of FT:mat_peptide KC875259_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV73). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYQEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KC875260_HBc_P-A Product feature CHAIN KC875260_HBc_P-A of FT:mat_peptide KC875260_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV5). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214657_HBc_P-A Product feature CHAIN KF214657_HBc_P-A of FT:mat_peptide KF214657_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214658_HBc_P-A Product feature CHAIN KF214658_HBc_P-A of FT:mat_peptide KF214658_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2009-6). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214659_HBc_P-A Product feature CHAIN KF214659_HBc_P-A of FT:mat_peptide KF214659_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2009-2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214660_HBc_P-A Product feature CHAIN KF214660_HBc_P-A of FT:mat_peptide KF214660_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-9). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLQDTASALYREALESPEHCSHHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214661_HBc_P-A Product feature CHAIN KF214661_HBc_P-A of FT:mat_peptide KF214661_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-8). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRRAVLCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214662_HBc_P-A Product feature CHAIN KF214662_HBc_P-A of FT:mat_peptide KF214662_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-14). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214663_HBc_P-A Product feature CHAIN KF214663_HBc_P-A of FT:mat_peptide KF214663_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2007-11). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214665_HBc_P-A Product feature CHAIN KF214665_HBc_P-A of FT:mat_peptide KF214665_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF214666_HBc_P-A Product feature CHAIN KF214666_HBc_P-A of FT:mat_peptide KF214666_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2010-7). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELTTLAGWVGHNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KF779213_HBc_P-A Product feature CHAIN KF779213_HBc_P-A of FT:mat_peptide KF779213_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5744). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVDRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSPPPQSQC
>gnl|hbvpro|KF779215_HBc_P-A Product feature CHAIN KF779215_HBc_P-A of FT:mat_peptide KF779215_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5763). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVDRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSPPPQSQC
>gnl|hbvpro|KF779227_HBc_P-A Product feature CHAIN KF779227_HBc_P-A of FT:mat_peptide KF779227_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6061). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779231_HBc_P-A Product feature CHAIN KF779231_HBc_P-A of FT:mat_peptide KF779231_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6084). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779232_HBc_P-A Product feature CHAIN KF779232_HBc_P-A of FT:mat_peptide KF779232_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6088). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779234_HBc_P-A Product feature CHAIN KF779234_HBc_P-A of FT:mat_peptide KF779234_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6104). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779238_HBc_P-A Product feature CHAIN KF779238_HBc_P-A of FT:mat_peptide KF779238_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6119). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779239_HBc_P-A Product feature CHAIN KF779239_HBc_P-A of FT:mat_peptide KF779239_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6120). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRIRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779240_HBc_P-A Product feature CHAIN KF779240_HBc_P-A of FT:mat_peptide KF779240_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6123). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779243_HBc_P-A Product feature CHAIN KF779243_HBc_P-A of FT:mat_peptide KF779243_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6142). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779244_HBc_P-A Product feature CHAIN KF779244_HBc_P-A of FT:mat_peptide KF779244_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6152). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779245_HBc_P-A Product feature CHAIN KF779245_HBc_P-A of FT:mat_peptide KF779245_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6156). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779246_HBc_P-A Product feature CHAIN KF779246_HBc_P-A of FT:mat_peptide KF779246_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6163). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779247_HBc_P-A Product feature CHAIN KF779247_HBc_P-A of FT:mat_peptide KF779247_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6164). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779248_HBc_P-A Product feature CHAIN KF779248_HBc_P-A of FT:mat_peptide KF779248_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6168). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779249_HBc_P-A Product feature CHAIN KF779249_HBc_P-A of FT:mat_peptide KF779249_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6173). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSKSPRRRRSQSRESQC
>gnl|hbvpro|KF779251_HBc_P-A Product feature CHAIN KF779251_HBc_P-A of FT:mat_peptide KF779251_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3787). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779252_HBc_P-A Product feature CHAIN KF779252_HBc_P-A of FT:mat_peptide KF779252_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3809). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779253_HBc_P-A Product feature CHAIN KF779253_HBc_P-A of FT:mat_peptide KF779253_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3817). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779254_HBc_P-A Product feature CHAIN KF779254_HBc_P-A of FT:mat_peptide KF779254_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3820). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPFVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779255_HBc_P-A Product feature CHAIN KF779255_HBc_P-A of FT:mat_peptide KF779255_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3825). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779256_HBc_P-A Product feature CHAIN KF779256_HBc_P-A of FT:mat_peptide KF779256_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3829). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779257_HBc_P-A Product feature CHAIN KF779257_HBc_P-A of FT:mat_peptide KF779257_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3857). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779258_HBc_P-A Product feature CHAIN KF779258_HBc_P-A of FT:mat_peptide KF779258_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3864). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779259_HBc_P-A Product feature CHAIN KF779259_HBc_P-A of FT:mat_peptide KF779259_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3892). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779260_HBc_P-A Product feature CHAIN KF779260_HBc_P-A of FT:mat_peptide KF779260_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3894). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLNIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779261_HBc_P-A Product feature CHAIN KF779261_HBc_P-A of FT:mat_peptide KF779261_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3896). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779262_HBc_P-A Product feature CHAIN KF779262_HBc_P-A of FT:mat_peptide KF779262_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3898). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779263_HBc_P-A Product feature CHAIN KF779263_HBc_P-A of FT:mat_peptide KF779263_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3903). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779264_HBc_P-A Product feature CHAIN KF779264_HBc_P-A of FT:mat_peptide KF779264_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3945). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779265_HBc_P-A Product feature CHAIN KF779265_HBc_P-A of FT:mat_peptide KF779265_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3946). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRLSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779266_HBc_P-A Product feature CHAIN KF779266_HBc_P-A of FT:mat_peptide KF779266_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3949). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779268_HBc_P-A Product feature CHAIN KF779268_HBc_P-A of FT:mat_peptide KF779268_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3966). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRISQSPRRRRSQSRESQC
>gnl|hbvpro|KF779269_HBc_P-A Product feature CHAIN KF779269_HBc_P-A of FT:mat_peptide KF779269_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4207). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779270_HBc_P-A Product feature CHAIN KF779270_HBc_P-A of FT:mat_peptide KF779270_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4219). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779271_HBc_P-A Product feature CHAIN KF779271_HBc_P-A of FT:mat_peptide KF779271_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4233). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779272_HBc_P-A Product feature CHAIN KF779272_HBc_P-A of FT:mat_peptide KF779272_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4236). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLVDTASALHREALESPEHCSPHHTALRQAIVCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779273_HBc_P-A Product feature CHAIN KF779273_HBc_P-A of FT:mat_peptide KF779273_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4237). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779274_HBc_P-A Product feature CHAIN KF779274_HBc_P-A of FT:mat_peptide KF779274_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4259). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779275_HBc_P-A Product feature CHAIN KF779275_HBc_P-A of FT:mat_peptide KF779275_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4283). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779276_HBc_P-A Product feature CHAIN KF779276_HBc_P-A of FT:mat_peptide KF779276_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4314). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779277_HBc_P-A Product feature CHAIN KF779277_HBc_P-A of FT:mat_peptide KF779277_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4322). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779279_HBc_P-A Product feature CHAIN KF779279_HBc_P-A of FT:mat_peptide KF779279_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4359). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779281_HBc_P-A Product feature CHAIN KF779281_HBc_P-A of FT:mat_peptide KF779281_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4390). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779282_HBc_P-A Product feature CHAIN KF779282_HBc_P-A of FT:mat_peptide KF779282_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4392). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779283_HBc_P-A Product feature CHAIN KF779283_HBc_P-A of FT:mat_peptide KF779283_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4394). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIGQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779284_HBc_P-A Product feature CHAIN KF779284_HBc_P-A of FT:mat_peptide KF779284_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0574). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRSLPYQSPRRRRSQSRESQC
>gnl|hbvpro|KF779286_HBc_P-A Product feature CHAIN KF779286_HBc_P-A of FT:mat_peptide KF779286_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0606). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779290_HBc_P-A Product feature CHAIN KF779290_HBc_P-A of FT:mat_peptide KF779290_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0756). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779291_HBc_P-A Product feature CHAIN KF779291_HBc_P-A of FT:mat_peptide KF779291_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0765). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779293_HBc_P-A Product feature CHAIN KF779293_HBc_P-A of FT:mat_peptide KF779293_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0787). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSARRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779294_HBc_P-A Product feature CHAIN KF779294_HBc_P-A of FT:mat_peptide KF779294_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0796). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSARRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779295_HBc_P-A Product feature CHAIN KF779295_HBc_P-A of FT:mat_peptide KF779295_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0854). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779297_HBc_P-A Product feature CHAIN KF779297_HBc_P-A of FT:mat_peptide KF779297_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0874). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSLSPRRRRSQSRESQC
>gnl|hbvpro|KF779298_HBc_P-A Product feature CHAIN KF779298_HBc_P-A of FT:mat_peptide KF779298_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0908). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSARRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779299_HBc_P-A Product feature CHAIN KF779299_HBc_P-A of FT:mat_peptide KF779299_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0943). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779304_HBc_P-A Product feature CHAIN KF779304_HBc_P-A of FT:mat_peptide KF779304_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1039). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779305_HBc_P-A Product feature CHAIN KF779305_HBc_P-A of FT:mat_peptide KF779305_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1043). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779306_HBc_P-A Product feature CHAIN KF779306_HBc_P-A of FT:mat_peptide KF779306_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1093). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779307_HBc_P-A Product feature CHAIN KF779307_HBc_P-A of FT:mat_peptide KF779307_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1227). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779308_HBc_P-A Product feature CHAIN KF779308_HBc_P-A of FT:mat_peptide KF779308_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1293). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779309_HBc_P-A Product feature CHAIN KF779309_HBc_P-A of FT:mat_peptide KF779309_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1294). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779310_HBc_P-A Product feature CHAIN KF779310_HBc_P-A of FT:mat_peptide KF779310_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3845). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779311_HBc_P-A Product feature CHAIN KF779311_HBc_P-A of FT:mat_peptide KF779311_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3863). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779312_HBc_P-A Product feature CHAIN KF779312_HBc_P-A of FT:mat_peptide KF779312_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3907). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779313_HBc_P-A Product feature CHAIN KF779313_HBc_P-A of FT:mat_peptide KF779313_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3958). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=186 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQCK
>gnl|hbvpro|KF779314_HBc_P-A Product feature CHAIN KF779314_HBc_P-A of FT:mat_peptide KF779314_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3985). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779315_HBc_P-A Product feature CHAIN KF779315_HBc_P-A of FT:mat_peptide KF779315_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4204). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779316_HBc_P-A Product feature CHAIN KF779316_HBc_P-A of FT:mat_peptide KF779316_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4247). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779317_HBc_P-A Product feature CHAIN KF779317_HBc_P-A of FT:mat_peptide KF779317_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4308). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779319_HBc_P-A Product feature CHAIN KF779319_HBc_P-A of FT:mat_peptide KF779319_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4323). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779320_HBc_P-A Product feature CHAIN KF779320_HBc_P-A of FT:mat_peptide KF779320_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4350). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779321_HBc_P-A Product feature CHAIN KF779321_HBc_P-A of FT:mat_peptide KF779321_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4362). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779322_HBc_P-A Product feature CHAIN KF779322_HBc_P-A of FT:mat_peptide KF779322_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4406). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779323_HBc_P-A Product feature CHAIN KF779323_HBc_P-A of FT:mat_peptide KF779323_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4414). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779324_HBc_P-A Product feature CHAIN KF779324_HBc_P-A of FT:mat_peptide KF779324_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4416). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779325_HBc_P-A Product feature CHAIN KF779325_HBc_P-A of FT:mat_peptide KF779325_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4422). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779326_HBc_P-A Product feature CHAIN KF779326_HBc_P-A of FT:mat_peptide KF779326_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4424). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779328_HBc_P-A Product feature CHAIN KF779328_HBc_P-A of FT:mat_peptide KF779328_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4532). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779329_HBc_P-A Product feature CHAIN KF779329_HBc_P-A of FT:mat_peptide KF779329_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4540). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRPRRSQSRESQC
>gnl|hbvpro|KF779330_HBc_P-A Product feature CHAIN KF779330_HBc_P-A of FT:mat_peptide KF779330_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4541). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779331_HBc_P-A Product feature CHAIN KF779331_HBc_P-A of FT:mat_peptide KF779331_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4543). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779332_HBc_P-A Product feature CHAIN KF779332_HBc_P-A of FT:mat_peptide KF779332_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4549). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779333_HBc_P-A Product feature CHAIN KF779333_HBc_P-A of FT:mat_peptide KF779333_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4661). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779334_HBc_P-A Product feature CHAIN KF779334_HBc_P-A of FT:mat_peptide KF779334_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4673). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRSSLSPSRRRSQSRESQC
>gnl|hbvpro|KF779335_HBc_P-A Product feature CHAIN KF779335_HBc_P-A of FT:mat_peptide KF779335_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4687). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779336_HBc_P-A Product feature CHAIN KF779336_HBc_P-A of FT:mat_peptide KF779336_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4730). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779337_HBc_P-A Product feature CHAIN KF779337_HBc_P-A of FT:mat_peptide KF779337_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4733). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779338_HBc_P-A Product feature CHAIN KF779338_HBc_P-A of FT:mat_peptide KF779338_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4756). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779339_HBc_P-A Product feature CHAIN KF779339_HBc_P-A of FT:mat_peptide KF779339_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4804). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779342_HBc_P-A Product feature CHAIN KF779342_HBc_P-A of FT:mat_peptide KF779342_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4865). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGLWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779344_HBc_P-A Product feature CHAIN KF779344_HBc_P-A of FT:mat_peptide KF779344_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4928). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779345_HBc_P-A Product feature CHAIN KF779345_HBc_P-A of FT:mat_peptide KF779345_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4936). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779346_HBc_P-A Product feature CHAIN KF779346_HBc_P-A of FT:mat_peptide KF779346_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4938). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779347_HBc_P-A Product feature CHAIN KF779347_HBc_P-A of FT:mat_peptide KF779347_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4950). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779348_HBc_P-A Product feature CHAIN KF779348_HBc_P-A of FT:mat_peptide KF779348_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4951). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779349_HBc_P-A Product feature CHAIN KF779349_HBc_P-A of FT:mat_peptide KF779349_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4999). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779350_HBc_P-A Product feature CHAIN KF779350_HBc_P-A of FT:mat_peptide KF779350_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5005). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779351_HBc_P-A Product feature CHAIN KF779351_HBc_P-A of FT:mat_peptide KF779351_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5017). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779352_HBc_P-A Product feature CHAIN KF779352_HBc_P-A of FT:mat_peptide KF779352_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5034). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779354_HBc_P-A Product feature CHAIN KF779354_HBc_P-A of FT:mat_peptide KF779354_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5084). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779355_HBc_P-A Product feature CHAIN KF779355_HBc_P-A of FT:mat_peptide KF779355_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5121). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779356_HBc_P-A Product feature CHAIN KF779356_HBc_P-A of FT:mat_peptide KF779356_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5185). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779358_HBc_P-A Product feature CHAIN KF779358_HBc_P-A of FT:mat_peptide KF779358_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5263). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779359_HBc_P-A Product feature CHAIN KF779359_HBc_P-A of FT:mat_peptide KF779359_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5268). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779360_HBc_P-A Product feature CHAIN KF779360_HBc_P-A of FT:mat_peptide KF779360_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5279). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779361_HBc_P-A Product feature CHAIN KF779361_HBc_P-A of FT:mat_peptide KF779361_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5291). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNFEDPA
SRDLVVNYVNTNMGLKIRQLSRFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779362_HBc_P-A Product feature CHAIN KF779362_HBc_P-A of FT:mat_peptide KF779362_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5296). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779363_HBc_P-A Product feature CHAIN KF779363_HBc_P-A of FT:mat_peptide KF779363_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5350). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779364_HBc_P-A Product feature CHAIN KF779364_HBc_P-A of FT:mat_peptide KF779364_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5374). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779365_HBc_P-A Product feature CHAIN KF779365_HBc_P-A of FT:mat_peptide KF779365_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5380). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779366_HBc_P-A Product feature CHAIN KF779366_HBc_P-A of FT:mat_peptide KF779366_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5383). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779367_HBc_P-A Product feature CHAIN KF779367_HBc_P-A of FT:mat_peptide KF779367_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5403). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779368_HBc_P-A Product feature CHAIN KF779368_HBc_P-A of FT:mat_peptide KF779368_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5421). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779369_HBc_P-A Product feature CHAIN KF779369_HBc_P-A of FT:mat_peptide KF779369_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5521). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779370_HBc_P-A Product feature CHAIN KF779370_HBc_P-A of FT:mat_peptide KF779370_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5594). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779371_HBc_P-A Product feature CHAIN KF779371_HBc_P-A of FT:mat_peptide KF779371_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5608). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLRFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779372_HBc_P-A Product feature CHAIN KF779372_HBc_P-A of FT:mat_peptide KF779372_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5654). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779373_HBc_P-A Product feature CHAIN KF779373_HBc_P-A of FT:mat_peptide KF779373_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5680). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779374_HBc_P-A Product feature CHAIN KF779374_HBc_P-A of FT:mat_peptide KF779374_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5743). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779375_HBc_P-A Product feature CHAIN KF779375_HBc_P-A of FT:mat_peptide KF779375_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5760). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779378_HBc_P-A Product feature CHAIN KF779378_HBc_P-A of FT:mat_peptide KF779378_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6064). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779379_HBc_P-A Product feature CHAIN KF779379_HBc_P-A of FT:mat_peptide KF779379_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6136). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779381_HBc_P-A Product feature CHAIN KF779381_HBc_P-A of FT:mat_peptide KF779381_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6268). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779383_HBc_P-A Product feature CHAIN KF779383_HBc_P-A of FT:mat_peptide KF779383_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6296). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779384_HBc_P-A Product feature CHAIN KF779384_HBc_P-A of FT:mat_peptide KF779384_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0061). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779385_HBc_P-A Product feature CHAIN KF779385_HBc_P-A of FT:mat_peptide KF779385_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0098). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF779386_HBc_P-A Product feature CHAIN KF779386_HBc_P-A of FT:mat_peptide KF779386_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0138). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798265_HBc_P-A Product feature CHAIN KF798265_HBc_P-A of FT:mat_peptide KF798265_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798266_HBc_P-A Product feature CHAIN KF798266_HBc_P-A of FT:mat_peptide KF798266_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KF798267_HBc_P-A Product feature CHAIN KF798267_HBc_P-A of FT:mat_peptide KF798267_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-09). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798271_HBc_P-A Product feature CHAIN KF798271_HBc_P-A of FT:mat_peptide KF798271_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798278_HBc_P-A Product feature CHAIN KF798278_HBc_P-A of FT:mat_peptide KF798278_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798279_HBc_P-A Product feature CHAIN KF798279_HBc_P-A of FT:mat_peptide KF798279_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798285_HBc_P-A Product feature CHAIN KF798285_HBc_P-A of FT:mat_peptide KF798285_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-27). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798286_HBc_P-A Product feature CHAIN KF798286_HBc_P-A of FT:mat_peptide KF798286_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-28). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798289_HBc_P-A Product feature CHAIN KF798289_HBc_P-A of FT:mat_peptide KF798289_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798290_HBc_P-A Product feature CHAIN KF798290_HBc_P-A of FT:mat_peptide KF798290_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798291_HBc_P-A Product feature CHAIN KF798291_HBc_P-A of FT:mat_peptide KF798291_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798292_HBc_P-A Product feature CHAIN KF798292_HBc_P-A of FT:mat_peptide KF798292_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798302_HBc_P-A Product feature CHAIN KF798302_HBc_P-A of FT:mat_peptide KF798302_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-44). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798308_HBc_P-A Product feature CHAIN KF798308_HBc_P-A of FT:mat_peptide KF798308_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-50). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798309_HBc_P-A Product feature CHAIN KF798309_HBc_P-A of FT:mat_peptide KF798309_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-51). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798310_HBc_P-A Product feature CHAIN KF798310_HBc_P-A of FT:mat_peptide KF798310_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-52). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798311_HBc_P-A Product feature CHAIN KF798311_HBc_P-A of FT:mat_peptide KF798311_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF798314_HBc_P-A Product feature CHAIN KF798314_HBc_P-A of FT:mat_peptide KF798314_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-56). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922406_HBc_P-A Product feature CHAIN KF922406_HBc_P-A of FT:mat_peptide KF922406_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922407_HBc_P-A Product feature CHAIN KF922407_HBc_P-A of FT:mat_peptide KF922407_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922408_HBc_P-A Product feature CHAIN KF922408_HBc_P-A of FT:mat_peptide KF922408_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCPTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922409_HBc_P-A Product feature CHAIN KF922409_HBc_P-A of FT:mat_peptide KF922409_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v4). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRGRSQSRESQC
>gnl|hbvpro|KF922414_HBc_P-A Product feature CHAIN KF922414_HBc_P-A of FT:mat_peptide KF922414_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLATWVGTNLEDPA
SRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVRRRGRDRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922415_HBc_P-A Product feature CHAIN KF922415_HBc_P-A of FT:mat_peptide KF922415_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLATWVGTNLEDPA
SRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVRRRGRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922416_HBc_P-A Product feature CHAIN KF922416_HBc_P-A of FT:mat_peptide KF922416_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLATWVGTNLEDPA
SRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVRRRGRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922418_HBc_P-A Product feature CHAIN KF922418_HBc_P-A of FT:mat_peptide KF922418_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v5). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLATWVGTNLEDPA
SRDQVVNYVNINMGIKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVRRRGRGRSPGR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922419_HBc_P-A Product feature CHAIN KF922419_HBc_P-A of FT:mat_peptide KF922419_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v6). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLATWVGTNLEDPA
SRDQVVNYVNINMGIKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVRRRGRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922420_HBc_P-A Product feature CHAIN KF922420_HBc_P-A of FT:mat_peptide KF922420_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v7). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLATWVGTNLEDPA
SRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVRRRGRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922421_HBc_P-A Product feature CHAIN KF922421_HBc_P-A of FT:mat_peptide KF922421_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v8). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLATWVGTNLEDPA
SRDQVVNYVNINMGIKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYGPPNAPILSSLPETTVVRRRGRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922424_HBc_P-A Product feature CHAIN KF922424_HBc_P-A of FT:mat_peptide KF922424_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070v1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922425_HBc_P-A Product feature CHAIN KF922425_HBc_P-A of FT:mat_peptide KF922425_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070v2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922426_HBc_P-A Product feature CHAIN KF922426_HBc_P-A of FT:mat_peptide KF922426_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922427_HBc_P-A Product feature CHAIN KF922427_HBc_P-A of FT:mat_peptide KF922427_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922428_HBc_P-A Product feature CHAIN KF922428_HBc_P-A of FT:mat_peptide KF922428_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922429_HBc_P-A Product feature CHAIN KF922429_HBc_P-A of FT:mat_peptide KF922429_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTAIRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922430_HBc_P-A Product feature CHAIN KF922430_HBc_P-A of FT:mat_peptide KF922430_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTAIRQAILCWGELMIFATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922431_HBc_P-A Product feature CHAIN KF922431_HBc_P-A of FT:mat_peptide KF922431_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v3). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTAIRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRGRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922433_HBc_P-A Product feature CHAIN KF922433_HBc_P-A of FT:mat_peptide KF922433_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3658v1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGSTVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922434_HBc_P-A Product feature CHAIN KF922434_HBc_P-A of FT:mat_peptide KF922434_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3658v2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGSTVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KF922435_HBc_P-A Product feature CHAIN KF922435_HBc_P-A of FT:mat_peptide KF922435_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGSTVELLSFLPSDFFPSVRDLLDTASALYREALESQEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSILPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KF922436_HBc_P-A Product feature CHAIN KF922436_HBc_P-A of FT:mat_peptide KF922436_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGSTVELLSFLPSDFFPSVRDLLDTASALYREALESLEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSILPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KF922437_HBc_P-A Product feature CHAIN KF922437_HBc_P-A of FT:mat_peptide KF922437_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N060v3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGSTVELLSFLPSDFFPSVRDLLDTASALYREGLESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSILPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KJ010776_HBc_P-A Product feature CHAIN KJ010776_HBc_P-A of FT:mat_peptide KJ010776_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ010777_HBc_P-A Product feature CHAIN KJ010777_HBc_P-A of FT:mat_peptide KJ010777_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ010778_HBc_P-A Product feature CHAIN KJ010778_HBc_P-A of FT:mat_peptide KJ010778_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ586809_HBc_P-A Product feature CHAIN KJ586809_HBc_P-A of FT:mat_peptide KJ586809_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVKDLLNTASALYREALESPEHCSPHHTALRQAILCWGELMTLSTWVGNNLEDPA
SRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843166_HBc_P-A Product feature CHAIN KJ843166_HBc_P-A of FT:mat_peptide KJ843166_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag04). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843172_HBc_P-A Product feature CHAIN KJ843172_HBc_P-A of FT:mat_peptide KJ843172_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag10). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLASWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEITVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843173_HBc_P-A Product feature CHAIN KJ843173_HBc_P-A of FT:mat_peptide KJ843173_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag11). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843182_HBc_P-A Product feature CHAIN KJ843182_HBc_P-A of FT:mat_peptide KJ843182_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag21). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843183_HBc_P-A Product feature CHAIN KJ843183_HBc_P-A of FT:mat_peptide KJ843183_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag22). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843184_HBc_P-A Product feature CHAIN KJ843184_HBc_P-A of FT:mat_peptide KJ843184_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag23). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIXTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843186_HBc_P-A Product feature CHAIN KJ843186_HBc_P-A of FT:mat_peptide KJ843186_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag25). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843188_HBc_P-A Product feature CHAIN KJ843188_HBc_P-A of FT:mat_peptide KJ843188_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag27). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843192_HBc_P-A Product feature CHAIN KJ843192_HBc_P-A of FT:mat_peptide KJ843192_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag31). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843214_HBc_P-A Product feature CHAIN KJ843214_HBc_P-A of FT:mat_peptide KJ843214_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag55). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843215_HBc_P-A Product feature CHAIN KJ843215_HBc_P-A of FT:mat_peptide KJ843215_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag56). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843216_HBc_P-A Product feature CHAIN KJ843216_HBc_P-A of FT:mat_peptide KJ843216_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag57). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843217_HBc_P-A Product feature CHAIN KJ843217_HBc_P-A of FT:mat_peptide KJ843217_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag62). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ843218_HBc_P-A Product feature CHAIN KJ843218_HBc_P-A of FT:mat_peptide KJ843218_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag63). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854685_HBc_P-A Product feature CHAIN KJ854685_HBc_P-A of FT:mat_peptide KJ854685_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 116-SE-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MAIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELSTLGTWVGNNLQDQA
SRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854686_HBc_P-A Product feature CHAIN KJ854686_HBc_P-A of FT:mat_peptide KJ854686_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1356-SE-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|KJ854687_HBc_P-A Product feature CHAIN KJ854687_HBc_P-A of FT:mat_peptide KJ854687_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1377-SE-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESHEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854688_HBc_P-A Product feature CHAIN KJ854688_HBc_P-A of FT:mat_peptide KJ854688_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1379-SE-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854689_HBc_P-A Product feature CHAIN KJ854689_HBc_P-A of FT:mat_peptide KJ854689_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16202-NE-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854690_HBc_P-A Product feature CHAIN KJ854690_HBc_P-A of FT:mat_peptide KJ854690_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16338-NE-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTSSALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854691_HBc_P-A Product feature CHAIN KJ854691_HBc_P-A of FT:mat_peptide KJ854691_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16650-NE-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854692_HBc_P-A Product feature CHAIN KJ854692_HBc_P-A of FT:mat_peptide KJ854692_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17372-NE-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854693_HBc_P-A Product feature CHAIN KJ854693_HBc_P-A of FT:mat_peptide KJ854693_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17545-NE-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854694_HBc_P-A Product feature CHAIN KJ854694_HBc_P-A of FT:mat_peptide KJ854694_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17822-NE-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854696_HBc_P-A Product feature CHAIN KJ854696_HBc_P-A of FT:mat_peptide KJ854696_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 18158-SE-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854697_HBc_P-A Product feature CHAIN KJ854697_HBc_P-A of FT:mat_peptide KJ854697_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1969-SE-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854698_HBc_P-A Product feature CHAIN KJ854698_HBc_P-A of FT:mat_peptide KJ854698_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1993-N-BRA). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854699_HBc_P-A Product feature CHAIN KJ854699_HBc_P-A of FT:mat_peptide KJ854699_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2340-N-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854700_HBc_P-A Product feature CHAIN KJ854700_HBc_P-A of FT:mat_peptide KJ854700_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 313-N-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRXVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854701_HBc_P-A Product feature CHAIN KJ854701_HBc_P-A of FT:mat_peptide KJ854701_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 349-SE-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPTARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDILTLGTWVGNNLEDQT
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREXVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KJ854702_HBc_P-A Product feature CHAIN KJ854702_HBc_P-A of FT:mat_peptide KJ854702_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 41-CW-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854703_HBc_P-A Product feature CHAIN KJ854703_HBc_P-A of FT:mat_peptide KJ854703_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 65-SE-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDFDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLXXNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854704_HBc_P-A Product feature CHAIN KJ854704_HBc_P-A of FT:mat_peptide KJ854704_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 66-CW-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854705_HBc_P-A Product feature CHAIN KJ854705_HBc_P-A of FT:mat_peptide KJ854705_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 67-CW-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854706_HBc_P-A Product feature CHAIN KJ854706_HBc_P-A of FT:mat_peptide KJ854706_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 753-CW-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854707_HBc_P-A Product feature CHAIN KJ854707_HBc_P-A of FT:mat_peptide KJ854707_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 895-N-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854708_HBc_P-A Product feature CHAIN KJ854708_HBc_P-A of FT:mat_peptide KJ854708_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16-S-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854709_HBc_P-A Product feature CHAIN KJ854709_HBc_P-A of FT:mat_peptide KJ854709_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24-S-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KJ854710_HBc_P-A Product feature CHAIN KJ854710_HBc_P-A of FT:mat_peptide KJ854710_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 274-SE-BRA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM243029_HBc_P-A Product feature CHAIN KM243029_HBc_P-A of FT:mat_peptide KM243029_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TAC455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM519452_HBc_P-A Product feature CHAIN KM519452_HBc_P-A of FT:mat_peptide KM519452_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_G1862T_Mutant_SA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM519453_HBc_P-A Product feature CHAIN KM519453_HBc_P-A of FT:mat_peptide KM519453_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_Wild_SA). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM519454_HBc_P-A Product feature CHAIN KM519454_HBc_P-A of FT:mat_peptide KM519454_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_WT_BEL). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606647_HBc_P-A Product feature CHAIN KM606647_HBc_P-A of FT:mat_peptide KM606647_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba10a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDHYKEFGATVELLSFLPLDFFPSARDLLETASALYRESLESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQILWFHISCLTFGRDTVLQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606648_HBc_P-A Product feature CHAIN KM606648_HBc_P-A of FT:mat_peptide KM606648_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba14a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606649_HBc_P-A Product feature CHAIN KM606649_HBc_P-A of FT:mat_peptide KM606649_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba15a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPTR
RTPSPRTRISQSPRRKRSQSRQSQC
>gnl|hbvpro|KM606650_HBc_P-A Product feature CHAIN KM606650_HBc_P-A of FT:mat_peptide KM606650_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba16a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDLYKEFGATVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGTWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606652_HBc_P-A Product feature CHAIN KM606652_HBc_P-A of FT:mat_peptide KM606652_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba20a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606653_HBc_P-A Product feature CHAIN KM606653_HBc_P-A of FT:mat_peptide KM606653_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba21a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQEILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606656_HBc_P-A Product feature CHAIN KM606656_HBc_P-A of FT:mat_peptide KM606656_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba26a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606657_HBc_P-A Product feature CHAIN KM606657_HBc_P-A of FT:mat_peptide KM606657_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba29a). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALFRQALESPEHCSPHHTALRQAILCWGELTTLGAWVGNNLEDQA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606658_HBc_P-A Product feature CHAIN KM606658_HBc_P-A of FT:mat_peptide KM606658_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba31a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDHYKEFGASVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606659_HBc_P-A Product feature CHAIN KM606659_HBc_P-A of FT:mat_peptide KM606659_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba33a). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606660_HBc_P-A Product feature CHAIN KM606660_HBc_P-A of FT:mat_peptide KM606660_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba34a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606661_HBc_P-A Product feature CHAIN KM606661_HBc_P-A of FT:mat_peptide KM606661_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba35a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606662_HBc_P-A Product feature CHAIN KM606662_HBc_P-A of FT:mat_peptide KM606662_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba36a). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPHDFFPSAPDLLDTAAALYREALESPEHCTPHHTALRQAILCWGELTTLGSWVGNNLQDQA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRDVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KM606663_HBc_P-A Product feature CHAIN KM606663_HBc_P-A of FT:mat_peptide KM606663_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba38a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606665_HBc_P-A Product feature CHAIN KM606665_HBc_P-A of FT:mat_peptide KM606665_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba40a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606666_HBc_P-A Product feature CHAIN KM606666_HBc_P-A of FT:mat_peptide KM606666_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba41a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606669_HBc_P-A Product feature CHAIN KM606669_HBc_P-A of FT:mat_peptide KM606669_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba45a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606671_HBc_P-A Product feature CHAIN KM606671_HBc_P-A of FT:mat_peptide KM606671_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba50a). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGEVTALGEWVGNNLQDQA
SRDLVVNYVDTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRHRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606672_HBc_P-A Product feature CHAIN KM606672_HBc_P-A of FT:mat_peptide KM606672_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba54a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTPPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606673_HBc_P-A Product feature CHAIN KM606673_HBc_P-A of FT:mat_peptide KM606673_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba55a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606674_HBc_P-A Product feature CHAIN KM606674_HBc_P-A of FT:mat_peptide KM606674_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba56a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606676_HBc_P-A Product feature CHAIN KM606676_HBc_P-A of FT:mat_peptide KM606676_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba59a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606677_HBc_P-A Product feature CHAIN KM606677_HBc_P-A of FT:mat_peptide KM606677_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba60a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606678_HBc_P-A Product feature CHAIN KM606678_HBc_P-A of FT:mat_peptide KM606678_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba61a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606680_HBc_P-A Product feature CHAIN KM606680_HBc_P-A of FT:mat_peptide KM606680_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba66a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606683_HBc_P-A Product feature CHAIN KM606683_HBc_P-A of FT:mat_peptide KM606683_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba69a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606684_HBc_P-A Product feature CHAIN KM606684_HBc_P-A of FT:mat_peptide KM606684_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba71a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606685_HBc_P-A Product feature CHAIN KM606685_HBc_P-A of FT:mat_peptide KM606685_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba72a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606687_HBc_P-A Product feature CHAIN KM606687_HBc_P-A of FT:mat_peptide KM606687_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba75a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606688_HBc_P-A Product feature CHAIN KM606688_HBc_P-A of FT:mat_peptide KM606688_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba78a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606691_HBc_P-A Product feature CHAIN KM606691_HBc_P-A of FT:mat_peptide KM606691_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba82a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606693_HBc_P-A Product feature CHAIN KM606693_HBc_P-A of FT:mat_peptide KM606693_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba84a). Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPLNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606694_HBc_P-A Product feature CHAIN KM606694_HBc_P-A of FT:mat_peptide KM606694_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba85a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606695_HBc_P-A Product feature CHAIN KM606695_HBc_P-A of FT:mat_peptide KM606695_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba86a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESHEHCSPHHTALRQAILCWGELMTLATWAGNNLEDPA
SRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRTRSQSRESQC
>gnl|hbvpro|KM606700_HBc_P-A Product feature CHAIN KM606700_HBc_P-A of FT:mat_peptide KM606700_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba100a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606737_HBc_P-A Product feature CHAIN KM606737_HBc_P-A of FT:mat_peptide KM606737_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba13a). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606742_HBc_P-A Product feature CHAIN KM606742_HBc_P-A of FT:mat_peptide KM606742_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPFDFFPSVRDFLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606746_HBc_P-A Product feature CHAIN KM606746_HBc_P-A of FT:mat_peptide KM606746_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba14). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606748_HBc_P-A Product feature CHAIN KM606748_HBc_P-A of FT:mat_peptide KM606748_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba51). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KM606749_HBc_P-A Product feature CHAIN KM606749_HBc_P-A of FT:mat_peptide KM606749_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba56). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168422_HBc_P-A Product feature CHAIN KP168422_HBc_P-A of FT:mat_peptide KP168422_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN136). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRXRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168423_HBc_P-A Product feature CHAIN KP168423_HBc_P-A of FT:mat_peptide KP168423_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB517). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168424_HBc_P-A Product feature CHAIN KP168424_HBc_P-A of FT:mat_peptide KP168424_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM571). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168425_HBc_P-A Product feature CHAIN KP168425_HBc_P-A of FT:mat_peptide KP168425_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS119). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIFWWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168426_HBc_P-A Product feature CHAIN KP168426_HBc_P-A of FT:mat_peptide KP168426_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM05). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRXPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168427_HBc_P-A Product feature CHAIN KP168427_HBc_P-A of FT:mat_peptide KP168427_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB201). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168428_HBc_P-A Product feature CHAIN KP168428_HBc_P-A of FT:mat_peptide KP168428_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN195). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAVLCWGELMTLATWVGNNLDDXA
SRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRXTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP168429_HBc_P-A Product feature CHAIN KP168429_HBc_P-A of FT:mat_peptide KP168429_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN033). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLXSDFFPSVRDLLDTXSALYREALESPEHCSPHHTALRQAILWWXELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168430_HBc_P-A Product feature CHAIN KP168430_HBc_P-A of FT:mat_peptide KP168430_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB10). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168432_HBc_P-A Product feature CHAIN KP168432_HBc_P-A of FT:mat_peptide KP168432_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB213). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168433_HBc_P-A Product feature CHAIN KP168433_HBc_P-A of FT:mat_peptide KP168433_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB04). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168434_HBc_P-A Product feature CHAIN KP168434_HBc_P-A of FT:mat_peptide KP168434_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM564). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP168435_HBc_P-A Product feature CHAIN KP168435_HBc_P-A of FT:mat_peptide KP168435_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS117). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KP274925_HBc_P-A Product feature CHAIN KP274925_HBc_P-A of FT:mat_peptide KP274925_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP274927_HBc_P-A Product feature CHAIN KP274927_HBc_P-A of FT:mat_peptide KP274927_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP274928_HBc_P-A Product feature CHAIN KP274928_HBc_P-A of FT:mat_peptide KP274928_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-4). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718085_HBc_P-A Product feature CHAIN KP718085_HBc_P-A of FT:mat_peptide KP718085_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-12-1-26). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718086_HBc_P-A Product feature CHAIN KP718086_HBc_P-A of FT:mat_peptide KP718086_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-03-02-1-60). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718087_HBc_P-A Product feature CHAIN KP718087_HBc_P-A of FT:mat_peptide KP718087_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1897). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718088_HBc_P-A Product feature CHAIN KP718088_HBc_P-A of FT:mat_peptide KP718088_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1162). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718089_HBc_P-A Product feature CHAIN KP718089_HBc_P-A of FT:mat_peptide KP718089_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1249). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALEXPEHCSPHHTALRQAIXCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718090_HBc_P-A Product feature CHAIN KP718090_HBc_P-A of FT:mat_peptide KP718090_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1348). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718091_HBc_P-A Product feature CHAIN KP718091_HBc_P-A of FT:mat_peptide KP718091_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1771). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718092_HBc_P-A Product feature CHAIN KP718092_HBc_P-A of FT:mat_peptide KP718092_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1891). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718093_HBc_P-A Product feature CHAIN KP718093_HBc_P-A of FT:mat_peptide KP718093_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1202). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718094_HBc_P-A Product feature CHAIN KP718094_HBc_P-A of FT:mat_peptide KP718094_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8757_TR). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGVKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718095_HBc_P-A Product feature CHAIN KP718095_HBc_P-A of FT:mat_peptide KP718095_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8809_TR). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718096_HBc_P-A Product feature CHAIN KP718096_HBc_P-A of FT:mat_peptide KP718096_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-0004). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718097_HBc_P-A Product feature CHAIN KP718097_HBc_P-A of FT:mat_peptide KP718097_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13-1943). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718098_HBc_P-A Product feature CHAIN KP718098_HBc_P-A of FT:mat_peptide KP718098_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3106_HIV). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718099_HBc_P-A Product feature CHAIN KP718099_HBc_P-A of FT:mat_peptide KP718099_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13-378). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718100_HBc_P-A Product feature CHAIN KP718100_HBc_P-A of FT:mat_peptide KP718100_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 137_HIV). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDXLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP718101_HBc_P-A Product feature CHAIN KP718101_HBc_P-A of FT:mat_peptide KP718101_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP11-3018). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPH
PRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857058_HBc_P-A Product feature CHAIN KP857058_HBc_P-A of FT:mat_peptide KP857058_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857059_HBc_P-A Product feature CHAIN KP857059_HBc_P-A of FT:mat_peptide KP857059_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDLVLEYLVSFGVWIRTPPPYRPQNAPILSTLPETAVVRGSNRGRSPRR
RTPSPRRRRSQSPRRRRSQSRQSQC
>gnl|hbvpro|KP857060_HBc_P-A Product feature CHAIN KP857060_HBc_P-A of FT:mat_peptide KP857060_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPPDFFPSARDLLDTAAALFREALESPEHCSPHHTALRQASLCWVELMTLATWVGNNLQDTA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSMLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|KP857061_HBc_P-A Product feature CHAIN KP857061_HBc_P-A of FT:mat_peptide KP857061_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRQRGRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857062_HBc_P-A Product feature CHAIN KP857062_HBc_P-A of FT:mat_peptide KP857062_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP857063_HBc_P-A Product feature CHAIN KP857063_HBc_P-A of FT:mat_peptide KP857063_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857064_HBc_P-A Product feature CHAIN KP857064_HBc_P-A of FT:mat_peptide KP857064_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALEAPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVLRRRDRGRSPRG
RTPSPRRRRSKSPRRRRSQSREPQC
>gnl|hbvpro|KP857065_HBc_P-A Product feature CHAIN KP857065_HBc_P-A of FT:mat_peptide KP857065_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSAHHTAIRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRGRARGRSPRR
RTPSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KP857066_HBc_P-A Product feature CHAIN KP857066_HBc_P-A of FT:mat_peptide KP857066_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVKDLYDTALALHREALESPEHCTHHHTALRQAILCWGDLMNLANWVGTNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPLNAPILSTLPECTVVRQRGRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857067_HBc_P-A Product feature CHAIN KP857067_HBc_P-A of FT:mat_peptide KP857067_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESAEHCSPHHTALRQAILCWGDVMTLGTWVGNNLDDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVVEYLISFGVWIRTPPAYRPPNAPILSTLPETTVXRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857068_HBc_P-A Product feature CHAIN KP857068_HBc_P-A of FT:mat_peptide KP857068_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTAIRQIVLCWGDVMNLATWVGSNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHTSCLTFGRDTVVEYLVSFGVWIRTPPAYRPLNAPILSTLPETTVVRCRDRRRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857069_HBc_P-A Product feature CHAIN KP857069_HBc_P-A of FT:mat_peptide KP857069_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSSHHTALRQAILCWGELTTLATWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857070_HBc_P-A Product feature CHAIN KP857070_HBc_P-A of FT:mat_peptide KP857070_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDLTTLGSWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVRSRNRGRSPRR
RTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP857071_HBc_P-A Product feature CHAIN KP857071_HBc_P-A of FT:mat_peptide KP857071_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREXLESPEHCSPHHTALRQAILCWGDLTTLGSWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVRSRNRGRSPRR
RTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP857072_HBc_P-A Product feature CHAIN KP857072_HBc_P-A of FT:mat_peptide KP857072_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALFREALESPEHGSSHHTALRQAILCWQEVTTLASWVGTNLDDPS
SRDQVVHYVNTNMGLKIRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857073_HBc_P-A Product feature CHAIN KP857073_HBc_P-A of FT:mat_peptide KP857073_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPADFYPSVRDLLDTATALYREALESPEHCSAHHTAIRQAILCWGELMTLASWVGANLDDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRHTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGGSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857074_HBc_P-A Product feature CHAIN KP857074_HBc_P-A of FT:mat_peptide KP857074_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPNDFYPSVKDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLATWVGNNLEDQA
SRNLVVDYVNNNVGLRLRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857075_HBc_P-A Product feature CHAIN KP857075_HBc_P-A of FT:mat_peptide KP857075_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESSEHCSPHHTALRQAALCWWELTTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVVEYLISFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRDSRC
>gnl|hbvpro|KP857076_HBc_P-A Product feature CHAIN KP857076_HBc_P-A of FT:mat_peptide KP857076_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGEVTXLATWVGTNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHTSCITFGRETVLEYLVSFGVWIRTPPTYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP857077_HBc_P-A Product feature CHAIN KP857077_HBc_P-A of FT:mat_peptide KP857077_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPIDFYPSVRDLIETASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857078_HBc_P-A Product feature CHAIN KP857078_HBc_P-A of FT:mat_peptide KP857078_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPADFFPSTKDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLGTWVGNNLEDQA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRPRHRGRSPRR
RTPSPRRRRSQSPRRRRSQSRDSQC
>gnl|hbvpro|KP857079_HBc_P-A Product feature CHAIN KP857079_HBc_P-A of FT:mat_peptide KP857079_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHXSPHHTALRQAILCWGXVMTLGTWVGBNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857080_HBc_P-A Product feature CHAIN KP857080_HBc_P-A of FT:mat_peptide KP857080_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRXRDRGRAPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857081_HBc_P-A Product feature CHAIN KP857081_HBc_P-A of FT:mat_peptide KP857081_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPADFFPSVKDLLDTASALYREALESXEHCTPHHTALRQAILCWGDVMNLATWVGANLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857082_HBc_P-A Product feature CHAIN KP857082_HBc_P-A of FT:mat_peptide KP857082_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGTKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857083_HBc_P-A Product feature CHAIN KP857083_HBc_P-A of FT:mat_peptide KP857083_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPLNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857084_HBc_P-A Product feature CHAIN KP857084_HBc_P-A of FT:mat_peptide KP857084_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSARDLLATASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVDYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857085_HBc_P-A Product feature CHAIN KP857085_HBc_P-A of FT:mat_peptide KP857085_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPIDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVHEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KP857086_HBc_P-A Product feature CHAIN KP857086_HBc_P-A of FT:mat_peptide KP857086_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASAQLLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWLELMTLATWVGNNLDDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVVEYLVSFGVWIRTPPAYRPLNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857087_HBc_P-A Product feature CHAIN KP857087_HBc_P-A of FT:mat_peptide KP857087_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDLYKEFGATVELLSFLPHDFYPSVRDLLDTASALFREALESPEHCSPHHTALRQAIVCWGELNTLGTWVGNNLEDQA
SRDLVVNYVNNNMGIKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRPRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KP857088_HBc_P-A Product feature CHAIN KP857088_HBc_P-A of FT:mat_peptide KP857088_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPLDFFPSVRDLLDTASALFREALESPEHCSPHHTAIRQAILCWGELMTLANWVGNNLDDPA
SRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRNTVLEYLVSFGVWIRTPPAYRPLNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRRRSKSRESQC
>gnl|hbvpro|KP857089_HBc_P-A Product feature CHAIN KP857089_HBc_P-A of FT:mat_peptide KP857089_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATTELLSFLPSDFFPNIRDLLDTASALFREALESPEHCSAHHTALRQAIICWGELMSLATWVGGNLQDQA
SRDLVVNYVNINMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857091_HBc_P-A Product feature CHAIN KP857091_HBc_P-A of FT:mat_peptide KP857091_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=184 residues).
MDIDPYKEFGATVELLSFLPHDFFPSIRDLLDTASALYREALESPEHCSHHHTAIRQAILCWGELTTLATWVGTNLDDPG
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGGRSPRRR
TPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP857092_HBc_P-A Product feature CHAIN KP857092_HBc_P-A of FT:mat_peptide KP857092_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWVELXTLATWVGNNLEDPA
SRDQVVNYVNTNMGLKLRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KP995108_HBc_P-A Product feature CHAIN KP995108_HBc_P-A of FT:mat_peptide KP995108_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 203-Cirrhosis). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDTYKEFGATVELLSFLPSDFYPSVRDLVDTASALYREALESPEHGSPHHTALRQAIVCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRGSQC
>gnl|hbvpro|KR905425_HBc_P-A Product feature CHAIN KR905425_HBc_P-A of FT:mat_peptide KR905425_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-24). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR905426_HBc_P-A Product feature CHAIN KR905426_HBc_P-A of FT:mat_peptide KR905426_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-28). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR905427_HBc_P-A Product feature CHAIN KR905427_HBc_P-A of FT:mat_peptide KR905427_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-30). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALEAPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KR905429_HBc_P-A Product feature CHAIN KR905429_HBc_P-A of FT:mat_peptide KR905429_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-35). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR905430_HBc_P-A Product feature CHAIN KR905430_HBc_P-A of FT:mat_peptide KR905430_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-47). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KR905431_HBc_P-A Product feature CHAIN KR905431_HBc_P-A of FT:mat_peptide KR905431_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-77). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151611_HBc_P-A Product feature CHAIN KT151611_HBc_P-A of FT:mat_peptide KT151611_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 398). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151612_HBc_P-A Product feature CHAIN KT151612_HBc_P-A of FT:mat_peptide KT151612_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 500). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATSELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPANAPILSTLPETTVIRGRGRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151613_HBc_P-A Product feature CHAIN KT151613_HBc_P-A of FT:mat_peptide KT151613_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 792). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151614_HBc_P-A Product feature CHAIN KT151614_HBc_P-A of FT:mat_peptide KT151614_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 969). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151615_HBc_P-A Product feature CHAIN KT151615_HBc_P-A of FT:mat_peptide KT151615_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 191). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDHYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151616_HBc_P-A Product feature CHAIN KT151616_HBc_P-A of FT:mat_peptide KT151616_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 655). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151617_HBc_P-A Product feature CHAIN KT151617_HBc_P-A of FT:mat_peptide KT151617_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 803). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATSELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPXNAPILSTLPETTVIRGRGRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT151618_HBc_P-A Product feature CHAIN KT151618_HBc_P-A of FT:mat_peptide KT151618_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 590). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT347087_HBc_P-A Product feature CHAIN KT347087_HBc_P-A of FT:mat_peptide KT347087_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM265). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT347088_HBc_P-A Product feature CHAIN KT347088_HBc_P-A of FT:mat_peptide KT347088_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM285). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366466_HBc_P-A Product feature CHAIN KT366466_HBc_P-A of FT:mat_peptide KT366466_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.7). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366467_HBc_P-A Product feature CHAIN KT366467_HBc_P-A of FT:mat_peptide KT366467_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.9). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366468_HBc_P-A Product feature CHAIN KT366468_HBc_P-A of FT:mat_peptide KT366468_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.27). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366469_HBc_P-A Product feature CHAIN KT366469_HBc_P-A of FT:mat_peptide KT366469_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.28). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366470_HBc_P-A Product feature CHAIN KT366470_HBc_P-A of FT:mat_peptide KT366470_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.31). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT366471_HBc_P-A Product feature CHAIN KT366471_HBc_P-A of FT:mat_peptide KT366471_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.50). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749822_HBc_P-A Product feature CHAIN KT749822_HBc_P-A of FT:mat_peptide KT749822_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL19). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVRHRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749824_HBc_P-A Product feature CHAIN KT749824_HBc_P-A of FT:mat_peptide KT749824_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL2b). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLGFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749825_HBc_P-A Product feature CHAIN KT749825_HBc_P-A of FT:mat_peptide KT749825_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4a). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749826_HBc_P-A Product feature CHAIN KT749826_HBc_P-A of FT:mat_peptide KT749826_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4b). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749829_HBc_P-A Product feature CHAIN KT749829_HBc_P-A of FT:mat_peptide KT749829_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL7). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749830_HBc_P-A Product feature CHAIN KT749830_HBc_P-A of FT:mat_peptide KT749830_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5b). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749831_HBc_P-A Product feature CHAIN KT749831_HBc_P-A of FT:mat_peptide KT749831_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL8). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749832_HBc_P-A Product feature CHAIN KT749832_HBc_P-A of FT:mat_peptide KT749832_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL10). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELISFLPADFFPSVRDLLDTASALFREALESPEHCSAHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749833_HBc_P-A Product feature CHAIN KT749833_HBc_P-A of FT:mat_peptide KT749833_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9b). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDTYKEFGATVELLSFLPSDFFPSVRDLVDTASALHREALESPEHCSPHHTALRQAIVCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749834_HBc_P-A Product feature CHAIN KT749834_HBc_P-A of FT:mat_peptide KT749834_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9a). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRIRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749835_HBc_P-A Product feature CHAIN KT749835_HBc_P-A of FT:mat_peptide KT749835_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9c). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749836_HBc_P-A Product feature CHAIN KT749836_HBc_P-A of FT:mat_peptide KT749836_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL12). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749837_HBc_P-A Product feature CHAIN KT749837_HBc_P-A of FT:mat_peptide KT749837_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL15). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749838_HBc_P-A Product feature CHAIN KT749838_HBc_P-A of FT:mat_peptide KT749838_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL16). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749839_HBc_P-A Product feature CHAIN KT749839_HBc_P-A of FT:mat_peptide KT749839_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5d). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRT
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749840_HBc_P-A Product feature CHAIN KT749840_HBc_P-A of FT:mat_peptide KT749840_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL18). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749842_HBc_P-A Product feature CHAIN KT749842_HBc_P-A of FT:mat_peptide KT749842_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4e). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749843_HBc_P-A Product feature CHAIN KT749843_HBc_P-A of FT:mat_peptide KT749843_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5c). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASAMYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749844_HBc_P-A Product feature CHAIN KT749844_HBc_P-A of FT:mat_peptide KT749844_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL25). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749846_HBc_P-A Product feature CHAIN KT749846_HBc_P-A of FT:mat_peptide KT749846_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4f). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749847_HBc_P-A Product feature CHAIN KT749847_HBc_P-A of FT:mat_peptide KT749847_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4d). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749849_HBc_P-A Product feature CHAIN KT749849_HBc_P-A of FT:mat_peptide KT749849_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4c). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KT749850_HBc_P-A Product feature CHAIN KT749850_HBc_P-A of FT:mat_peptide KT749850_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL21). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605516_HBc_P-A Product feature CHAIN KU605516_HBc_P-A of FT:mat_peptide KU605516_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605517_HBc_P-A Product feature CHAIN KU605517_HBc_P-A of FT:mat_peptide KU605517_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486F2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605518_HBc_P-A Product feature CHAIN KU605518_HBc_P-A of FT:mat_peptide KU605518_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605519_HBc_P-A Product feature CHAIN KU605519_HBc_P-A of FT:mat_peptide KU605519_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605520_HBc_P-A Product feature CHAIN KU605520_HBc_P-A of FT:mat_peptide KU605520_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605521_HBc_P-A Product feature CHAIN KU605521_HBc_P-A of FT:mat_peptide KU605521_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163F2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605522_HBc_P-A Product feature CHAIN KU605522_HBc_P-A of FT:mat_peptide KU605522_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163F4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605532_HBc_P-A Product feature CHAIN KU605532_HBc_P-A of FT:mat_peptide KU605532_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486Baseline). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605533_HBc_P-A Product feature CHAIN KU605533_HBc_P-A of FT:mat_peptide KU605533_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787Baseline). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605534_HBc_P-A Product feature CHAIN KU605534_HBc_P-A of FT:mat_peptide KU605534_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605535_HBc_P-A Product feature CHAIN KU605535_HBc_P-A of FT:mat_peptide KU605535_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163Baseline). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605536_HBc_P-A Product feature CHAIN KU605536_HBc_P-A of FT:mat_peptide KU605536_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643Baseline). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605537_HBc_P-A Product feature CHAIN KU605537_HBc_P-A of FT:mat_peptide KU605537_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605538_HBc_P-A Product feature CHAIN KU605538_HBc_P-A of FT:mat_peptide KU605538_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU605539_HBc_P-A Product feature CHAIN KU605539_HBc_P-A of FT:mat_peptide KU605539_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU736918_HBc_P-A Product feature CHAIN KU736918_HBc_P-A of FT:mat_peptide KU736918_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU736919_HBc_P-A Product feature CHAIN KU736919_HBc_P-A of FT:mat_peptide KU736919_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KU736920_HBc_P-A Product feature CHAIN KU736920_HBc_P-A of FT:mat_peptide KU736920_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Sudan_10). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKXFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX276769_HBc_P-A Product feature CHAIN KX276769_HBc_P-A of FT:mat_peptide KX276769_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSSHHTALRQAILCWGELMTLASWVGNNLQDPA
SRDQVVSYVNTNMGLKIRQLLWFHISCLTFGRDAVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|KX357640_HBc_P-A Product feature CHAIN KX357640_HBc_P-A of FT:mat_peptide KX357640_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA11ETH). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTNLATWVGTNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KX357642_HBc_P-A Product feature CHAIN KX357642_HBc_P-A of FT:mat_peptide KX357642_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JM16ETH). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX357643_HBc_P-A Product feature CHAIN KX357643_HBc_P-A of FT:mat_peptide KX357643_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MK156ETH). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX357644_HBc_P-A Product feature CHAIN KX357644_HBc_P-A of FT:mat_peptide KX357644_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA152ETH). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATTELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRNRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX357645_HBc_P-A Product feature CHAIN KX357645_HBc_P-A of FT:mat_peptide KX357645_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA162ETH). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX357646_HBc_P-A Product feature CHAIN KX357646_HBc_P-A of FT:mat_peptide KX357646_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL185ETH). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX357647_HBc_P-A Product feature CHAIN KX357647_HBc_P-A of FT:mat_peptide KX357647_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL13ETH). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX357649_HBc_P-A Product feature CHAIN KX357649_HBc_P-A of FT:mat_peptide KX357649_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA86ETH). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPRDFYPSVRDLIDTASALFREALESPEHCSPHHTALRQAVLCWGELMTLAXWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSTRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX357650_HBc_P-A Product feature CHAIN KX357650_HBc_P-A of FT:mat_peptide KX357650_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA46ETH). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGDVINLSTWVGQNLEDPA
SRDLVVNYVNTNIGLKTRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX648547_HBc_P-A Product feature CHAIN KX648547_HBc_P-A of FT:mat_peptide KX648547_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi12_103). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATXELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGXGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX648548_HBc_P-A Product feature CHAIN KX648548_HBc_P-A of FT:mat_peptide KX648548_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_091). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX648549_HBc_P-A Product feature CHAIN KX648549_HBc_P-A of FT:mat_peptide KX648549_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_172). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRXPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX686607_HBc_P-A Product feature CHAIN KX686607_HBc_P-A of FT:mat_peptide KX686607_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1522). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX827293_HBc_P-A Product feature CHAIN KX827293_HBc_P-A of FT:mat_peptide KX827293_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno5.4). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIGQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX827294_HBc_P-A Product feature CHAIN KX827294_HBc_P-A of FT:mat_peptide KX827294_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.2). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX827295_HBc_P-A Product feature CHAIN KX827295_HBc_P-A of FT:mat_peptide KX827295_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.3). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIPCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX827296_HBc_P-A Product feature CHAIN KX827296_HBc_P-A of FT:mat_peptide KX827296_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.5). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVGDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KX827298_HBc_P-A Product feature CHAIN KX827298_HBc_P-A of FT:mat_peptide KX827298_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno9.4). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVDYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY003230_HBc_P-A Product feature CHAIN KY003230_HBc_P-A of FT:mat_peptide KY003230_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 20160922). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY271389_HBc_P-A Product feature CHAIN KY271389_HBc_P-A of FT:mat_peptide KY271389_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C34803). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY271390_HBc_P-A Product feature CHAIN KY271390_HBc_P-A of FT:mat_peptide KY271390_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C34575). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTTSALCREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDQVVNYVNTNMGLKIRQLLWFHLSCITFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY271391_HBc_P-A Product feature CHAIN KY271391_HBc_P-A of FT:mat_peptide KY271391_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C34058). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTTLATWVGQNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY353909_HBc_P-A Product feature CHAIN KY353909_HBc_P-A of FT:mat_peptide KY353909_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M-HBV.18). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRCRNRVRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY353912_HBc_P-A Product feature CHAIN KY353912_HBc_P-A of FT:mat_peptide KY353912_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M-HBV.23). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY353913_HBc_P-A Product feature CHAIN KY353913_HBc_P-A of FT:mat_peptide KY353913_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M-HBV.32). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLATWVGTNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY353915_HBc_P-A Product feature CHAIN KY353915_HBc_P-A of FT:mat_peptide KY353915_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M-HBV.50). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDLYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAIVCWGELMTLGSWVGNNLEDQA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KY353916_HBc_P-A Product feature CHAIN KY353916_HBc_P-A of FT:mat_peptide KY353916_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M-HBV.51). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRQQYRGRSSRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY353917_HBc_P-A Product feature CHAIN KY353917_HBc_P-A of FT:mat_peptide KY353917_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M-HBV.52). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESHC
>gnl|hbvpro|KY353918_HBc_P-A Product feature CHAIN KY353918_HBc_P-A of FT:mat_peptide KY353918_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M-HBV.58). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALFRDALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRPTVLEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY353919_HBc_P-A Product feature CHAIN KY353919_HBc_P-A of FT:mat_peptide KY353919_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M-HBV.3). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTSSALFREALESPEHCSHHHTARRQAIICWVELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|KY353926_HBc_P-A Product feature CHAIN KY353926_HBc_P-A of FT:mat_peptide KY353926_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate M-HBV.14). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTAIRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRQRYRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY382410_HBc_P-A Product feature CHAIN KY382410_HBc_P-A of FT:mat_peptide KY382410_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_wt). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|KY886219_HBc_P-A Product feature CHAIN KY886219_HBc_P-A of FT:mat_peptide KY886219_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|L13994_HBc_P-A Product feature CHAIN L13994_HBc_P-A of FT:mat_peptide L13994_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC051141_HBc_P-A Product feature CHAIN LC051141_HBc_P-A of FT:mat_peptide LC051141_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0620). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC074724_HBc_P-A Product feature CHAIN LC074724_HBc_P-A of FT:mat_peptide LC074724_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p621). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC311241_HBc_P-A Product feature CHAIN LC311241_HBc_P-A of FT:mat_peptide LC311241_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p509). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC311242_HBc_P-A Product feature CHAIN LC311242_HBc_P-A of FT:mat_peptide LC311242_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p90). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPNHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC311243_HBc_P-A Product feature CHAIN LC311243_HBc_P-A of FT:mat_peptide LC311243_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p121). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC458430_HBc_P-A Product feature CHAIN LC458430_HBc_P-A of FT:mat_peptide LC458430_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB01). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LC458431_HBc_P-A Product feature CHAIN LC458431_HBc_P-A of FT:mat_peptide LC458431_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB03). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LK995385_HBc_P-A Product feature CHAIN LK995385_HBc_P-A of FT:mat_peptide LK995385_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NAT2037658). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LT992440_HBc_P-A Product feature CHAIN LT992440_HBc_P-A of FT:mat_peptide LT992440_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DA119). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LT992441_HBc_P-A Product feature CHAIN LT992441_HBc_P-A of FT:mat_peptide LT992441_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DA195). Complete genome. [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|LT992448_HBc_P-A Product feature CHAIN LT992448_HBc_P-A of FT:mat_peptide LT992448_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RISE386). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=183 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRT
PSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|M57663_HBc_P-A Product feature CHAIN M57663_HBc_P-A of FT:mat_peptide M57663_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|M74501_HBc_P-A Product feature CHAIN M74501_HBc_P-A of FT:mat_peptide M74501_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF536836_HBc_P-A Product feature CHAIN MF536836_HBc_P-A of FT:mat_peptide MF536836_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate T2029C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=186 residues).
MDIDPYKEFGASVELLSFLPTDFFPSVRDLLHTASALYREALESPEHCSSHHTALRQAILCWGELLYSLPTWVGNNLQDP
ASRDLHVNYVNTNMGLKIRQLLWFHISCLTFGRLVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRCRDRVRSPR
RRTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF772344_HBc_P-A Product feature CHAIN MF772344_HBc_P-A of FT:mat_peptide MF772344_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV1662). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF772345_HBc_P-A Product feature CHAIN MF772345_HBc_P-A of FT:mat_peptide MF772345_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1959). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVDLLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKLRQILWFHISCLTFGRETVLEYLVDFGVWIRTPPAYRPPNAPILSTLPETCVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF772346_HBc_P-A Product feature CHAIN MF772346_HBc_P-A of FT:mat_peptide MF772346_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 855_16). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATTELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF772347_HBc_P-A Product feature CHAIN MF772347_HBc_P-A of FT:mat_peptide MF772347_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 970). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALKSPEHCSPHHTALRQAILCWGDVTTLATWVGQNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF772348_HBc_P-A Product feature CHAIN MF772348_HBc_P-A of FT:mat_peptide MF772348_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV120). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRDTVLEYLVSFGVWIRTPPAYRPLNAPILSTLPETTVVRRRDRVRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF772350_HBc_P-A Product feature CHAIN MF772350_HBc_P-A of FT:mat_peptide MF772350_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 64106). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF772351_HBc_P-A Product feature CHAIN MF772351_HBc_P-A of FT:mat_peptide MF772351_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1141). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF772353_HBc_P-A Product feature CHAIN MF772353_HBc_P-A of FT:mat_peptide MF772353_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV580). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWXGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925361_HBc_P-A Product feature CHAIN MF925361_HBc_P-A of FT:mat_peptide MF925361_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV04). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925362_HBc_P-A Product feature CHAIN MF925362_HBc_P-A of FT:mat_peptide MF925362_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV05). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPHDFFPNVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVMNLATWVGTNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGQGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925368_HBc_P-A Product feature CHAIN MF925368_HBc_P-A of FT:mat_peptide MF925368_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV12). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGTWVGNNLQDPA
SRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925372_HBc_P-A Product feature CHAIN MF925372_HBc_P-A of FT:mat_peptide MF925372_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV16). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLDDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWLRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MF925373_HBc_P-A Product feature CHAIN MF925373_HBc_P-A of FT:mat_peptide MF925373_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV17). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRAPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MF925385_HBc_P-A Product feature CHAIN MF925385_HBc_P-A of FT:mat_peptide MF925385_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV29). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MF925400_HBc_P-A Product feature CHAIN MF925400_HBc_P-A of FT:mat_peptide MF925400_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV46). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRNRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESKC
>gnl|hbvpro|MF925407_HBc_P-A Product feature CHAIN MF925407_HBc_P-A of FT:mat_peptide MF925407_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV54). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464808_HBc_P-A Product feature CHAIN MH464808_HBc_P-A of FT:mat_peptide MH464808_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA86). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKKFGAXVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAXRQAILCWGEXMXLAXWVGNNLZDPX
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREXQC
>gnl|hbvpro|MH464809_HBc_P-A Product feature CHAIN MH464809_HBc_P-A of FT:mat_peptide MH464809_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA87). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWXELMXLATWVGXNLZDPA
SRDLVVNYVNTNMGLKXRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRCRARGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464810_HBc_P-A Product feature CHAIN MH464810_HBc_P-A of FT:mat_peptide MH464810_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA88). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464813_HBc_P-A Product feature CHAIN MH464813_HBc_P-A of FT:mat_peptide MH464813_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA91). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464814_HBc_P-A Product feature CHAIN MH464814_HBc_P-A of FT:mat_peptide MH464814_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA92). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464815_HBc_P-A Product feature CHAIN MH464815_HBc_P-A of FT:mat_peptide MH464815_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA93). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464817_HBc_P-A Product feature CHAIN MH464817_HBc_P-A of FT:mat_peptide MH464817_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA95). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATXELLSFLPPDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLATWVGNNLDDPA
SRDLVVNYVNTNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRTQSRESQC
>gnl|hbvpro|MH464818_HBc_P-A Product feature CHAIN MH464818_HBc_P-A of FT:mat_peptide MH464818_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA96). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464825_HBc_P-A Product feature CHAIN MH464825_HBc_P-A of FT:mat_peptide MH464825_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA103). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPPVRDLLGTAAALYREALESSDHCSPHHTALRQALLCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MH464828_HBc_P-A Product feature CHAIN MH464828_HBc_P-A of FT:mat_peptide MH464828_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA106). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH464830_HBc_P-A Product feature CHAIN MH464830_HBc_P-A of FT:mat_peptide MH464830_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA108). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH580627_HBc_P-A Product feature CHAIN MH580627_HBc_P-A of FT:mat_peptide MH580627_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 299). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH580639_HBc_P-A Product feature CHAIN MH580639_HBc_P-A of FT:mat_peptide MH580639_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 420). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH580642_HBc_P-A Product feature CHAIN MH580642_HBc_P-A of FT:mat_peptide MH580642_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 443). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH580643_HBc_P-A Product feature CHAIN MH580643_HBc_P-A of FT:mat_peptide MH580643_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 446). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MH932713_HBc_P-A Product feature CHAIN MH932713_HBc_P-A of FT:mat_peptide MH932713_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Hiroshima GtA CL1). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512455_HBc_P-A Product feature CHAIN MK512455_HBc_P-A of FT:mat_peptide MK512455_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2079). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALNREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRELLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRCRDRGRSPRR
RTPSPRRRRSQSPRRKRSQSRESKC
>gnl|hbvpro|MK512456_HBc_P-A Product feature CHAIN MK512456_HBc_P-A of FT:mat_peptide MK512456_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw3531). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSARDLLETASALFREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCITFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK512457_HBc_P-A Product feature CHAIN MK512457_HBc_P-A of FT:mat_peptide MK512457_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw3173). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLATWVGTNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512458_HBc_P-A Product feature CHAIN MK512458_HBc_P-A of FT:mat_peptide MK512458_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2244). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPDDCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWILTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512459_HBc_P-A Product feature CHAIN MK512459_HBc_P-A of FT:mat_peptide MK512459_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2226). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512460_HBc_P-A Product feature CHAIN MK512460_HBc_P-A of FT:mat_peptide MK512460_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2199). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRKQKSQSPRRKRSQSRESQC
>gnl|hbvpro|MK512461_HBc_P-A Product feature CHAIN MK512461_HBc_P-A of FT:mat_peptide MK512461_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2157). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTAIRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK512462_HBc_P-A Product feature CHAIN MK512462_HBc_P-A of FT:mat_peptide MK512462_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2113). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK512463_HBc_P-A Product feature CHAIN MK512463_HBc_P-A of FT:mat_peptide MK512463_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2086). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRQRSQSPRRRKSQSRESQC
>gnl|hbvpro|MK512464_HBc_P-A Product feature CHAIN MK512464_HBc_P-A of FT:mat_peptide MK512464_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2016). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVLRRRDRGRSPRR
RTPSPRRRRFQSPRRRRSQSRESQC
>gnl|hbvpro|MK512465_HBc_P-A Product feature CHAIN MK512465_HBc_P-A of FT:mat_peptide MK512465_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2003). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREGLESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512466_HBc_P-A Product feature CHAIN MK512466_HBc_P-A of FT:mat_peptide MK512466_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-226). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKISQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512467_HBc_P-A Product feature CHAIN MK512467_HBc_P-A of FT:mat_peptide MK512467_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-220). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELRTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGEWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512468_HBc_P-A Product feature CHAIN MK512468_HBc_P-A of FT:mat_peptide MK512468_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-203). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512469_HBc_P-A Product feature CHAIN MK512469_HBc_P-A of FT:mat_peptide MK512469_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-136). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK512470_HBc_P-A Product feature CHAIN MK512470_HBc_P-A of FT:mat_peptide MK512470_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-126). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512471_HBc_P-A Product feature CHAIN MK512471_HBc_P-A of FT:mat_peptide MK512471_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-120). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAGALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512472_HBc_P-A Product feature CHAIN MK512472_HBc_P-A of FT:mat_peptide MK512472_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-65). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512473_HBc_P-A Product feature CHAIN MK512473_HBc_P-A of FT:mat_peptide MK512473_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-48). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512474_HBc_P-A Product feature CHAIN MK512474_HBc_P-A of FT:mat_peptide MK512474_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-37). Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|MK512475_HBc_P-A Product feature CHAIN MK512475_HBc_P-A of FT:mat_peptide MK512475_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-25). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|MK512476_HBc_P-A Product feature CHAIN MK512476_HBc_P-A of FT:mat_peptide MK512476_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-14). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSREPQC
>gnl|hbvpro|V00866_HBc_P-A Product feature CHAIN V00866_HBc_P-A of FT:mat_peptide V00866_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Non-functional genomic sequence. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X02763_HBc_C-A Product feature CHAIN X02763_HBc_C-A of FT:mat_peptide X02763_HBc_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSPSPRRRRSQSRESQC
>gnl|hbvpro|X07911_HBc_P-A Product feature CHAIN X07911_HBc_P-A of FT:mat_peptide X07911_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X51970_HBc_P-A Product feature CHAIN X51970_HBc_P-A of FT:mat_peptide X51970_HBc_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|X70185_HBc_P-A Product feature CHAIN X70185_HBc_P-A of FT:mat_peptide X70185_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A938). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|Z35717_HBc_P-A Product feature CHAIN Z35717_HBc_P-A of FT:mat_peptide Z35717_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hb614). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
>gnl|hbvpro|Z72478_HBc_P-A Product feature CHAIN Z72478_HBc_P-A of FT:mat_peptide Z72478_HBc_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A317). Complete genome. [Hepadnaviridae] (length=185 residues).
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPA
SRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRDRGRSPRR
RTPSPRRRRSQSPRRRRSQSRESQC
© 1998-2019